dbACP: A Comprehensive Database of Anti-Cancer Peptides

45 result(s) have been found!

Accession Name Sequence Source/Organism Mechanism Assay Type Cell Line Cancer Type Activity
dbacp03122 Gomesin ECRRLCYKQRCVTYCRGR Hemocytes, Tarantula spider sp. Cell membrane disintegration Not specified Not found Breast cancer Not found
dbacp03123 Gomesin QCRRLCYKQRCVTYCRGR Hemocytes, Tarantula spider sp. Cell membrane disintegration Not specified Not found Breast cancer Not found
dbacp03124 Gomesin GCRRLCYKQRCVTYCRGR Tarantula spider sp. Membrane permeabilization Lactate dehydrogenase (LDH) assay U-87 MG Glioblastoma MIC : 10 mM
dbacp03125 Gomesin ZCRRLCYKQRCVTYCRGR Tarantula spider sp. Target and destroy tumor cell membranes Fluorescence-based assay using a Fluorescence Imaging Plate Reader MM96L Epithelial cancer CC50 : 3.7 ± 0.2 μM
dbacp03126 Gomesin ZCRRLCYKQRCVTYCRGR Tarantula spider sp. Target and destroy tumor cell membranes Fluorescence-based assay using a Fluorescence Imaging Plate Reader K-562 Chronic myeloid leukemia CC50 : 3.8 ± 0.3 μM
dbacp03127 Gomesin ZCRRLCYKQRCVTYCRGR Tarantula spider sp. Target and destroy tumor cell membranes Fluorescence-based assay using a Fluorescence Imaging Plate Reader CRL-1739 Gastric cancer CC50 : 67.0 ± 5.0 μM
dbacp03128 Gomesin ZCRRLCYKQRCVTYCRGR Tarantula spider sp. Target and destroy tumor cell membranes Fluorescence-based assay using a Fluorescence Imaging Plate Reader HeLa Cervical cancer CC50 : 54.1 ± 5.0 μM
dbacp03129 Gomesin ZCRRLCYKQRCVTYCRGR Tarantula spider sp. Target and destroy tumor cell membranes Cell viability assay K-562 Epithelial cancer CC50 : 3.8 ± 0.3 μM
dbacp03130 Gomesin ZCRRLCYKQRCVTYCRGR Tarantula spider sp. Target and destroy tumor cell membranes Cell viability assay K-562 Chronic myeloid leukemia CC50 : 3.8 ± 0.3 μM
dbacp03131 Gomesin ZCRRLCYKQRCVTYCRGR Tarantula spider sp. Target and destroy tumor cell membranes Cell viability assay K-562 Gastric cancer CC50 : 3.8 ± 0.3 μM
dbacp03132 Gomesin ZCRRLCYKQRCVTYCRGR Tarantula spider sp. Target and destroy tumor cell membranes Cell viability assay K-562 Breast cancer CC50 : 3.8 ± 0.3 μM
dbacp03133 Gomesin ZCRRLCYKQRCVTYCRGR Tarantula spider sp. Target and destroy tumor cell membranes Cell viability assay K-562 Cervical cancer CC50 : 3.8 ± 0.3 μM
dbacp03134 Gomesin ZCRRLCYKQRCVTYCRGR Tarantula spider sp. Target and destroy tumor cell membranes Cell viability assay CRL-1739 Epithelial cancer CC50 : 67.0 ± 5.0 μM
dbacp03135 Gomesin ZCRRLCYKQRCVTYCRGR Tarantula spider sp. Target and destroy tumor cell membranes Cell viability assay CRL-1739 Chronic myeloid leukemia CC50 : 67.0 ± 5.0 μM
dbacp03136 Gomesin ZCRRLCYKQRCVTYCRGR Tarantula spider sp. Target and destroy tumor cell membranes Cell viability assay CRL-1739 Gastric cancer CC50 : 67.0 ± 5.0 μM
dbacp03137 Gomesin ZCRRLCYKQRCVTYCRGR Tarantula spider sp. Target and destroy tumor cell membranes Cell viability assay CRL-1739 Breast cancer CC50 : 67.0 ± 5.0 μM
dbacp03138 Gomesin ZCRRLCYKQRCVTYCRGR Tarantula spider sp. Target and destroy tumor cell membranes Cell viability assay CRL-1739 Cervical cancer CC50 : 67.0 ± 5.0 μM
dbacp03139 Gomesin ZCRRLCYKQRCVTYCRGR Tarantula spider sp. Target and destroy tumor cell membranes Cell viability assay MM96L Epithelial cancer CC50 : 3.7 ± 0.2 μM
dbacp03140 Gomesin ZCRRLCYKQRCVTYCRGR Tarantula spider sp. Target and destroy tumor cell membranes Cell viability assay MM96L Chronic myeloid leukemia CC50 : 3.7 ± 0.2 μM
dbacp03141 Gomesin ZCRRLCYKQRCVTYCRGR Tarantula spider sp. Target and destroy tumor cell membranes Cell viability assay MM96L Gastric cancer CC50 : 3.7 ± 0.2 μM
dbacp03142 Gomesin ZCRRLCYKQRCVTYCRGR Tarantula spider sp. Target and destroy tumor cell membranes Cell viability assay MM96L Breast cancer CC50 : 3.7 ± 0.2 μM
