dbACP: A Comprehensive Database of Anti-Cancer Peptides

69 result(s) have been found!

Accession Name Sequence Source/Organism Mechanism Assay Type Cell Line Cancer Type Activity
dbacp00310 (Bl- LAAO) L-amino acid oxidases (L-AAO) ADDRNPLEECFRETDYEEFLEIAKNGLSTT Venom base Apoptosis inducing MTT assay HUTU Adenocarcinoma Not found
dbacp00319 [A18K]OCN-3N GIFDVLKNLAKGVITSLKS Derivatives of ocellatin-3N Membranolytic mechanism Not specified A549 Lung adenocarcinoma LC50 : 12-20 μM
dbacp00320 [A18K]OCN-3N GIFDVLKNLAKGVITSLKS Derivatives of ocellatin-3N Membranolytic mechanism Not specified MDA-MB-231 Breast adenocarcinoma LC50 : 12-20 μM
dbacp00321 [A18K]OCN-3N GIFDVLKNLAKGVITSLKS Derivatives of ocellatin-3N Membranolytic mechanism Not specified HT-29 Colorectal adenocarcinoma LC50 : 12-20 μM
dbacp00433 [D4K,A18K]OCN-3N GIFKVLKNLAKGVITSLKS Derivatives of ocellatin-3N Membranolytic mechanism Not specified A549 Lung adenocarcinoma LC50 : 12-20 μM
dbacp00434 [D4K,A18K]OCN-3N GIFKVLKNLAKGVITSLKS Derivatives of ocellatin-3N Membranolytic mechanism Not specified MDA-MB-231 Breast adenocarcinoma LC50 : 12-20 μM
dbacp00435 [D4K,A18K]OCN-3N GIFKVLKNLAKGVITSLKS Derivatives of ocellatin-3N Membranolytic mechanism Not specified HT-29 Colorectal adenocarcinoma LC50 : 12-20 μM
dbacp00436 [D4K]OCN-3N GIFKVLKNLAKGVITSLAS Derivatives of ocellatin-3N Not specified Lactate dehydrogenase (LDH) assay A549 Lung adenocarcinoma LC50 : 12-20 μM
dbacp00437 [D4K]OCN-3N GIFKVLKNLAKGVITSLAS Derivatives of ocellatin-3N Not specified Lactate dehydrogenase (LDH) assay MDA-MB-231 Breast adenocarcinoma LC50 : 12-20 μM
dbacp00438 [D4K]OCN-3N GIFKVLKNLAKGVITSLAS Derivatives of ocellatin-3N Not specified Lactate dehydrogenase (LDH) assay HT-29 Colorectal adenocarcinoma LC50 : 12-20 μM
dbacp00439 [G11k, N15K] alyteserin-2a ILGKLLSTAAGLLSNL Common midwife toad Cell-penetrating mechanism Cytotoxicity assay A549 Lung adenocarcinoma LC50 : 13 µM
dbacp00769 A specific Eps8/EGFR Inhibitor Peptide 327 EFLDCFQKF A specific Eps8/EGFR Inhibitor Peptide 327 Immune response to tumor cell recognition Lactate dehydrogenase (LDH)-release assay HT-29 Colorectal adenocarcinoma IC50 : 96.00 ± 9.06 μM
dbacp00821 AaeAP1 FLFSLIPSVIAGLVSAIRN Venom, Aeneas fattailed scorpion, Africa Membrane lysis MTT assay NCI-H460 Human lung adenocarcinoma MIC : 10−4 to 10−9 M
dbacp00829 AaeAP2 FLFSLIPSAIAGLVSAIRN Venom, Aeneas fattailed scorpion, Africa Membrane lysis MTT assay NCI-H460 Human lung adenocarcinoma MIC : 10−4 to 10−9 M
dbacp01007 Alyteserin-2 ILGKLLSTAAGLLSNL Common midwife toad Cell penetration Cytotoxicity assay MDA-MB-231 Breast adenocarcinoma LC50 : 20 µM
dbacp01008 Alyteserin-2 ILGKLLSTAAGLLSNL Common midwife toad Cell penetration Cytotoxicity assay HT29 Colorectal adenocarcinoma LC50 : 28 µM
