71 result(s) have been found!
| Accession | Name | Sequence | Source/Organism | Mechanism | Assay Type | Cell Line | Cancer Type | Activity |
|---|---|---|---|---|---|---|---|---|
| dbacp01239 | Aurein 1.2 | GLFDIIKKIAESF | Southern bell frog Green and Golden Bell Frog, Australia | Cell membrane penetration | Not specified | Not specified | Not specified | LC50 : 10⁻⁵ to 10⁻⁴ M |
| dbacp01240 | Aurein 1.2 | GLFDIIKKIAESF | Southern Bell Frog | Cell membrane penetration | Not specified | Not specified | Not specified | LC50 : 10⁻⁵ to 10⁻⁴ M |
| dbacp01241 | Aurein 2.1 | GLLDIVKKVVGAFGSL | Southern bell frog, Australia | Cell membrane penetration | Not specified | Not found | Not found | Not found |
| dbacp01242 | Aurein 2.1 | GLLDIVKKVVGAFGSL | Southern bell frog, Australia | Cell membrane penetration | Not specified | Not specified | Not specified | LC50 : 10⁻⁵ to 10⁻⁴ M |
| dbacp01243 | Aurein 2.2 | GLFDIVKKVVGALGSL | Green and Golden Bell Frog, Australia | Cell membrane penetration | Not specified | Not found | Not found | Not found |
| dbacp01244 | Aurein 2.2 | GLFDIVKKVVGALGSL | Southern bell frog, Australia | Cell membrane penetration | Not specified | Not specified | Not specified | LC50 : 10⁻⁵ to 10⁻⁴ M |
| dbacp01245 | Aurein 2.3 | GLFDIVKKVVGAIGSL | Green and Golden Bell Frog, Australia | Cell membrane penetration | Not specified | Not found | Not found | Not found |
| dbacp01246 | Aurein 2.3 | GLFDIVKKVVGAIGSL | Southern bell frog, Australia | Cell membrane penetration | Not specified | Not specified | Not specified | LC50 : 10⁻⁵ to 10⁻⁴ M |
| dbacp01247 | Aurein 2.4 | GLFDIVKKVVGTLAGL | Green and Golden Bell Frog, Australia | Cell membrane penetration | Not specified | Not found | Not found | Not found |
| dbacp01248 | Aurein 2.4 | GLFDIVKKVVGTLAGL | Southern bell frog, Australia | Cell membrane penetration | Not specified | Not specified | Not specified | LC50 : 10⁻⁵ to 10⁻⁴ M |
| dbacp01249 | Aurein 2.5 | GLFDIVKKVVGAFGSL | Southern bell frog, Australia | Cell membrane penetration | Not specified | Not specified | Not specified | LC50 : 10⁻⁵ to 10⁻⁴ M |
| dbacp01250 | Aurein 2.6 | GLFDIAKKVIGVIGSL | Southern bell frog, Australia | Cell membrane penetration | Not specified | Not specified | Not specified | LC50 : 10⁻⁵ to 10⁻⁴ M |
| dbacp01432 | B1AW | FLPLLAGLAANFLPQIICKIARKC | Wuyi torrent frog | Cell membrane penetration | MTT assay | PC-3 | Human prostatic cancer | IC50 : 33.46 μM |
| dbacp01433 | B1AW | FLPLLAGLAANFLPQIICKIARKC | Wuyi torrent frog | Cell membrane penetration | MTT assay | H838 | Non-small lung cancer | IC50 : 32.15 μM |
| dbacp01434 | B1AW | FLPLLAGLAANFLPQIICKIARKC | Wuyi torrent frog | Cell membrane penetration | MTT assay | U251MG | Glioblastoma cancer | IC50 : 33.56 μM |
