dbACP: A Comprehensive Database of Anti-Cancer Peptides

16 result(s) have been found!

Accession Name Sequence Source/Organism Mechanism Assay Type Cell Line Cancer Type Activity
dbacp06924 #2(D33-N52) RRRRRRRRGGDRDYKKFWAGLQGLTIYFYN STAP-2 PH domain–derived peptide Inhibition of cell signalling CellTiter-Glo assay DU-145 Liver Cancer Graph figure 1-B
dbacp06925 #2(D33-N52) RRRRRRRRGGDRDYKKFWAGLQGLTIYFYN STAP-2 PH domain–derived peptide Inhibition of cell signalling CellTiter-Glo assay MCF-7 Breast Cancer Graph figure 1-B
dbacp06926 #5(D93-F112) RRRRRRRRGGDQEIKFKVETLECREMWKGF STAP-2 PH domain–derived peptide Inhibition of cell signalling CellTiter-Glo assay DU-145 Liver Cancer Graph figure 1-B
dbacp06927 #6(M108-L127) RRRRRRRRGGMWKGFILTVVELRVPTDLTL STAP-2 PH domain–derived peptide Inhibition of cell signalling CellTiter-Glo assay DU-145 Liver Cancer Graph figure 1-B
dbacp06928 #6(M108-L127) RRRRRRRRGGMWKGFILTVVELRVPTDLTL STAP-2 PH domain–derived peptide Inhibition of cell signalling CellTiter-Glo assay MCF-7 Breast Cancer Graph figure 1-B
dbacp06929 2A(F39-Q58) RRRRRRRRGGFWAGLQGLTIYFYNSNRDFQ STAP-2 PH domain–derived peptide Inhibition of cell signalling CellTiter-Glo assay DU-145 Liver Cancer Graph figure 1-C
dbacp06930 2C(Q44-Q58) RRRRRRRRGGQGLTIYFYNSNRDFQ STAP-2 PH domain–derived peptide Inhibition of cell signalling CellTiter-Glo assay DU-145 Liver Cancer Graph figure 1-C
dbacp06931 2D(Q44-R55) RRRRRRRRGGQGLTIYFYNSNR STAP-2 PH domain–derived peptide Inhibition of cell signalling CellTiter-Glo assay DU-145 Liver Cancer Graph figure 1-C
dbacp06932 2D2(Q44-Y51) RRRRRRRRGGQGLTIYFY STAP-2 PH domain–derived peptide Inhibition of cell signalling CellTiter-Glo assay DU-145 Liver Cancer Graph figure 1-C
dbacp06933 2D3(G45-N52) RRRRRRRRGGGLTIYFYN STAP-2 PH domain–derived peptide Inhibition of cell signalling CellTiter-Glo assay DU-145 Liver Cancer Graph figure 1-C
dbacp06934 2D5(G45-Y51) RRRRRRRRGGGLTIYFY STAP-2 PH domain–derived peptide Inhibition of cell signalling CellTiter-Glo assay DU-145 Liver Cancer IC50 = 19.4 μM
dbacp06935 6E(V116-M135) RRRRRRRRGGVVELRVPTDLTLLPGHLYMM STAP-2 PH domain–derived peptide Inhibition of cell signalling CellTiter-Glo assay DU-145 Liver Cancer Graph figure 1-D
dbacp06936 6F (I113-P122) RRRRRRRRGGILTVVELRVP STAP-2 PH domain–derived peptide Inhibition of cell signalling CellTiter-Glo assay DU-145 Liver Cancer Graph figure 1-D
dbacp06937 TAT-2D5 GRKKRRQRRRPPQGGLTIYFY STAP-2 PH domain–derived peptide Inhibition of cell signalling CellTiter-Glo assay DU-145 Liver Cancer Graph figure 1-G
dbacp06938 HTLV-II-Rex-2D5 TRRQRTRRARRNRGGLTIYFY STAP-2 PH domain–derived peptide Inhibition of cell signalling CellTiter-Glo assay DU-145 Liver Cancer Graph figure 1-G
dbacp06939 FHV-2D5 RRRRNRTRRNRRRVRGGLTIYFY STAP-2 PH domain–derived peptide Inhibition of cell signalling CellTiter-Glo assay DU-145 Liver Cancer Graph figure 1-G