69 result(s) have been found!
| Accession | Name | Sequence | Source/Organism | Mechanism | Assay Type | Cell Line | Cancer Type | Activity |
|---|---|---|---|---|---|---|---|---|
| dbacp00310 | (Bl- LAAO) L-amino acid oxidases (L-AAO) | ADDRNPLEECFRETDYEEFLEIAKNGLSTT | Venom base | Apoptosis inducing | MTT assay | HUTU | Adenocarcinoma | Not found |
| dbacp00319 | [A18K]OCN-3N | GIFDVLKNLAKGVITSLKS | Derivatives of ocellatin-3N | Membranolytic mechanism | Not specified | A549 | Lung adenocarcinoma | LC50 : 12-20 μM |
| dbacp00320 | [A18K]OCN-3N | GIFDVLKNLAKGVITSLKS | Derivatives of ocellatin-3N | Membranolytic mechanism | Not specified | MDA-MB-231 | Breast adenocarcinoma | LC50 : 12-20 μM |
| dbacp00321 | [A18K]OCN-3N | GIFDVLKNLAKGVITSLKS | Derivatives of ocellatin-3N | Membranolytic mechanism | Not specified | HT-29 | Colorectal adenocarcinoma | LC50 : 12-20 μM |
| dbacp00433 | [D4K,A18K]OCN-3N | GIFKVLKNLAKGVITSLKS | Derivatives of ocellatin-3N | Membranolytic mechanism | Not specified | A549 | Lung adenocarcinoma | LC50 : 12-20 μM |
| dbacp00434 | [D4K,A18K]OCN-3N | GIFKVLKNLAKGVITSLKS | Derivatives of ocellatin-3N | Membranolytic mechanism | Not specified | MDA-MB-231 | Breast adenocarcinoma | LC50 : 12-20 μM |
| dbacp00435 | [D4K,A18K]OCN-3N | GIFKVLKNLAKGVITSLKS | Derivatives of ocellatin-3N | Membranolytic mechanism | Not specified | HT-29 | Colorectal adenocarcinoma | LC50 : 12-20 μM |
| dbacp00436 | [D4K]OCN-3N | GIFKVLKNLAKGVITSLAS | Derivatives of ocellatin-3N | Not specified | Lactate dehydrogenase (LDH) assay | A549 | Lung adenocarcinoma | LC50 : 12-20 μM |
| dbacp00437 | [D4K]OCN-3N | GIFKVLKNLAKGVITSLAS | Derivatives of ocellatin-3N | Not specified | Lactate dehydrogenase (LDH) assay | MDA-MB-231 | Breast adenocarcinoma | LC50 : 12-20 μM |
| dbacp00438 | [D4K]OCN-3N | GIFKVLKNLAKGVITSLAS | Derivatives of ocellatin-3N | Not specified | Lactate dehydrogenase (LDH) assay | HT-29 | Colorectal adenocarcinoma | LC50 : 12-20 μM |
| dbacp00439 | [G11k, N15K] alyteserin-2a | ILGKLLSTAAGLLSNL | Common midwife toad | Cell-penetrating mechanism | Cytotoxicity assay | A549 | Lung adenocarcinoma | LC50 : 13 µM |
| dbacp00769 | A specific Eps8/EGFR Inhibitor Peptide 327 | EFLDCFQKF | A specific Eps8/EGFR Inhibitor Peptide 327 | Immune response to tumor cell recognition | Lactate dehydrogenase (LDH)-release assay | HT-29 | Colorectal adenocarcinoma | IC50 : 96.00 ± 9.06 μM |
| dbacp00821 | AaeAP1 | FLFSLIPSVIAGLVSAIRN | Venom, Aeneas fattailed scorpion, Africa | Membrane lysis | MTT assay | NCI-H460 | Human lung adenocarcinoma | MIC : 10−4 to 10−9 M |
| dbacp00829 | AaeAP2 | FLFSLIPSAIAGLVSAIRN | Venom, Aeneas fattailed scorpion, Africa | Membrane lysis | MTT assay | NCI-H460 | Human lung adenocarcinoma | MIC : 10−4 to 10−9 M |
| dbacp01007 | Alyteserin-2 | ILGKLLSTAAGLLSNL | Common midwife toad | Cell penetration | Cytotoxicity assay | MDA-MB-231 | Breast adenocarcinoma | LC50 : 20 µM |
| dbacp01008 | Alyteserin-2 | ILGKLLSTAAGLLSNL | Common midwife toad | Cell penetration | Cytotoxicity assay | HT29 | Colorectal adenocarcinoma | LC50 : 28 µM |
