dbACP: A Comprehensive Database of Anti-Cancer Peptides

4 result(s) have been found!

Accession Name Sequence Source/Organism Mechanism Assay Type Cell Line Cancer Type Activity
dbacp02096 Buforin Iib RAGLQFPVGRLLRRLLRRLLR Not found Inducing apoptosis MTT/MTS assay SKOV3 Not specified IC50 : 12.6 µg/ml
dbacp03745 LfcinB (Bovine lactoferricin) FKCRRWQWRM Not found Inducing apoptosis MTT assay SKov3 Leukemia Not found
dbacp05666 Protein GPR15LG (Antimicrobial peptide with 57 amino acid residues) (AP-57) (Antimicrobial peptide-57) (Colon-derived SUSD2 binding factor) (CSBF) (Protein GPR15 ligand) (Protein GPR15L) (Secreted protein C10orf99) MRLLVLSSLLCILLLCFSIFSTEGKRRPAKAWSGRRTRLCCHRVPSPNSTNLKGHHVRLCKPCKLEPEPRLWVVPGALPQV Human Cytotoxic effects SDS-PAGE assay SKOV3 Colorectal cancer Not found
dbacp06307 TLS peptide TLSGAFELSRDK Not found Inducing apoptosis Not specified SKOV3 Ovarian cancer Not found