| dbacp01435 | B1AW | FLPLLAGLAANFLPQIICKIARKC | Wuyi torrent frog | Cell membrane penetration | MTT assay | HMEC-1 | Glioblastoma cancer | IC50 : 32.96 μM |
| dbacp01436 | B1AW | FLPLLAGLAANFLPQIICKIARKC | Wuyi torrent frog | Cell membrane penetration | MTT assay | HaCaT | Glioblastoma cancer | IC50 : 44.09 μM |
| dbacp01437 | B1AW-K | FLPLLAGLAANFLPKIICKIARKC | Wuyi torrent frog | Cell membrane penetration | MTT assay | PC-3 | Prostate cancer | IC50 : 33.46 μM |
| dbacp01923 | Brevinin-1-AW | FLPLLAGLAANFLPQIICKIARKC | Skin secretion, the Wuyi torrent frog, China, Asia | Cell membrane penetration | MTT assay | PC-3 | Prostate cancer | IC50 : 33.46 μM |
| dbacp02309 | Catfish PACAP38 | HSDGIFTDSYSRYRKQMAVKKYLAAVLGRRYRQRFRNK | Sharptooth catfish, North Africa | Cell membrane penetration | In vitro cell proliferation assay | H460 | Lung cancer | IC50 :13.17 μM |
| dbacp02577 | Crotamine | MKILYLLFAFLFLAFLSEPGNAYKQCHKKGGHCFPKEKICLPPSSDFGKMDCRWRWKCCKKGSGK | South American rattlesnake | Cell membrane penetration and lysis | MTT assay | CHO-K1 | Not specified | IC50 : 5 μM |
| dbacp02741 | Dermaseptin-SS1 | ALWKSILKNAGKAALNEINQIV | Skin Secretion, Brown-belly leaf frog, South America | Cell membrane penetration | Anti-proliferative activity assay | Not found | Lung cancer | Not found |
| dbacp02786 | DN-C16orf74 | RRRRRRRRRRR-GGG-KHLDVPVIVIPPTPT | Not found | Cell membrane penetration | Immunoprecipitation assay | PDAC cells | Pancreatic ductal adenocarcinoma | Not found |
| dbacp02955 | Figainin 2BN | FLGVALKLGKVLGKALLPLASSLLHSQ | Norepinephrine-stimulated skin secretion, the Giant Gladiator Treefrog, the Rusty Treefrog, Trinidad, South America | Cell membrane penetration | Not specified | A549 | Lung carcinoma | LC50 : 7-14 µM |
| dbacp02956 | Figainin 2BN | FLGVALKLGKVLGKALLPLASSLLHSQ | Norepinephrine-stimulated skin secretion, the Giant Gladiator Treefrog, the Rusty Treefrog, Trinidad, South America | Cell membrane penetration | Not specified | MDA-MB-231 | Breast adenocarcinoma | LC50 : 7-14 µM |
| dbacp02957 | Figainin 2BN | FLGVALKLGKVLGKALLPLASSLLHSQ | Norepinephrine-stimulated skin secretion, the Giant Gladiator Treefrog, the Rusty Treefrog, Trinidad, South America | Cell membrane penetration | Not specified | HT-29 | Colon adenocarcinoma | LC50 : 7-14 µM |
| dbacp05555 | Picturin 1BN | GIFKDTLKKVVAAVLTTVADNIHPK | Norepinephrine-stimulated skin secretion, the Giant Gladiator Treefrog, the Rusty Treefrog, Trinidad, South America | Cell membrane penetration | Not specified | A549 | Lung carcinoma | LC50 : 7 - 14 µM |
| dbacp05556 | Picturin 1BN | GIFKDTLKKVVAAVLTTVADNIHPK | Norepinephrine-stimulated skin secretion, the Giant Gladiator Treefrog, the Rusty Treefrog, Trinidad, South America | Cell membrane penetration | Not specified | MDA-MB-231 | Breast adenocarcinoma | LC50 : 7 - 14 µM |