| dbacp01161 | Antimicrobial peptide TsAP-1 | MQIKHLITLFFLVLIVADQCSAFLSLIPSLVGGSISAFKGRRKREISAQIEQYKDLQKREAELEELLDRLPMY | Brazilian scorpion | Membrane disruption | MTT Cell viability assay | NCIeH838 | Human Lung adenocarcinoma | IC50 : 0.83 - 2.0 μM |
| dbacp01162 | Antimicrobial peptide TsAP-1 | MQIKHLITLFFLVLIVADQCSAFLSLIPSLVGGSISAFKGRRKREISAQIEQYKDLQKREAELEELLDRLPMY | Brazilian scorpion | Membrane disruption | MTT Cell viability assay | PC-3 | androgen-independent Prostate adenocarcinoma | IC50 : 0.83 - 2.0 μM |
| dbacp01974 | Brevinin-2R | KLKNFAKGVAQSLLNKASCKLSGQC | Skin, Marsh frog, Europe | Activates the lysosomal-mitochondrial death pathway; Involves autophagy-like cell death | MTT-assay | MCF-7 | Breast adenocarcinoma | LD50 : 10 – 15μg/ml |
| dbacp01975 | Brevinin-2R | KLKNFAKGVAQSLLNKASCKLSGQC | Skin, Marsh frog, Europe | Activates the lysosomal-mitochondrial death pathway; Involves autophagy-like cell death | MTT-assay | MCF-7 | Breast adenocarcinoma | LD50 : 20 – 25 μg/ml |
| dbacp01976 | Brevinin-2R | KLKNFAKGVAQSLLNKASCKLSGQC | Skin, Marsh frog, Europe | Activates the lysosomal-mitochondrial death pathway; Involves autophagy-like cell death | MTT-assay | MCF-7 | Breast adenocarcinoma | LD50 : 30 – 40 μg/ml |
| dbacp01983 | Brevinin-2R | KLKNFAKGVAQSLLNKASCKLSGQC | Skin, Marsh frog, Europe | Activates the lysosomal-mitochondrial death pathway; Involves autophagy-like cell death | MTT-assay | MCF-7 | Breast adenocarcinoma | LD50 : 10 – 15 µg/ml |
| dbacp02481 | ChMAP-28 | GRFKRFRKKLKRLWHKVGPFVGPILHY | Domestic goat | Cause cell membrane permeability; Induce necrotic death | Cytotoxic Activity assay, Lactate dehydrogenase (LDH)-Releaseassay, MTT assay | SKBR-3 | Human breast adenocarcinoma | IC50 : 5.63 ± 1.05μM |
| dbacp02655 | Dermaseptin-B2 | GLWSKIKEVGKEAAKAAAKAAGKAALGAVSEAV | Giant leaf frog | Immunomodulatory properties | Cytotoxicity assays, Cell Titer-Glo Luminescent Cell viability assay | A549 | Lung adenocarcinoma | LC50 : < 12 μM |
| dbacp02656 | Dermaseptin-B2 | GLWSKIKEVGKEAAKAAAKAAGKAALGAVSEAV | Giant leaf frog | Immunomodulatory properties | Cytotoxicity assays, Cell Titer-Glo Luminescent Cell viability assay | MDA-MB-231 | Breast adenocarcinoma | LC50 : < 12 μM |
| dbacp02657 | Dermaseptin-B2 | GLWSKIKEVGKEAAKAAAKAAGKAALGAVSEAV | Giant leaf frog | Immunomodulatory properties | Cytotoxicity assays, Cell Titer-Glo Luminescent Cell viability assay | HT-29 | Colorectal adenocarcinoma | LC50 : < 12 μM |
| dbacp02659 | Dermaseptin-B3 | ALWKnMLKGIGKLAGQAALGAVKTLVGAE | Giant leaf frog | Membrane lysis | In vitro proliferation assay, Soft agar assay | PC-3 | Human epithelial prostate adenocarcinoma | EC50 : 2 μM |
| dbacp02786 | DN-C16orf74 | RRRRRRRRRRR-GGG-KHLDVPVIVIPPTPT | Not found | Cell membrane penetration | Immunoprecipitation assay | PDAC cells | Pancreatic ductal adenocarcinoma | Not found |
| dbacp02814 | Drosophila Antennapedia homodomain PFV | CALNNPFVYLI | Fruit fly homodomain PFV | Cell membrane disintegration | SPR assay | A549 | Human lung adenocarcinoma | Not found |
