45 result(s) have been found!
| Accession | Name | Sequence | Source/Organism | Mechanism | Assay Type | Cell Line | Cancer Type | Activity |
|---|---|---|---|---|---|---|---|---|
| dbacp03122 | Gomesin | ECRRLCYKQRCVTYCRGR | Hemocytes, Tarantula spider sp. | Cell membrane disintegration | Not specified | Not found | Breast cancer | Not found |
| dbacp03123 | Gomesin | QCRRLCYKQRCVTYCRGR | Hemocytes, Tarantula spider sp. | Cell membrane disintegration | Not specified | Not found | Breast cancer | Not found |
| dbacp03124 | Gomesin | GCRRLCYKQRCVTYCRGR | Tarantula spider sp. | Membrane permeabilization | Lactate dehydrogenase (LDH) assay | U-87 MG | Glioblastoma | MIC : 10 mM |
| dbacp03125 | Gomesin | ZCRRLCYKQRCVTYCRGR | Tarantula spider sp. | Target and destroy tumor cell membranes | Fluorescence-based assay using a Fluorescence Imaging Plate Reader | MM96L | Epithelial cancer | CC50 : 3.7 ± 0.2 μM |
| dbacp03126 | Gomesin | ZCRRLCYKQRCVTYCRGR | Tarantula spider sp. | Target and destroy tumor cell membranes | Fluorescence-based assay using a Fluorescence Imaging Plate Reader | K-562 | Chronic myeloid leukemia | CC50 : 3.8 ± 0.3 μM |
| dbacp03127 | Gomesin | ZCRRLCYKQRCVTYCRGR | Tarantula spider sp. | Target and destroy tumor cell membranes | Fluorescence-based assay using a Fluorescence Imaging Plate Reader | CRL-1739 | Gastric cancer | CC50 : 67.0 ± 5.0 μM |
| dbacp03128 | Gomesin | ZCRRLCYKQRCVTYCRGR | Tarantula spider sp. | Target and destroy tumor cell membranes | Fluorescence-based assay using a Fluorescence Imaging Plate Reader | HeLa | Cervical cancer | CC50 : 54.1 ± 5.0 μM |
| dbacp03129 | Gomesin | ZCRRLCYKQRCVTYCRGR | Tarantula spider sp. | Target and destroy tumor cell membranes | Cell viability assay | K-562 | Epithelial cancer | CC50 : 3.8 ± 0.3 μM |
| dbacp03130 | Gomesin | ZCRRLCYKQRCVTYCRGR | Tarantula spider sp. | Target and destroy tumor cell membranes | Cell viability assay | K-562 | Chronic myeloid leukemia | CC50 : 3.8 ± 0.3 μM |
| dbacp03131 | Gomesin | ZCRRLCYKQRCVTYCRGR | Tarantula spider sp. | Target and destroy tumor cell membranes | Cell viability assay | K-562 | Gastric cancer | CC50 : 3.8 ± 0.3 μM |
| dbacp03132 | Gomesin | ZCRRLCYKQRCVTYCRGR | Tarantula spider sp. | Target and destroy tumor cell membranes | Cell viability assay | K-562 | Breast cancer | CC50 : 3.8 ± 0.3 μM |
| dbacp03133 | Gomesin | ZCRRLCYKQRCVTYCRGR | Tarantula spider sp. | Target and destroy tumor cell membranes | Cell viability assay | K-562 | Cervical cancer | CC50 : 3.8 ± 0.3 μM |
| dbacp03134 | Gomesin | ZCRRLCYKQRCVTYCRGR | Tarantula spider sp. | Target and destroy tumor cell membranes | Cell viability assay | CRL-1739 | Epithelial cancer | CC50 : 67.0 ± 5.0 μM |