| dbacp05557 | Picturin 1BN | GIFKDTLKKVVAAVLTTVADNIHPK | Norepinephrine-stimulated skin secretion, the Giant Gladiator Treefrog, the Rusty Treefrog, Trinidad, South America | Cell membrane penetration | Not specified | HT-29 | Colon adenocarcinoma | LC50 : 7 - 14 µM |
| dbacp05558 | Picturin 2BN | GLMDMLKKVGKVALTVAKSALLP | Norepinephrine-stimulated skin secretion, the Giant Gladiator Treefrog, the Rusty Treefrog, Trinidad, South America | Cell membrane penetration | Not specified | A549 | Lung carcinoma | LC50 : 7 - 14 µM |
| dbacp05559 | Picturin 2BN | GLMDMLKKVGKVALTVAKSALLP | Norepinephrine-stimulated skin secretion, the Giant Gladiator Treefrog, the Rusty Treefrog, Trinidad, South America | Cell membrane penetration | Not specified | MDA-MB-231 | Breast adenocarcinoma | LC50 : 7 - 14 µM |
| dbacp05560 | Picturin 2BN | GLMDMLKKVGKVALTVAKSALLP | Norepinephrine-stimulated skin secretion, the Giant Gladiator Treefrog, the Rusty Treefrog, Trinidad, South America | Cell membrane penetration | Not specified | HT-29 | Colon adenocarcinoma | LC50 : 7 - 14 µM |
| dbacp06803 | [C/U, G1K, L5Y, K8R]cGm | KURRYUYRQRUVTYURGR | Synthetic Analogue of Gomesin | Cell membrane penetration | Resazurin dye assay | CRL-1739 | Gastric Cancer | CC50 = 46.2 ± 7.6 μM |
| dbacp06804 | [C/U, G1K, L5Y, K8R]cGm | KURRYUYRQRUVTYURGR | Synthetic Analogue of Gomesin | Cell membrane penetration | Resazurin dye assay | MM96L | Skin Cancer | CC50 = 2.3 ± 0.2 μM |
| dbacp06805 | [C/U, G1K, L5Y, K8R]cGm | KURRYUYRQRUVTYURGR | Synthetic Analogue of Gomesin | Cell membrane penetration | Resazurin dye assay | HeLa | Cervical Cancer | CC50 = 36.2 ± 2.8 μM |
| dbacp06806 | [C/U, G1K, L5Y, K8R]cGm | KURRYUYRQRUVTYURGR | Synthetic Analogue of Gomesin | Cell membrane penetration | Resazurin dye assay | MCF-7 | Breast Cancer | CC50 = 29.0 ± 3.7 μM |
| dbacp06807 | [C/U, G1K, L5Y, K8R]cGm | KURRYUYRQRUVTYURGR | Synthetic Analogue of Gomesin | Cell membrane penetration | Resazurin dye assay | K-562 | Leukemia Cancer | CC50 = 6.4 ± 0.6 μM |
| dbacp06808 | [C/U, G1K, L5Y, K8R]cGm | KURRYUYRQRUVTYURGR | Synthetic Analogue of Gomesin | Cell membrane penetration | Resazurin dye assay | HL-60 | Leukemia Cancer | CC50 = 33.3 ±7.4μM |
| dbacp06809 | [G1K, L5Y, K8R]cGm | KCRRYCYRQRCVTYCRGR | Synthetic Analogue of Gomesin | Cell membrane penetration | Resazurin dye assay | CRL-1739 | Gastric Cancer | CC50 = 26.5 ± 2.4 μM |
| dbacp06810 | [G1K, L5Y, K8R]cGm | KCRRYCYRQRCVTYCRGR | Synthetic Analogue of Gomesin | Cell membrane penetration | Resazurin dye assay | MM96L | Skin Cancer | CC50 = 2.0 ± 0.1 μM |
| dbacp06811 | [G1K, L5Y, K8R]cGm | KCRRYCYRQRCVTYCRGR | Synthetic Analogue of Gomesin | Cell membrane penetration | Resazurin dye assay | HeLa | Cervical Cancer | CC50 = 20.9 ± 1.4 μM |
| dbacp06812 | [G1K, L5Y, K8R]cGm | KCRRYCYRQRCVTYCRGR | Synthetic Analogue of Gomesin | Cell membrane penetration | Resazurin dye assay | MCF-7 | Breast Cancer | CC50 = 15.2 ± 1.9 μM |