dbacp01161 Antimicrobial peptide TsAP-1 MQIKHLITLFFLVLIVADQCSAFLSLIPSLVGGSISAFKGRRKREISAQIEQYKDLQKREAELEELLDRLPMY Brazilian scorpion Membrane disruption MTT Cell viability assay NCIeH838 Human Lung adenocarcinoma IC50 : 0.83 - 2.0 μM
dbacp01162 Antimicrobial peptide TsAP-1 MQIKHLITLFFLVLIVADQCSAFLSLIPSLVGGSISAFKGRRKREISAQIEQYKDLQKREAELEELLDRLPMY Brazilian scorpion Membrane disruption MTT Cell viability assay PC-3 androgen-independent Prostate adenocarcinoma IC50 : 0.83 - 2.0 μM
dbacp01974 Brevinin-2R KLKNFAKGVAQSLLNKASCKLSGQC Skin, Marsh frog, Europe Activates the lysosomal-mitochondrial death pathway; Involves autophagy-like cell death MTT-assay MCF-7 Breast adenocarcinoma LD50 : 10 – 15μg/ml
dbacp01975 Brevinin-2R KLKNFAKGVAQSLLNKASCKLSGQC Skin, Marsh frog, Europe Activates the lysosomal-mitochondrial death pathway; Involves autophagy-like cell death MTT-assay MCF-7 Breast adenocarcinoma LD50 : 20 – 25 μg/ml
dbacp01976 Brevinin-2R KLKNFAKGVAQSLLNKASCKLSGQC Skin, Marsh frog, Europe Activates the lysosomal-mitochondrial death pathway; Involves autophagy-like cell death MTT-assay MCF-7 Breast adenocarcinoma LD50 : 30 – 40 μg/ml
dbacp01983 Brevinin-2R KLKNFAKGVAQSLLNKASCKLSGQC Skin, Marsh frog, Europe Activates the lysosomal-mitochondrial death pathway; Involves autophagy-like cell death MTT-assay MCF-7 Breast adenocarcinoma LD50 : 10 – 15 µg/ml
dbacp02481 ChMAP-28 GRFKRFRKKLKRLWHKVGPFVGPILHY Domestic goat Cause cell membrane permeability; Induce necrotic death Cytotoxic Activity assay, Lactate dehydrogenase (LDH)-Releaseassay, MTT assay SKBR-3 Human breast adenocarcinoma IC50 : 5.63 ± 1.05μM
dbacp02655 Dermaseptin-B2 GLWSKIKEVGKEAAKAAAKAAGKAALGAVSEAV Giant leaf frog Immunomodulatory properties Cytotoxicity assays, Cell Titer-Glo Luminescent Cell viability assay A549 Lung adenocarcinoma LC50 : < 12 μM
dbacp02656 Dermaseptin-B2 GLWSKIKEVGKEAAKAAAKAAGKAALGAVSEAV Giant leaf frog Immunomodulatory properties Cytotoxicity assays, Cell Titer-Glo Luminescent Cell viability assay MDA-MB-231 Breast adenocarcinoma LC50 : < 12 μM
dbacp02657 Dermaseptin-B2 GLWSKIKEVGKEAAKAAAKAAGKAALGAVSEAV Giant leaf frog Immunomodulatory properties Cytotoxicity assays, Cell Titer-Glo Luminescent Cell viability assay HT-29 Colorectal adenocarcinoma LC50 : < 12 μM
dbacp02659 Dermaseptin-B3 ALWKnMLKGIGKLAGQAALGAVKTLVGAE Giant leaf frog Membrane lysis In vitro proliferation assay, Soft agar assay PC-3 Human epithelial prostate adenocarcinoma EC50 : 2 μM
dbacp02786 DN-C16orf74 RRRRRRRRRRR-GGG-KHLDVPVIVIPPTPT Not found Cell membrane penetration Immunoprecipitation assay PDAC cells Pancreatic ductal adenocarcinoma Not found
dbacp02814 Drosophila Antennapedia homodomain PFV CALNNPFVYLI Fruit fly homodomain PFV Cell membrane disintegration SPR assay A549 Human lung adenocarcinoma Not found
