16 result(s) have been found!
| Accession | Name | Sequence | Source/Organism | Mechanism | Assay Type | Cell Line | Cancer Type | Activity |
|---|---|---|---|---|---|---|---|---|
| dbacp06924 | #2(D33-N52) | RRRRRRRRGGDRDYKKFWAGLQGLTIYFYN | STAP-2 PH domain–derived peptide | Inhibition of cell signalling | CellTiter-Glo assay | DU-145 | Liver Cancer | Graph figure 1-B |
| dbacp06925 | #2(D33-N52) | RRRRRRRRGGDRDYKKFWAGLQGLTIYFYN | STAP-2 PH domain–derived peptide | Inhibition of cell signalling | CellTiter-Glo assay | MCF-7 | Breast Cancer | Graph figure 1-B |
| dbacp06926 | #5(D93-F112) | RRRRRRRRGGDQEIKFKVETLECREMWKGF | STAP-2 PH domain–derived peptide | Inhibition of cell signalling | CellTiter-Glo assay | DU-145 | Liver Cancer | Graph figure 1-B |
| dbacp06927 | #6(M108-L127) | RRRRRRRRGGMWKGFILTVVELRVPTDLTL | STAP-2 PH domain–derived peptide | Inhibition of cell signalling | CellTiter-Glo assay | DU-145 | Liver Cancer | Graph figure 1-B |
| dbacp06928 | #6(M108-L127) | RRRRRRRRGGMWKGFILTVVELRVPTDLTL | STAP-2 PH domain–derived peptide | Inhibition of cell signalling | CellTiter-Glo assay | MCF-7 | Breast Cancer | Graph figure 1-B |
| dbacp06929 | 2A(F39-Q58) | RRRRRRRRGGFWAGLQGLTIYFYNSNRDFQ | STAP-2 PH domain–derived peptide | Inhibition of cell signalling | CellTiter-Glo assay | DU-145 | Liver Cancer | Graph figure 1-C |
| dbacp06930 | 2C(Q44-Q58) | RRRRRRRRGGQGLTIYFYNSNRDFQ | STAP-2 PH domain–derived peptide | Inhibition of cell signalling | CellTiter-Glo assay | DU-145 | Liver Cancer | Graph figure 1-C |
| dbacp06931 | 2D(Q44-R55) | RRRRRRRRGGQGLTIYFYNSNR | STAP-2 PH domain–derived peptide | Inhibition of cell signalling | CellTiter-Glo assay | DU-145 | Liver Cancer | Graph figure 1-C |
| dbacp06932 | 2D2(Q44-Y51) | RRRRRRRRGGQGLTIYFY | STAP-2 PH domain–derived peptide | Inhibition of cell signalling | CellTiter-Glo assay | DU-145 | Liver Cancer | Graph figure 1-C |
| dbacp06933 | 2D3(G45-N52) | RRRRRRRRGGGLTIYFYN | STAP-2 PH domain–derived peptide | Inhibition of cell signalling | CellTiter-Glo assay | DU-145 | Liver Cancer | Graph figure 1-C |
| dbacp06934 | 2D5(G45-Y51) | RRRRRRRRGGGLTIYFY | STAP-2 PH domain–derived peptide | Inhibition of cell signalling | CellTiter-Glo assay | DU-145 | Liver Cancer | IC50 = 19.4 μM |
| dbacp06935 | 6E(V116-M135) | RRRRRRRRGGVVELRVPTDLTLLPGHLYMM | STAP-2 PH domain–derived peptide | Inhibition of cell signalling | CellTiter-Glo assay | DU-145 | Liver Cancer | Graph figure 1-D |
| dbacp06936 | 6F (I113-P122) | RRRRRRRRGGILTVVELRVP | STAP-2 PH domain–derived peptide | Inhibition of cell signalling | CellTiter-Glo assay | DU-145 | Liver Cancer | Graph figure 1-D |
| dbacp06937 | TAT-2D5 | GRKKRRQRRRPPQGGLTIYFY | STAP-2 PH domain–derived peptide | Inhibition of cell signalling | CellTiter-Glo assay | DU-145 | Liver Cancer | Graph figure 1-G |
| dbacp06938 | HTLV-II-Rex-2D5 | TRRQRTRRARRNRGGLTIYFY | STAP-2 PH domain–derived peptide | Inhibition of cell signalling | CellTiter-Glo assay | DU-145 | Liver Cancer | Graph figure 1-G |
| dbacp06939 | FHV-2D5 | RRRRNRTRRNRRRVRGGLTIYFY | STAP-2 PH domain–derived peptide | Inhibition of cell signalling | CellTiter-Glo assay | DU-145 | Liver Cancer | Graph figure 1-G |