dbACP: A Comprehensive Database of Anti-Cancer Peptides

71 result(s) have been found!

Accession Name Sequence Source/Organism Mechanism Assay Type Cell Line Cancer Type Activity
dbacp01239 Aurein 1.2 GLFDIIKKIAESF Southern bell frog Green and Golden Bell Frog, Australia Cell membrane penetration Not specified Not specified Not specified LC50 : 10⁻⁵ to 10⁻⁴ M
dbacp01240 Aurein 1.2 GLFDIIKKIAESF Southern Bell Frog Cell membrane penetration Not specified Not specified Not specified LC50 : 10⁻⁵ to 10⁻⁴ M
dbacp01241 Aurein 2.1 GLLDIVKKVVGAFGSL Southern bell frog, Australia Cell membrane penetration Not specified Not found Not found Not found
dbacp01242 Aurein 2.1 GLLDIVKKVVGAFGSL Southern bell frog, Australia Cell membrane penetration Not specified Not specified Not specified LC50 : 10⁻⁵ to 10⁻⁴ M
dbacp01243 Aurein 2.2 GLFDIVKKVVGALGSL Green and Golden Bell Frog, Australia Cell membrane penetration Not specified Not found Not found Not found
dbacp01244 Aurein 2.2 GLFDIVKKVVGALGSL Southern bell frog, Australia Cell membrane penetration Not specified Not specified Not specified LC50 : 10⁻⁵ to 10⁻⁴ M
dbacp01245 Aurein 2.3 GLFDIVKKVVGAIGSL Green and Golden Bell Frog, Australia Cell membrane penetration Not specified Not found Not found Not found
dbacp01246 Aurein 2.3 GLFDIVKKVVGAIGSL Southern bell frog, Australia Cell membrane penetration Not specified Not specified Not specified LC50 : 10⁻⁵ to 10⁻⁴ M
dbacp01247 Aurein 2.4 GLFDIVKKVVGTLAGL Green and Golden Bell Frog, Australia Cell membrane penetration Not specified Not found Not found Not found
dbacp01248 Aurein 2.4 GLFDIVKKVVGTLAGL Southern bell frog, Australia Cell membrane penetration Not specified Not specified Not specified LC50 : 10⁻⁵ to 10⁻⁴ M
dbacp01249 Aurein 2.5 GLFDIVKKVVGAFGSL Southern bell frog, Australia Cell membrane penetration Not specified Not specified Not specified LC50 : 10⁻⁵ to 10⁻⁴ M
dbacp01250 Aurein 2.6 GLFDIAKKVIGVIGSL Southern bell frog, Australia Cell membrane penetration Not specified Not specified Not specified LC50 : 10⁻⁵ to 10⁻⁴ M
dbacp01432 B1AW FLPLLAGLAANFLPQIICKIARKC Wuyi torrent frog Cell membrane penetration MTT assay PC-3 Human prostatic cancer IC50 : 33.46 μM
dbacp01433 B1AW FLPLLAGLAANFLPQIICKIARKC Wuyi torrent frog Cell membrane penetration MTT assay H838 Non-small lung cancer IC50 : 32.15 μM
dbacp01434 B1AW FLPLLAGLAANFLPQIICKIARKC Wuyi torrent frog Cell membrane penetration MTT assay U251MG Glioblastoma cancer IC50 : 33.56 μM
dbacp01435 B1AW FLPLLAGLAANFLPQIICKIARKC Wuyi torrent frog Cell membrane penetration MTT assay HMEC-1 Glioblastoma cancer IC50 : 32.96 μM
dbacp01436 B1AW FLPLLAGLAANFLPQIICKIARKC Wuyi torrent frog Cell membrane penetration MTT assay HaCaT Glioblastoma cancer IC50 : 44.09 μM
dbacp01437 B1AW-K FLPLLAGLAANFLPKIICKIARKC Wuyi torrent frog Cell membrane penetration MTT assay PC-3 Prostate cancer IC50 : 33.46 μM
dbacp01923 Brevinin-1-AW FLPLLAGLAANFLPQIICKIARKC Skin secretion, the Wuyi torrent frog, China, Asia Cell membrane penetration MTT assay PC-3 Prostate cancer IC50 : 33.46 μM