dbacp03143 Gomesin ZCRRLCYKQRCVTYCRGR Tarantula spider sp. Target and destroy tumor cell membranes Cell viability assay MM96L Cervical cancer CC50 : 3.7 ± 0.2 μM
dbacp03144 Gomesin ZCRRLCYKQRCVTYCRGR Tarantula spider sp. Target and destroy tumor cell membranes Cell viability assay HFF-1 Epithelial cancer CC50 : 49.9 ±16.6 μM
dbacp03145 Gomesin ZCRRLCYKQRCVTYCRGR Tarantula spider sp. Target and destroy tumor cell membranes Cell viability assay HFF-1 Chronic myeloid leukemia CC50 : 49.9 ±16.6 μM
dbacp03146 Gomesin ZCRRLCYKQRCVTYCRGR Tarantula spider sp. Target and destroy tumor cell membranes Cell viability assay HFF-1 Gastric cancer CC50 : 49.9 ±16.6 μM
dbacp03147 Gomesin ZCRRLCYKQRCVTYCRGR Tarantula spider sp. Target and destroy tumor cell membranes Cell viability assay HFF-1 Breast cancer CC50 : 49.9 ±16.6 μM
dbacp03148 Gomesin ZCRRLCYKQRCVTYCRGR Tarantula spider sp. Target and destroy tumor cell membranes Cell viability assay HFF-1 Cervical cancer CC50 : 49.9 ±16.6 μM
dbacp03149 Gomesin ZCRRLCYKQRCVTYCRGR Tarantula spider sp. Target and destroy tumor cell membranes Cell viability assay HeLa Epithelial cancer CC50 : 54.1 ± 5.0 μM
dbacp03150 Gomesin ZCRRLCYKQRCVTYCRGR Tarantula spider sp. Target and destroy tumor cell membranes Cell viability assay HeLa Chronic myeloid leukemia CC50 : 54.1 ± 5.0 μM
dbacp03151 Gomesin ZCRRLCYKQRCVTYCRGR Tarantula spider sp. Target and destroy tumor cell membranes Cell viability assay HeLa Gastric cancer CC50 : 54.1 ± 5.0 μM
dbacp03152 Gomesin ZCRRLCYKQRCVTYCRGR Tarantula spider sp. Target and destroy tumor cell membranes Cell viability assay HeLa Breast cancer CC50 : 54.1 ± 5.0 μM
dbacp03153 Gomesin ZCRRLCYKQRCVTYCRGR Tarantula spider sp. Target and destroy tumor cell membranes Cell viability assay HeLa Cervical cancer CC50 : 54.1 ± 5.0 μM
dbacp03705 Latarcin 2a GLFGKLIKKFGRKAISYAVKKARGKH Central Asian spider Membrane disruption LDH leakage assay Breast tumor cell line Breast cancer Not found
dbacp03706 Latarcin 2a GLFGKLIKKFGRKAISYAVKKARGKH-OH Spider Membrane disruption Not specified Not found Not specified Not found
dbacp03707 Latarcin 3a SWKSMAKKLKEYMEKLKQRA Venom, Spider, Central Asia Membrane destabilization Not specified Not found Not found Not found
dbacp04295 ltc2aG11A GLFGKLIKKFARKAISYAVKKARGKH Central Asian spider Membrane disruption LDH leakage assay Prostate tumor cell line Prostate cancer Not found
dbacp04341 Lycosin-1 Ac-KGWFKAMKSIAKFIAKEKLKEHL-amide Tarantula wolf spider Inhibit the migration of prostate cancer cell; Induce apoptosis MTT assay DU-145 Prostate cancer MIC : 10 μM
dbacp04342 Lycosin-1 Ac-KGWFKAMKSIAKFIAKEKLKEHL-amide Tarantula wolf spider Inhibit the migration of prostate cancer cell; Induce apoptosis MTT assay PC-3 Prostate cancer MIC : 20 μM
dbacp04343 Lycosin-I RKGWFKAMKSIAKFIAKEKLKEHL-OH Venom, wolf spider Apoptosis Not specified Not found Not found Not found
dbacp04344 Lycosin-I RKGWFKAMKSIAKFIAKEKLKEHL-OH Wolf spider Apoptosis Not specified Not found Not found Not found
dbacp04345 Lycosin-I RKGWFKAMKSIAKFIAKEKLKEHL-OH Wolf spider Penetrating the cell membrane Not specified Not found Not specified Not found
dbacp04346 Lycosin-I RKGWFKAMKSIAKFIAKEKLKEHL Wolf spider Not specified Not specified Not found Not found Not found
dbacp06133 SNX-482 GVDKAGCRYMFGGCSVNDDCCPRLGCHSLFSYCAWDLTFSDOHa Giant baboon spider Immunomodulatory properties Not specified Not found Not found Not found
dbacp06413 U1-TRTX-Ar1b SCVYERETCSKVRGPLCCRGECTCPIYGDCFCYGS-OHc Spider (Theraphosidae family) Membrane disruption Not specified Not found Not specified Not found
dbacp06414 U1-TRTXAgm3a ACGSFMWKCSERLPCCQEYVCSPQWKWCQNP-OHa Spider (Theraphosidae family) Membrane disruption Not specified Not found Not specified Not found