dbACP: A Comprehensive Database of Anti-Cancer Peptides

6 result(s) have been found!

Accession Name Sequence Source/Organism Mechanism Assay Type Cell Line Cancer Type Activity
dbacp04610 Maximin1 GIGTKILGGVKTALKGALKELASTYAN Yunnan firebelly toad Not specified MTT/MTS assay T-24 Bladder cancer IC50 : 35.4 µg/ml
dbacp04614 Maximin3 GIGGKILSGLKTALKGAAKELASTYLH Yunnan firebelly toad Not specified MTT/MTS assay T-24 Bladder cancer IC50 : 18 µg/ml
dbacp04618 Maximin4 GIGVLLSAGKAALKGLAKVLAEKYAN Yunnan firebelly toad Not specified MTT/MTS assay T-24 Bladder cancer IC50 : >50 µg/ml
dbacp04622 Maximin5 SIGAKILGGVKTFFKGALKELASTYLQ Yunnan firebelly toad Not specified MTT/MTS assay T-24 Bladder cancer IC50 : >50 µg/ml
dbacp07104 rScyreprocin MKEDSNILDKTAKMTKQNKALLFTAGGAAAFMAGYYYYHCNYRNPAPKKSGSTTSQDKTDAQAVQSIPSPSGNKGKESKDPKVKHHHHHH Recombinant product of Scyreprocin Membrane disruption triggers ROS-mediated apoptosis MTS assay T-24 Urinary Bladder Cancer IC50 = 1.94 x 105 µM
dbacp08310 DAP1 LWKRWVGVWRKWL Synthetic Not Available MTT assay T-24 Bladder Cancer IC50 = 15.3 μM