| dbacp03135 | Gomesin | ZCRRLCYKQRCVTYCRGR | Tarantula spider sp. | Target and destroy tumor cell membranes | Cell viability assay | CRL-1739 | Chronic myeloid leukemia | CC50 : 67.0 ± 5.0 μM |
| dbacp03136 | Gomesin | ZCRRLCYKQRCVTYCRGR | Tarantula spider sp. | Target and destroy tumor cell membranes | Cell viability assay | CRL-1739 | Gastric cancer | CC50 : 67.0 ± 5.0 μM |
| dbacp03137 | Gomesin | ZCRRLCYKQRCVTYCRGR | Tarantula spider sp. | Target and destroy tumor cell membranes | Cell viability assay | CRL-1739 | Breast cancer | CC50 : 67.0 ± 5.0 μM |
| dbacp03138 | Gomesin | ZCRRLCYKQRCVTYCRGR | Tarantula spider sp. | Target and destroy tumor cell membranes | Cell viability assay | CRL-1739 | Cervical cancer | CC50 : 67.0 ± 5.0 μM |
| dbacp03139 | Gomesin | ZCRRLCYKQRCVTYCRGR | Tarantula spider sp. | Target and destroy tumor cell membranes | Cell viability assay | MM96L | Epithelial cancer | CC50 : 3.7 ± 0.2 μM |
| dbacp03140 | Gomesin | ZCRRLCYKQRCVTYCRGR | Tarantula spider sp. | Target and destroy tumor cell membranes | Cell viability assay | MM96L | Chronic myeloid leukemia | CC50 : 3.7 ± 0.2 μM |
| dbacp03141 | Gomesin | ZCRRLCYKQRCVTYCRGR | Tarantula spider sp. | Target and destroy tumor cell membranes | Cell viability assay | MM96L | Gastric cancer | CC50 : 3.7 ± 0.2 μM |
| dbacp03142 | Gomesin | ZCRRLCYKQRCVTYCRGR | Tarantula spider sp. | Target and destroy tumor cell membranes | Cell viability assay | MM96L | Breast cancer | CC50 : 3.7 ± 0.2 μM |
| dbacp03143 | Gomesin | ZCRRLCYKQRCVTYCRGR | Tarantula spider sp. | Target and destroy tumor cell membranes | Cell viability assay | MM96L | Cervical cancer | CC50 : 3.7 ± 0.2 μM |
| dbacp03144 | Gomesin | ZCRRLCYKQRCVTYCRGR | Tarantula spider sp. | Target and destroy tumor cell membranes | Cell viability assay | HFF-1 | Epithelial cancer | CC50 : 49.9 ±16.6 μM |
| dbacp03145 | Gomesin | ZCRRLCYKQRCVTYCRGR | Tarantula spider sp. | Target and destroy tumor cell membranes | Cell viability assay | HFF-1 | Chronic myeloid leukemia | CC50 : 49.9 ±16.6 μM |
| dbacp03146 | Gomesin | ZCRRLCYKQRCVTYCRGR | Tarantula spider sp. | Target and destroy tumor cell membranes | Cell viability assay | HFF-1 | Gastric cancer | CC50 : 49.9 ±16.6 μM |
| dbacp03147 | Gomesin | ZCRRLCYKQRCVTYCRGR | Tarantula spider sp. | Target and destroy tumor cell membranes | Cell viability assay | HFF-1 | Breast cancer | CC50 : 49.9 ±16.6 μM |
| dbacp03148 | Gomesin | ZCRRLCYKQRCVTYCRGR | Tarantula spider sp. | Target and destroy tumor cell membranes | Cell viability assay | HFF-1 | Cervical cancer | CC50 : 49.9 ±16.6 μM |
| dbacp03149 | Gomesin | ZCRRLCYKQRCVTYCRGR | Tarantula spider sp. | Target and destroy tumor cell membranes | Cell viability assay | HeLa | Epithelial cancer | CC50 : 54.1 ± 5.0 μM |
| dbacp03150 | Gomesin | ZCRRLCYKQRCVTYCRGR | Tarantula spider sp. | Target and destroy tumor cell membranes | Cell viability assay | HeLa | Chronic myeloid leukemia | CC50 : 54.1 ± 5.0 μM |