dbacp02309 Catfish PACAP38 HSDGIFTDSYSRYRKQMAVKKYLAAVLGRRYRQRFRNK Sharptooth catfish, North Africa Cell membrane penetration In vitro cell proliferation assay H460 Lung cancer IC50 :13.17 μM
dbacp02577 Crotamine MKILYLLFAFLFLAFLSEPGNAYKQCHKKGGHCFPKEKICLPPSSDFGKMDCRWRWKCCKKGSGK South American rattlesnake Cell membrane penetration and lysis MTT assay CHO-K1 Not specified IC50 : 5 μM
dbacp02741 Dermaseptin-SS1 ALWKSILKNAGKAALNEINQIV Skin Secretion, Brown-belly leaf frog, South America Cell membrane penetration Anti-proliferative activity assay Not found Lung cancer Not found
dbacp02786 DN-C16orf74 RRRRRRRRRRR-GGG-KHLDVPVIVIPPTPT Not found Cell membrane penetration Immunoprecipitation assay PDAC cells Pancreatic ductal adenocarcinoma Not found
dbacp02955 Figainin 2BN FLGVALKLGKVLGKALLPLASSLLHSQ Norepinephrine-stimulated skin secretion, the Giant Gladiator Treefrog, the Rusty Treefrog, Trinidad, South America Cell membrane penetration Not specified A549 Lung carcinoma LC50 : 7-14 µM
dbacp02956 Figainin 2BN FLGVALKLGKVLGKALLPLASSLLHSQ Norepinephrine-stimulated skin secretion, the Giant Gladiator Treefrog, the Rusty Treefrog, Trinidad, South America Cell membrane penetration Not specified MDA-MB-231 Breast adenocarcinoma LC50 : 7-14 µM
dbacp02957 Figainin 2BN FLGVALKLGKVLGKALLPLASSLLHSQ Norepinephrine-stimulated skin secretion, the Giant Gladiator Treefrog, the Rusty Treefrog, Trinidad, South America Cell membrane penetration Not specified HT-29 Colon adenocarcinoma LC50 : 7-14 µM
dbacp05555 Picturin 1BN GIFKDTLKKVVAAVLTTVADNIHPK Norepinephrine-stimulated skin secretion, the Giant Gladiator Treefrog, the Rusty Treefrog, Trinidad, South America Cell membrane penetration Not specified A549 Lung carcinoma LC50 : 7 - 14 µM
dbacp05556 Picturin 1BN GIFKDTLKKVVAAVLTTVADNIHPK Norepinephrine-stimulated skin secretion, the Giant Gladiator Treefrog, the Rusty Treefrog, Trinidad, South America Cell membrane penetration Not specified MDA-MB-231 Breast adenocarcinoma LC50 : 7 - 14 µM
dbacp05557 Picturin 1BN GIFKDTLKKVVAAVLTTVADNIHPK Norepinephrine-stimulated skin secretion, the Giant Gladiator Treefrog, the Rusty Treefrog, Trinidad, South America Cell membrane penetration Not specified HT-29 Colon adenocarcinoma LC50 : 7 - 14 µM
dbacp05558 Picturin 2BN GLMDMLKKVGKVALTVAKSALLP Norepinephrine-stimulated skin secretion, the Giant Gladiator Treefrog, the Rusty Treefrog, Trinidad, South America Cell membrane penetration Not specified A549 Lung carcinoma LC50 : 7 - 14 µM
dbacp05559 Picturin 2BN GLMDMLKKVGKVALTVAKSALLP Norepinephrine-stimulated skin secretion, the Giant Gladiator Treefrog, the Rusty Treefrog, Trinidad, South America Cell membrane penetration Not specified MDA-MB-231 Breast adenocarcinoma LC50 : 7 - 14 µM
dbacp05560 Picturin 2BN GLMDMLKKVGKVALTVAKSALLP Norepinephrine-stimulated skin secretion, the Giant Gladiator Treefrog, the Rusty Treefrog, Trinidad, South America Cell membrane penetration Not specified HT-29 Colon adenocarcinoma LC50 : 7 - 14 µM
dbacp06803 [C/U, G1K, L5Y, K8R]cGm KURRYUYRQRUVTYURGR Synthetic Analogue of Gomesin Cell membrane penetration Resazurin dye assay CRL-1739 Gastric Cancer CC50 = 46.2 ± 7.6 μM