dbacp02919 Esculentin-2CHa GFSSIFRGVAKFASKGLGKDLAKLGVDLVACKISKQC Chiricahua leopard frog Membrane disruption and cell lysis Cytotoxicity assay, Cell TiterGlo Luminescent cell viability assay A549 cells Lung adenocarcinoma LC50 : 10μM
dbacp02956 Figainin 2BN FLGVALKLGKVLGKALLPLASSLLHSQ Norepinephrine-stimulated skin secretion, the Giant Gladiator Treefrog, the Rusty Treefrog, Trinidad, South America Cell membrane penetration Not specified MDA-MB-231 Breast adenocarcinoma LC50 : 7-14 µM
dbacp02957 Figainin 2BN FLGVALKLGKVLGKALLPLASSLLHSQ Norepinephrine-stimulated skin secretion, the Giant Gladiator Treefrog, the Rusty Treefrog, Trinidad, South America Cell membrane penetration Not specified HT-29 Colon adenocarcinoma LC50 : 7-14 µM
dbacp02969 Frenatin 2.1S GLVGTLLGHIGKAILG Skin secretions, the Orinoco lime frog, north central Guyana, South America Immunomodulatory activity Cytotoxicity assay, Cell Titer-Glo Luminescent Cell Viability assay A549 Lung adenocarcinoma LC50 : 80 ± 6 μM
dbacp02970 Frenatin 2.1S (F2.3S) MAFLKKSLFLVLFLGLVSLSMGEREKREEEEEEEEENKEEEANEEGKGESEEKRGLVGTLLGHIGKAILGG Orinoco lime treefrog Not specified Cytotoxicity assay, Cell Titer-Glo Luminescent Cell Viability assay A549 Lung adenocarcinoma LC50 : 80 ± 6 µM
dbacp02971 Frenatin 2.2S GLVGTLLGHIGKAILS Skin secretions, the Orinoco lime frog, north central Guyana, South America Immunomodulatory activity Cytotoxicity assay, Cell Titer-Glo Luminescent Cell Viability assay A549 Lung adenocarcinoma LC50 : 75 ± 5 μM
dbacp04654 Melittin GIGAVLKVLTTGLPALISWIKRKRQQ Honey bee Membrane damage as swelling; Breakage or blebbing Live/Dead staining and florescence microscopy assay AGS Human adenocarcinoma MIC : 10 μg/mL
dbacp04655 Melittin GIGAVLKVLTTGLPALISWIKRKRQQ Honey bee Membrane damage as swelling; Breakage or blebbing Live/Dead staining and florescence microscopy assay COLO205 Human adenocarcinoma MIC : 10 μg/mL
dbacp04656 Melittin GIGAVLKVLTTGLPALISWIKRKRQQ Honey bee Membrane damage as swelling; Breakage or blebbing Live/Dead staining and florescence microscopy assay HCT-15 Human adenocarcinoma MIC : 5 μg/mL
dbacp05031 P04 IGEHTPSALAIMENANVLAR Aldolase A derived Apoptosis inducing MTT assay PDAC Pancreatic ductal adenocarcinoma MIC : 25 µg/mL
dbacp05467 Peptidoglycan recognition protein 1 MLFACALLALLGLATSCSFIVPRSEWRALPSECSSRLGHPVRYVVISHTAGSFCNSPDSCEQQARNVQHYHKNELGWCDVAYNFLIGEDGHVYEGRGWNIKGDHTGPIWNPMSIGITFMGNFMDRVPAKRALRAALNLLECGVSRGFLRSNYEVKGHRDVQSTLSPGDQLYQVIQSWEHYRE Mouse Necrosis; Apoptosis Cytotoxicity assay VMR-0 Mammary adenocarcinoma Not found
dbacp05468 Peptidoglycan recognition protein 1 MLFACALLALLGLATSCSFIVPRSEWRALPSECSSRLGHPVRYVVISHTAGSFCNSPDSCEQQARNVQHYHKNELGWCDVAYNFLIGEDGHVYEGRGWNIKGDHTGPIWNPMSIGITFMGNFMDRVPAKRALRAALNLLECGVSRGFLRSNYEVKGHRDVQSTLSPGDQLYQVIQSWEHYRE Mouse Necrosis; Apoptosis Cytotoxicity assay VMR-L Mammary adenocarcinoma Not found