| dbacp03151 | Gomesin | ZCRRLCYKQRCVTYCRGR | Tarantula spider sp. | Target and destroy tumor cell membranes | Cell viability assay | HeLa | Gastric cancer | CC50 : 54.1 ± 5.0 μM |
| dbacp03152 | Gomesin | ZCRRLCYKQRCVTYCRGR | Tarantula spider sp. | Target and destroy tumor cell membranes | Cell viability assay | HeLa | Breast cancer | CC50 : 54.1 ± 5.0 μM |
| dbacp03153 | Gomesin | ZCRRLCYKQRCVTYCRGR | Tarantula spider sp. | Target and destroy tumor cell membranes | Cell viability assay | HeLa | Cervical cancer | CC50 : 54.1 ± 5.0 μM |
| dbacp03705 | Latarcin 2a | GLFGKLIKKFGRKAISYAVKKARGKH | Central Asian spider | Membrane disruption | LDH leakage assay | Breast tumor cell line | Breast cancer | Not found |
| dbacp03706 | Latarcin 2a | GLFGKLIKKFGRKAISYAVKKARGKH-OH | Spider | Membrane disruption | Not specified | Not found | Not specified | Not found |
| dbacp03707 | Latarcin 3a | SWKSMAKKLKEYMEKLKQRA | Venom, Spider, Central Asia | Membrane destabilization | Not specified | Not found | Not found | Not found |
| dbacp04295 | ltc2aG11A | GLFGKLIKKFARKAISYAVKKARGKH | Central Asian spider | Membrane disruption | LDH leakage assay | Prostate tumor cell line | Prostate cancer | Not found |
| dbacp04341 | Lycosin-1 | Ac-KGWFKAMKSIAKFIAKEKLKEHL-amide | Tarantula wolf spider | Inhibit the migration of prostate cancer cell; Induce apoptosis | MTT assay | DU-145 | Prostate cancer | MIC : 10 μM |
| dbacp04342 | Lycosin-1 | Ac-KGWFKAMKSIAKFIAKEKLKEHL-amide | Tarantula wolf spider | Inhibit the migration of prostate cancer cell; Induce apoptosis | MTT assay | PC-3 | Prostate cancer | MIC : 20 μM |
| dbacp04343 | Lycosin-I | RKGWFKAMKSIAKFIAKEKLKEHL-OH | Venom, wolf spider | Apoptosis | Not specified | Not found | Not found | Not found |
| dbacp04344 | Lycosin-I | RKGWFKAMKSIAKFIAKEKLKEHL-OH | Wolf spider | Apoptosis | Not specified | Not found | Not found | Not found |
| dbacp04345 | Lycosin-I | RKGWFKAMKSIAKFIAKEKLKEHL-OH | Wolf spider | Penetrating the cell membrane | Not specified | Not found | Not specified | Not found |
| dbacp04346 | Lycosin-I | RKGWFKAMKSIAKFIAKEKLKEHL | Wolf spider | Not specified | Not specified | Not found | Not found | Not found |
| dbacp06133 | SNX-482 | GVDKAGCRYMFGGCSVNDDCCPRLGCHSLFSYCAWDLTFSDOHa | Giant baboon spider | Immunomodulatory properties | Not specified | Not found | Not found | Not found |
| dbacp06413 | U1-TRTX-Ar1b | SCVYERETCSKVRGPLCCRGECTCPIYGDCFCYGS-OHc | Spider (Theraphosidae family) | Membrane disruption | Not specified | Not found | Not specified | Not found |
| dbacp06414 | U1-TRTXAgm3a | ACGSFMWKCSERLPCCQEYVCSPQWKWCQNP-OHa | Spider (Theraphosidae family) | Membrane disruption | Not specified | Not found | Not specified | Not found |