dbacp06804 [C/U, G1K, L5Y, K8R]cGm KURRYUYRQRUVTYURGR Synthetic Analogue of Gomesin Cell membrane penetration Resazurin dye assay MM96L Skin Cancer CC50 = 2.3 ± 0.2 μM
dbacp06805 [C/U, G1K, L5Y, K8R]cGm KURRYUYRQRUVTYURGR Synthetic Analogue of Gomesin Cell membrane penetration Resazurin dye assay HeLa Cervical Cancer CC50 = 36.2 ± 2.8 μM
dbacp06806 [C/U, G1K, L5Y, K8R]cGm KURRYUYRQRUVTYURGR Synthetic Analogue of Gomesin Cell membrane penetration Resazurin dye assay MCF-7 Breast Cancer CC50 = 29.0 ± 3.7 μM
dbacp06807 [C/U, G1K, L5Y, K8R]cGm KURRYUYRQRUVTYURGR Synthetic Analogue of Gomesin Cell membrane penetration Resazurin dye assay K-562 Leukemia Cancer CC50 = 6.4 ± 0.6 μM
dbacp06808 [C/U, G1K, L5Y, K8R]cGm KURRYUYRQRUVTYURGR Synthetic Analogue of Gomesin Cell membrane penetration Resazurin dye assay HL-60 Leukemia Cancer CC50 = 33.3 ±7.4μM
dbacp06809 [G1K, L5Y, K8R]cGm KCRRYCYRQRCVTYCRGR Synthetic Analogue of Gomesin Cell membrane penetration Resazurin dye assay CRL-1739 Gastric Cancer CC50 = 26.5 ± 2.4 μM
dbacp06810 [G1K, L5Y, K8R]cGm KCRRYCYRQRCVTYCRGR Synthetic Analogue of Gomesin Cell membrane penetration Resazurin dye assay MM96L Skin Cancer CC50 = 2.0 ± 0.1 μM
dbacp06811 [G1K, L5Y, K8R]cGm KCRRYCYRQRCVTYCRGR Synthetic Analogue of Gomesin Cell membrane penetration Resazurin dye assay HeLa Cervical Cancer CC50 = 20.9 ± 1.4 μM
dbacp06812 [G1K, L5Y, K8R]cGm KCRRYCYRQRCVTYCRGR Synthetic Analogue of Gomesin Cell membrane penetration Resazurin dye assay MCF-7 Breast Cancer CC50 = 15.2 ± 1.9 μM
dbacp06813 [G1K, L5Y, K8R]cGm KCRRYCYRQRCVTYCRGR Synthetic Analogue of Gomesin Cell membrane penetration Resazurin dye assay K-562 Leukemia Cancer CC50 = 1.3 ± 0.1 μM
dbacp06814 [G1K, L5Y, K8R]cGm KCRRYCYRQRCVTYCRGR Synthetic Analogue of Gomesin Cell membrane penetration Resazurin dye assay HL-60 Leukemia Cancer CC50 = 15.7 ±1.1μM
dbacp06815 [D-P L-P]cGm GCRRLCYKQRCVTYCRGpPR Synthetic Analogue of Gomesin Cell membrane penetration Resazurin dye assay CRL-1739 Gastric Cancer CC50 = 22.5 ± 3.3 μM
dbacp06816 [D-P L-P]cGm GCRRLCYKQRCVTYCRGpPR Synthetic Analogue of Gomesin Cell membrane penetration Resazurin dye assay MM96L Skin Cancer CC50 = 3.0 ± 0.1 μM
dbacp06817 [D-P L-P]cGm GCRRLCYKQRCVTYCRGpPR Synthetic Analogue of Gomesin Cell membrane penetration Resazurin dye assay HeLa Cervical Cancer CC50 = 51.5 ± 3.9 μM
dbacp06818 [D-P L-P]cGm GCRRLCYKQRCVTYCRGpPR Synthetic Analogue of Gomesin Cell membrane penetration Resazurin dye assay K-562 Leukemia Cancer CC50 = 3.9 ± 0.2 μM
dbacp06819 [C/U]cGm GURRLUYKQRUVTYURGR Synthetic Analogue of Gomesin Cell membrane penetration Resazurin dye assay CRL-1739 Gastric Cancer CC50 = 51.0 ± 4.6 μM
dbacp06820 [C/U]cGm GURRLUYKQRUVTYURGR Synthetic Analogue of Gomesin Cell membrane penetration Resazurin dye assay MM96L Skin Cancer CC50 = 4.6 ± 0.2 μM
dbacp06821 [C/U]cGm GURRLUYKQRUVTYURGR Synthetic Analogue of Gomesin Cell membrane penetration Resazurin dye assay HeLa Cervical Cancer CC50 > 64 μM
dbacp06822 [C/U]cGm GURRLUYKQRUVTYURGR Synthetic Analogue of Gomesin Cell membrane penetration Resazurin dye assay MCF-7 Breast Cancer CC50 = 37.5 ± 3.3 μM