dbacp05469 Peptidoglycan recognition protein 1 MLFACALLALLGLATSCSFIVPRSEWRALPSECSSRLGHPVRYVVISHTAGSFCNSPDSCEQQARNVQHYHKNELGWCDVAYNFLIGEDGHVYEGRGWNIKGDHTGPIWNPMSIGITFMGNFMDRVPAKRALRAALNLLECGVSRGFLRSNYEVKGHRDVQSTLSPGDQLYQVIQSWEHYRE Mouse Necrosis; Apoptosis Cytotoxicity assay CSML-0 Mammary adenocarcinoma Not found
dbacp05470 Peptidoglycan recognition protein 1 MLFACALLALLGLATSCSFIVPRSEWRALPSECSSRLGHPVRYVVISHTAGSFCNSPDSCEQQARNVQHYHKNELGWCDVAYNFLIGEDGHVYEGRGWNIKGDHTGPIWNPMSIGITFMGNFMDRVPAKRALRAALNLLECGVSRGFLRSNYEVKGHRDVQSTLSPGDQLYQVIQSWEHYRE Mouse Necrosis; Apoptosis Cytotoxicity assay CSML-100 Mammary adenocarcinoma Not found
dbacp05556 Picturin 1BN GIFKDTLKKVVAAVLTTVADNIHPK Norepinephrine-stimulated skin secretion, the Giant Gladiator Treefrog, the Rusty Treefrog, Trinidad, South America Cell membrane penetration Not specified MDA-MB-231 Breast adenocarcinoma LC50 : 7 - 14 µM
dbacp05557 Picturin 1BN GIFKDTLKKVVAAVLTTVADNIHPK Norepinephrine-stimulated skin secretion, the Giant Gladiator Treefrog, the Rusty Treefrog, Trinidad, South America Cell membrane penetration Not specified HT-29 Colon adenocarcinoma LC50 : 7 - 14 µM
dbacp05559 Picturin 2BN GLMDMLKKVGKVALTVAKSALLP Norepinephrine-stimulated skin secretion, the Giant Gladiator Treefrog, the Rusty Treefrog, Trinidad, South America Cell membrane penetration Not specified MDA-MB-231 Breast adenocarcinoma LC50 : 7 - 14 µM
dbacp05560 Picturin 2BN GLMDMLKKVGKVALTVAKSALLP Norepinephrine-stimulated skin secretion, the Giant Gladiator Treefrog, the Rusty Treefrog, Trinidad, South America Cell membrane penetration Not specified HT-29 Colon adenocarcinoma LC50 : 7 - 14 µM
dbacp05578 Pleurocidin GWGSFFKKAAHVGKHVGKAALTHYL Winter flounder Apoptosis inducing; Anti-proliferative activity MTT assay A549 Non-small cell lung adenocarcinoma IC50 : 300.8 µM
dbacp05579 Pleurocidin GWGSFFKKAAHVGKHVGKAALTHYL Winter flounder Apoptosis inducing; Anti-proliferative activity MTT assay AGS Stomach adenocarcinoma IC50 : 186.5 µM
dbacp05583 Pleurocidin-a GWGSFFKKAAHVGKHVGKAALTHYL-NH5 Winter flounder Apoptosis inducing; Anti-proliferative activity MTT assay A549 Non-small cell lung adenocarcinoma IC50 : 42.1 µM
dbacp05584 Pleurocidin-a GWGSFFKKAAHVGKHVGKAALTHYL-NH6 Winter flounder Apoptosis inducing; Anti-proliferative activity MTT assay AGS Stomach adenocarcinoma IC50 : 29.8 µM
dbacp05585 Pleurocidin-a GWGSFFKKAAHVGKHVGKAALTHYL-NH7 Winter flounder Apoptosis inducing; Anti-proliferative activity MTT assay WiDr Colon adenocarcinoma IC50 : 197.3 µM
dbacp05676 Ps-1Pb IKIPSFFRNILKKVGKEAVSLIAGALKQS Merlin's dwarf gray frog Immunomodulatory properties Cytotoxicity assays, CellTiter-Glo Luminescent cell viability assay A549 Lung adenocarcinoma LC50 : < 12 μM