| dbacp02919 | Esculentin-2CHa | GFSSIFRGVAKFASKGLGKDLAKLGVDLVACKISKQC | Chiricahua leopard frog | Membrane disruption and cell lysis | Cytotoxicity assay, Cell TiterGlo Luminescent cell viability assay | A549 cells | Lung adenocarcinoma | LC50 : 10μM |
| dbacp02956 | Figainin 2BN | FLGVALKLGKVLGKALLPLASSLLHSQ | Norepinephrine-stimulated skin secretion, the Giant Gladiator Treefrog, the Rusty Treefrog, Trinidad, South America | Cell membrane penetration | Not specified | MDA-MB-231 | Breast adenocarcinoma | LC50 : 7-14 µM |
| dbacp02957 | Figainin 2BN | FLGVALKLGKVLGKALLPLASSLLHSQ | Norepinephrine-stimulated skin secretion, the Giant Gladiator Treefrog, the Rusty Treefrog, Trinidad, South America | Cell membrane penetration | Not specified | HT-29 | Colon adenocarcinoma | LC50 : 7-14 µM |
| dbacp02969 | Frenatin 2.1S | GLVGTLLGHIGKAILG | Skin secretions, the Orinoco lime frog, north central Guyana, South America | Immunomodulatory activity | Cytotoxicity assay, Cell Titer-Glo Luminescent Cell Viability assay | A549 | Lung adenocarcinoma | LC50 : 80 ± 6 μM |
| dbacp02970 | Frenatin 2.1S (F2.3S) | MAFLKKSLFLVLFLGLVSLSMGEREKREEEEEEEEENKEEEANEEGKGESEEKRGLVGTLLGHIGKAILGG | Orinoco lime treefrog | Not specified | Cytotoxicity assay, Cell Titer-Glo Luminescent Cell Viability assay | A549 | Lung adenocarcinoma | LC50 : 80 ± 6 µM |
| dbacp02971 | Frenatin 2.2S | GLVGTLLGHIGKAILS | Skin secretions, the Orinoco lime frog, north central Guyana, South America | Immunomodulatory activity | Cytotoxicity assay, Cell Titer-Glo Luminescent Cell Viability assay | A549 | Lung adenocarcinoma | LC50 : 75 ± 5 μM |
| dbacp04654 | Melittin | GIGAVLKVLTTGLPALISWIKRKRQQ | Honey bee | Membrane damage as swelling; Breakage or blebbing | Live/Dead staining and florescence microscopy assay | AGS | Human adenocarcinoma | MIC : 10 μg/mL |
| dbacp04655 | Melittin | GIGAVLKVLTTGLPALISWIKRKRQQ | Honey bee | Membrane damage as swelling; Breakage or blebbing | Live/Dead staining and florescence microscopy assay | COLO205 | Human adenocarcinoma | MIC : 10 μg/mL |
| dbacp04656 | Melittin | GIGAVLKVLTTGLPALISWIKRKRQQ | Honey bee | Membrane damage as swelling; Breakage or blebbing | Live/Dead staining and florescence microscopy assay | HCT-15 | Human adenocarcinoma | MIC : 5 μg/mL |
| dbacp05031 | P04 | IGEHTPSALAIMENANVLAR | Aldolase A derived | Apoptosis inducing | MTT assay | PDAC | Pancreatic ductal adenocarcinoma | MIC : 25 µg/mL |
| dbacp05467 | Peptidoglycan recognition protein 1 | MLFACALLALLGLATSCSFIVPRSEWRALPSECSSRLGHPVRYVVISHTAGSFCNSPDSCEQQARNVQHYHKNELGWCDVAYNFLIGEDGHVYEGRGWNIKGDHTGPIWNPMSIGITFMGNFMDRVPAKRALRAALNLLECGVSRGFLRSNYEVKGHRDVQSTLSPGDQLYQVIQSWEHYRE | Mouse | Necrosis; Apoptosis | Cytotoxicity assay | VMR-0 | Mammary adenocarcinoma | Not found |
| dbacp05468 | Peptidoglycan recognition protein 1 | MLFACALLALLGLATSCSFIVPRSEWRALPSECSSRLGHPVRYVVISHTAGSFCNSPDSCEQQARNVQHYHKNELGWCDVAYNFLIGEDGHVYEGRGWNIKGDHTGPIWNPMSIGITFMGNFMDRVPAKRALRAALNLLECGVSRGFLRSNYEVKGHRDVQSTLSPGDQLYQVIQSWEHYRE | Mouse | Necrosis; Apoptosis | Cytotoxicity assay | VMR-L | Mammary adenocarcinoma | Not found |
