5 result(s) have been found!
| Accession | Name | Sequence | Source/Organism | Mechanism | Assay Type | Cell Line | Cancer Type | Activity |
|---|---|---|---|---|---|---|---|---|
| dbacp04562 | Mastoparan | INLKALAALAKKIL | Venom base | Inducing apoptosis | Not specified | A2058 | Not specified | IC50 : 140 ± 9.2 µM |
| dbacp06388 | Turgencin B | GIKEML_CnMACAQTVC_KKSGGPLCDTCQAACKALG-NH2 | Tunicate | Disruption of cell membranes | Human cell viability assay | A2058 | Melanoma cancer | IC50 : 4.1μM |
| dbacp06389 | Turgencin A | GPKTKAACKMACKLATCGKKPGGWKCKLCELGCDAV | Tunicate | Disruption of cell membranes | Human cell viability assay | A2058 | Melanoma cancer | IC50 : 1.4 μM |
| dbacp06390 | Turgencin A | GPKTKAACKMACKLATCGKKPGGWKCKLCELGCDAV-NH2 | Tunicate | Disruption of cell membranes | Human cell viability assay | A2058 | Melanoma cancer | IC50 : 1.4 μM |
| dbacp06391 | Turgencin A | GPKTKAACKMACKLATCGKKPGGWKCKLCELGCDAV | Tunicate | Disruption of cell membranes | Human cell viability assay | A2058 | Melanoma cancer | IC50 : 1.4 μM |