dbACP: A Comprehensive Database of Anti-Cancer Peptides

3 result(s) have been found!

Accession Name Sequence Source/Organism Mechanism Assay Type Cell Line Cancer Type Activity
dbacp06517 Viscotoxin 1-Ps KSCCPNTTGRNIYNTCRFGGGSREVCARISGCKIISASTCPSDYPK The European mistletoe Cell membrane disintegration Not specified Not found Colorectal cancer Not found
dbacp06522 Viscotoxin A3 KSCCPNTTGRNIYNACRLTGAPRPTCAKLSGCKIISGSTCPSDYPK The European mistletoe Cell membrane disintegration Not specified Not found Breast cancer Not found
dbacp06523 Viscotoxin A3 KSCCPNTTGRNIYNACRLTGAPRPTCAKLSGCKIISGSTCPSDYPK The European mistletoe Cell membrane disintegration Not specified Not found Breast cancer Not found