| dbacp05469 | Peptidoglycan recognition protein 1 | MLFACALLALLGLATSCSFIVPRSEWRALPSECSSRLGHPVRYVVISHTAGSFCNSPDSCEQQARNVQHYHKNELGWCDVAYNFLIGEDGHVYEGRGWNIKGDHTGPIWNPMSIGITFMGNFMDRVPAKRALRAALNLLECGVSRGFLRSNYEVKGHRDVQSTLSPGDQLYQVIQSWEHYRE | Mouse | Necrosis; Apoptosis | Cytotoxicity assay | CSML-0 | Mammary adenocarcinoma | Not found |
| dbacp05470 | Peptidoglycan recognition protein 1 | MLFACALLALLGLATSCSFIVPRSEWRALPSECSSRLGHPVRYVVISHTAGSFCNSPDSCEQQARNVQHYHKNELGWCDVAYNFLIGEDGHVYEGRGWNIKGDHTGPIWNPMSIGITFMGNFMDRVPAKRALRAALNLLECGVSRGFLRSNYEVKGHRDVQSTLSPGDQLYQVIQSWEHYRE | Mouse | Necrosis; Apoptosis | Cytotoxicity assay | CSML-100 | Mammary adenocarcinoma | Not found |
| dbacp05556 | Picturin 1BN | GIFKDTLKKVVAAVLTTVADNIHPK | Norepinephrine-stimulated skin secretion, the Giant Gladiator Treefrog, the Rusty Treefrog, Trinidad, South America | Cell membrane penetration | Not specified | MDA-MB-231 | Breast adenocarcinoma | LC50 : 7 - 14 µM |
| dbacp05557 | Picturin 1BN | GIFKDTLKKVVAAVLTTVADNIHPK | Norepinephrine-stimulated skin secretion, the Giant Gladiator Treefrog, the Rusty Treefrog, Trinidad, South America | Cell membrane penetration | Not specified | HT-29 | Colon adenocarcinoma | LC50 : 7 - 14 µM |
| dbacp05559 | Picturin 2BN | GLMDMLKKVGKVALTVAKSALLP | Norepinephrine-stimulated skin secretion, the Giant Gladiator Treefrog, the Rusty Treefrog, Trinidad, South America | Cell membrane penetration | Not specified | MDA-MB-231 | Breast adenocarcinoma | LC50 : 7 - 14 µM |
| dbacp05560 | Picturin 2BN | GLMDMLKKVGKVALTVAKSALLP | Norepinephrine-stimulated skin secretion, the Giant Gladiator Treefrog, the Rusty Treefrog, Trinidad, South America | Cell membrane penetration | Not specified | HT-29 | Colon adenocarcinoma | LC50 : 7 - 14 µM |
| dbacp05578 | Pleurocidin | GWGSFFKKAAHVGKHVGKAALTHYL | Winter flounder | Apoptosis inducing; Anti-proliferative activity | MTT assay | A549 | Non-small cell lung adenocarcinoma | IC50 : 300.8 µM |
| dbacp05579 | Pleurocidin | GWGSFFKKAAHVGKHVGKAALTHYL | Winter flounder | Apoptosis inducing; Anti-proliferative activity | MTT assay | AGS | Stomach adenocarcinoma | IC50 : 186.5 µM |
| dbacp05583 | Pleurocidin-a | GWGSFFKKAAHVGKHVGKAALTHYL-NH5 | Winter flounder | Apoptosis inducing; Anti-proliferative activity | MTT assay | A549 | Non-small cell lung adenocarcinoma | IC50 : 42.1 µM |
| dbacp05584 | Pleurocidin-a | GWGSFFKKAAHVGKHVGKAALTHYL-NH6 | Winter flounder | Apoptosis inducing; Anti-proliferative activity | MTT assay | AGS | Stomach adenocarcinoma | IC50 : 29.8 µM |
| dbacp05585 | Pleurocidin-a | GWGSFFKKAAHVGKHVGKAALTHYL-NH7 | Winter flounder | Apoptosis inducing; Anti-proliferative activity | MTT assay | WiDr | Colon adenocarcinoma | IC50 : 197.3 µM |
| dbacp05676 | Ps-1Pb | IKIPSFFRNILKKVGKEAVSLIAGALKQS | Merlin's dwarf gray frog | Immunomodulatory properties | Cytotoxicity assays, CellTiter-Glo Luminescent cell viability assay | A549 | Lung adenocarcinoma | LC50 : < 12 μM |
| dbacp05677 | Ps-1Pb | IKIPSFFRNILKKVGKEAVSLIAGALKQS | Merlin's dwarf gray frog | Immunomodulatory properties | Cytotoxicity assays, CellTiter-Glo Luminescent cell viability assay | MDA-MB-231 | Breast adenocarcinoma | LC50 : < 12 μM |
