4 result(s) have been found!
| Accession | Name | Sequence | Source/Organism | Mechanism | Assay Type | Cell Line | Cancer Type | Activity |
|---|---|---|---|---|---|---|---|---|
| dbacp02096 | Buforin Iib | RAGLQFPVGRLLRRLLRRLLR | Not found | Inducing apoptosis | MTT/MTS assay | SKOV3 | Not specified | IC50 : 12.6 µg/ml |
| dbacp03745 | LfcinB (Bovine lactoferricin) | FKCRRWQWRM | Not found | Inducing apoptosis | MTT assay | SKov3 | Leukemia | Not found |
| dbacp05666 | Protein GPR15LG (Antimicrobial peptide with 57 amino acid residues) (AP-57) (Antimicrobial peptide-57) (Colon-derived SUSD2 binding factor) (CSBF) (Protein GPR15 ligand) (Protein GPR15L) (Secreted protein C10orf99) | MRLLVLSSLLCILLLCFSIFSTEGKRRPAKAWSGRRTRLCCHRVPSPNSTNLKGHHVRLCKPCKLEPEPRLWVVPGALPQV | Human | Cytotoxic effects | SDS-PAGE assay | SKOV3 | Colorectal cancer | Not found |
| dbacp06307 | TLS peptide | TLSGAFELSRDK | Not found | Inducing apoptosis | Not specified | SKOV3 | Ovarian cancer | Not found |