dbacp05677 Ps-1Pb IKIPSFFRNILKKVGKEAVSLIAGALKQS Merlin's dwarf gray frog Immunomodulatory properties Cytotoxicity assays, CellTiter-Glo Luminescent cell viability assay MDA-MB-231 Breast adenocarcinoma LC50 : < 12 μM
dbacp05678 Ps-1Pb IKIPSFFRNILKKVGKEAVSLIAGALKQS Merlin's dwarf gray frog Immunomodulatory properties Cytotoxicity assays, CellTiter-Glo Luminescent cell viability assay HT-29 Colorectal adenocarcinoma LC50 : < 12 μM
dbacp05679 Ps-2Pa GIFPIFAKLLGKVIKVASSLISKGRTE Merlin's dwarf gray frog Immunomodulatory properties Cytotoxicity assays, CellTiter-Glo Luminescent cell viability assay A549 Lung adenocarcinoma LC50 : < 12 μM
dbacp05680 Ps-2Pa GIFPIFAKLLGKVIKVASSLISKGRTE Merlin's dwarf gray frog Immunomodulatory properties Cytotoxicity assays, CellTiter-Glo Luminescent cell viability assay MDA-MB-231 Breast adenocarcinoma LC50 : < 12 μM
dbacp05681 Ps-2Pa GIFPIFAKLLGKVIKVASSLISKGRTE Merlin's dwarf gray frog Immunomodulatory properties Cytotoxicity assays, CellTiter-Glo Luminescent cell viability assay HT-29 Colorectal adenocarcinoma LC50 : < 12 μM
dbacp05821 R8 CALRRRRRRRR Not found Cell membrane disintegration SPR assay A549 Human lung adenocarcinoma Not found
dbacp06064 Shepherdin KHSSGCAFL Not found Inducing apoptosis MTT assay PC3 Prostate adenocarcinoma IC50 : 25–75 µM
dbacp06068 Shepherdin (ATP) RQIKIWFQNRRMKWKKKHSSGCAFL Not found Inducing apoptosis MTT assay PC3 Prostate adenocarcinoma IC50 : 50–75 μM
dbacp06072 Shepherdin (TAT) YGRKKRRQRRRKHSSGCAFL Not found Inducing apoptosis MTT assay PC3 Prostate adenocarcinoma IC50 : 50–75 μM
dbacp06154 StigA16 FFKLIPKLVKGLISAF Amino acid substitution, amino acid truncation, animal-derived, natural derivative Disruption of cell membrane MTT assay 3T3 Renal cell adenocarcinoma IC 50 : 13.01 μM
dbacp06156 StigA16 FFKLIPKLVKGLISAF Amino acid substitution, amino acid truncation, animal-derived, natural derivative Disruption of cell membrane MTT assay 786-0 Human cervix adenocarcinoma IC 50 : 13.01 μM
dbacp06157 StigA16 FFKLIPKLVKGLISAF Amino acid substitution, amino acid truncation, animal-derived, natural derivative Disruption of cell membrane MTT assay B16 Human pancreas adenocarcinoma IC 50 : 13.01 μM
dbacp06159 StigA6 FFSLIPKLVKGLISAFK Amino acid substitution, animal-derived, natural derivative Disruption of cell membrane MTT assay 3T3 Renal cell adenocarcinoma IC 50 : 14.01 μM
dbacp06161 StigA6 FFSLIPKLVKGLISAFK Amino acid substitution, animal-derived, natural derivative Disruption of cell membrane MTT assay 786-0 Human cervix adenocarcinoma IC 50 : 14.01 μM
dbacp06162 StigA6 FFSLIPKLVKGLISAFK Amino acid substitution, animal-derived, natural derivative Disruption of cell membrane MTT assay B16 Human pancreas adenocarcinoma IC 50 : 14.01 μM
dbacp07020 D-LAK-120-A kklalalakkwlalakklalalakk Synthetic ROS induction, mitochondria-mediated apoptosis. MTT assay HCC-827 Lung Adenocarcinoma IC50 between 4.0 and 5.5 μM