| dbacp05678 | Ps-1Pb | IKIPSFFRNILKKVGKEAVSLIAGALKQS | Merlin's dwarf gray frog | Immunomodulatory properties | Cytotoxicity assays, CellTiter-Glo Luminescent cell viability assay | HT-29 | Colorectal adenocarcinoma | LC50 : < 12 μM |
| dbacp05679 | Ps-2Pa | GIFPIFAKLLGKVIKVASSLISKGRTE | Merlin's dwarf gray frog | Immunomodulatory properties | Cytotoxicity assays, CellTiter-Glo Luminescent cell viability assay | A549 | Lung adenocarcinoma | LC50 : < 12 μM |
| dbacp05680 | Ps-2Pa | GIFPIFAKLLGKVIKVASSLISKGRTE | Merlin's dwarf gray frog | Immunomodulatory properties | Cytotoxicity assays, CellTiter-Glo Luminescent cell viability assay | MDA-MB-231 | Breast adenocarcinoma | LC50 : < 12 μM |
| dbacp05681 | Ps-2Pa | GIFPIFAKLLGKVIKVASSLISKGRTE | Merlin's dwarf gray frog | Immunomodulatory properties | Cytotoxicity assays, CellTiter-Glo Luminescent cell viability assay | HT-29 | Colorectal adenocarcinoma | LC50 : < 12 μM |
| dbacp05821 | R8 | CALRRRRRRRR | Not found | Cell membrane disintegration | SPR assay | A549 | Human lung adenocarcinoma | Not found |
| dbacp06064 | Shepherdin | KHSSGCAFL | Not found | Inducing apoptosis | MTT assay | PC3 | Prostate adenocarcinoma | IC50 : 25–75 µM |
| dbacp06068 | Shepherdin (ATP) | RQIKIWFQNRRMKWKKKHSSGCAFL | Not found | Inducing apoptosis | MTT assay | PC3 | Prostate adenocarcinoma | IC50 : 50–75 μM |
| dbacp06072 | Shepherdin (TAT) | YGRKKRRQRRRKHSSGCAFL | Not found | Inducing apoptosis | MTT assay | PC3 | Prostate adenocarcinoma | IC50 : 50–75 μM |
| dbacp06154 | StigA16 | FFKLIPKLVKGLISAF | Amino acid substitution, amino acid truncation, animal-derived, natural derivative | Disruption of cell membrane | MTT assay | 3T3 | Renal cell adenocarcinoma | IC 50 : 13.01 μM |
| dbacp06156 | StigA16 | FFKLIPKLVKGLISAF | Amino acid substitution, amino acid truncation, animal-derived, natural derivative | Disruption of cell membrane | MTT assay | 786-0 | Human cervix adenocarcinoma | IC 50 : 13.01 μM |
| dbacp06157 | StigA16 | FFKLIPKLVKGLISAF | Amino acid substitution, amino acid truncation, animal-derived, natural derivative | Disruption of cell membrane | MTT assay | B16 | Human pancreas adenocarcinoma | IC 50 : 13.01 μM |
| dbacp06159 | StigA6 | FFSLIPKLVKGLISAFK | Amino acid substitution, animal-derived, natural derivative | Disruption of cell membrane | MTT assay | 3T3 | Renal cell adenocarcinoma | IC 50 : 14.01 μM |
| dbacp06161 | StigA6 | FFSLIPKLVKGLISAFK | Amino acid substitution, animal-derived, natural derivative | Disruption of cell membrane | MTT assay | 786-0 | Human cervix adenocarcinoma | IC 50 : 14.01 μM |
| dbacp06162 | StigA6 | FFSLIPKLVKGLISAFK | Amino acid substitution, animal-derived, natural derivative | Disruption of cell membrane | MTT assay | B16 | Human pancreas adenocarcinoma | IC 50 : 14.01 μM |
| dbacp07020 | D-LAK-120-A | kklalalakkwlalakklalalakk | Synthetic | ROS induction, mitochondria-mediated apoptosis. | MTT assay | HCC-827 | Lung Adenocarcinoma | IC50 between 4.0 and 5.5 μM |