dbacp06823 [C/U]cGm GURRLUYKQRUVTYURGR Synthetic Analogue of Gomesin Cell membrane penetration Resazurin dye assay K-562 Leukemia Cancer CC50 = 1.4 ± 0.2 μM
dbacp06824 [C/U]cGm GURRLUYKQRUVTYURGR Synthetic Analogue of Gomesin Cell membrane penetration Resazurin dye assay HL-60 Leukemia Cancer CC50 = 38.5 ± 4.8 μM
dbacp06825 [G1K, K8R]cGm KCRRLCYRQRCVTYCRGR Synthetic Analogue of Gomesin Cell membrane penetration Resazurin dye assay CRL-1739 Gastric Cancer CC50 = 19.5 ± 0.5 μM
dbacp06826 [G1K, K8R]cGm KCRRLCYRQRCVTYCRGR Synthetic Analogue of Gomesin Cell membrane penetration Resazurin dye assay MM96L Skin Cancer CC50 = 1.7 ± 0.1 μM
dbacp06827 [G1K, K8R]cGm KCRRLCYRQRCVTYCRGR Synthetic Analogue of Gomesin Cell membrane penetration Resazurin dye assay HeLa Cervical Cancer CC50 = 44.2 ± 2.2μM
dbacp06828 [G1K, K8R]cGm KCRRLCYRQRCVTYCRGR Synthetic Analogue of Gomesin Cell membrane penetration Resazurin dye assay MCF-7 Breast Cancer CC50 = 6.7 ± 0.7 μM
dbacp06829 [G1K, K8R]cGm KCRRLCYRQRCVTYCRGR Synthetic Analogue of Gomesin Cell membrane penetration Resazurin dye assay K-562 Leukemia Cancer CC50 = 2.1 ± 0.2 μM
dbacp06830 [G1K, K8R]cGm KCRRLCYRQRCVTYCRGR Synthetic Analogue of Gomesin Cell membrane penetration Resazurin dye assay HL-60 Leukemia Cancer CC50 = 9.0 ± 1.1μM
dbacp06831 [R4A, R18A]cGm GCRALCYKQRCVTYCRGA Synthetic Analogue of Gomesin Cell membrane penetration Resazurin dye assay CRL-1739 Gastric Cancer CC50 > 64 μM
dbacp06832 [R4A, R18A]cGm GCRALCYKQRCVTYCRGA Synthetic Analogue of Gomesin Cell membrane penetration Resazurin dye assay MM96L Skin Cancer CC50 = 10.3 ± 1.1 μM
dbacp06833 [R4A, R18A]cGm GCRALCYKQRCVTYCRGA Synthetic Analogue of Gomesin Cell membrane penetration Resazurin dye assay HeLa Cervical Cancer CC50 > 64 μM
dbacp06834 [R4A, R18A]cGm GCRALCYKQRCVTYCRGA Synthetic Analogue of Gomesin Cell membrane penetration Resazurin dye assay MCF-7 Breast Cancer CC50 = 48.4 ± 0.7 μM
dbacp06835 [R4A, R18A]cGm GCRALCYKQRCVTYCRGA Synthetic Analogue of Gomesin Cell membrane penetration Resazurin dye assay K-562 Leukemia Cancer CC50 = 11.5 ± 0.6 μM
dbacp06836 [R4A, R18A]cGm GCRALCYKQRCVTYCRGA Synthetic Analogue of Gomesin Cell membrane penetration Resazurin dye assay HL-60 Leukemia Cancer CC50 = 34.1 ± 3.9 μM
dbacp06837 [Y7W, K8R, Y14W]cGm GCRRLCWRQRCVTWCRGR Synthetic Analogue of Gomesin Cell membrane penetration Resazurin dye assay CRL-1739 Gastric Cancer CC50 = 31.6 ± 1.3 μM
dbacp06838 [Y7W, K8R, Y14W]cGm GCRRLCWRQRCVTWCRGR Synthetic Analogue of Gomesin Cell membrane penetration Resazurin dye assay MM96L Skin Cancer CC50 = 5.4 ± 0.3 μM
dbacp06839 [Y7W, K8R, Y14W]cGm GCRRLCWRQRCVTWCRGR Synthetic Analogue of Gomesin Cell membrane penetration Resazurin dye assay HeLa Cervical Cancer CC50 = 41.0 ± 4.2 μM
dbacp06840 [Y7W, K8R, Y14W]cGm GCRRLCWRQRCVTWCRGR Synthetic Analogue of Gomesin Cell membrane penetration Resazurin dye assay MCF-7 Breast Cancer CC50 = 15.1 ± 1.4 μM
dbacp06841 [Y7W, K8R, Y14W]cGm GCRRLCWRQRCVTWCRGR Synthetic Analogue of Gomesin Cell membrane penetration Resazurin dye assay K-562 Leukemia Cancer CC50 = 3.9 ± 0.1 μM