| dbacp06813 | [G1K, L5Y, K8R]cGm | KCRRYCYRQRCVTYCRGR | Synthetic Analogue of Gomesin | Cell membrane penetration | Resazurin dye assay | K-562 | Leukemia Cancer | CC50 = 1.3 ± 0.1 μM |
| dbacp06814 | [G1K, L5Y, K8R]cGm | KCRRYCYRQRCVTYCRGR | Synthetic Analogue of Gomesin | Cell membrane penetration | Resazurin dye assay | HL-60 | Leukemia Cancer | CC50 = 15.7 ±1.1μM |
| dbacp06815 | [D-P L-P]cGm | GCRRLCYKQRCVTYCRGpPR | Synthetic Analogue of Gomesin | Cell membrane penetration | Resazurin dye assay | CRL-1739 | Gastric Cancer | CC50 = 22.5 ± 3.3 μM |
| dbacp06816 | [D-P L-P]cGm | GCRRLCYKQRCVTYCRGpPR | Synthetic Analogue of Gomesin | Cell membrane penetration | Resazurin dye assay | MM96L | Skin Cancer | CC50 = 3.0 ± 0.1 μM |
| dbacp06817 | [D-P L-P]cGm | GCRRLCYKQRCVTYCRGpPR | Synthetic Analogue of Gomesin | Cell membrane penetration | Resazurin dye assay | HeLa | Cervical Cancer | CC50 = 51.5 ± 3.9 μM |
| dbacp06818 | [D-P L-P]cGm | GCRRLCYKQRCVTYCRGpPR | Synthetic Analogue of Gomesin | Cell membrane penetration | Resazurin dye assay | K-562 | Leukemia Cancer | CC50 = 3.9 ± 0.2 μM |
| dbacp06819 | [C/U]cGm | GURRLUYKQRUVTYURGR | Synthetic Analogue of Gomesin | Cell membrane penetration | Resazurin dye assay | CRL-1739 | Gastric Cancer | CC50 = 51.0 ± 4.6 μM |
| dbacp06820 | [C/U]cGm | GURRLUYKQRUVTYURGR | Synthetic Analogue of Gomesin | Cell membrane penetration | Resazurin dye assay | MM96L | Skin Cancer | CC50 = 4.6 ± 0.2 μM |
| dbacp06821 | [C/U]cGm | GURRLUYKQRUVTYURGR | Synthetic Analogue of Gomesin | Cell membrane penetration | Resazurin dye assay | HeLa | Cervical Cancer | CC50 > 64 μM |
| dbacp06822 | [C/U]cGm | GURRLUYKQRUVTYURGR | Synthetic Analogue of Gomesin | Cell membrane penetration | Resazurin dye assay | MCF-7 | Breast Cancer | CC50 = 37.5 ± 3.3 μM |
| dbacp06823 | [C/U]cGm | GURRLUYKQRUVTYURGR | Synthetic Analogue of Gomesin | Cell membrane penetration | Resazurin dye assay | K-562 | Leukemia Cancer | CC50 = 1.4 ± 0.2 μM |
| dbacp06824 | [C/U]cGm | GURRLUYKQRUVTYURGR | Synthetic Analogue of Gomesin | Cell membrane penetration | Resazurin dye assay | HL-60 | Leukemia Cancer | CC50 = 38.5 ± 4.8 μM |
| dbacp06825 | [G1K, K8R]cGm | KCRRLCYRQRCVTYCRGR | Synthetic Analogue of Gomesin | Cell membrane penetration | Resazurin dye assay | CRL-1739 | Gastric Cancer | CC50 = 19.5 ± 0.5 μM |
| dbacp06826 | [G1K, K8R]cGm | KCRRLCYRQRCVTYCRGR | Synthetic Analogue of Gomesin | Cell membrane penetration | Resazurin dye assay | MM96L | Skin Cancer | CC50 = 1.7 ± 0.1 μM |
| dbacp06827 | [G1K, K8R]cGm | KCRRLCYRQRCVTYCRGR | Synthetic Analogue of Gomesin | Cell membrane penetration | Resazurin dye assay | HeLa | Cervical Cancer | CC50 = 44.2 ± 2.2μM |
| dbacp06828 | [G1K, K8R]cGm | KCRRLCYRQRCVTYCRGR | Synthetic Analogue of Gomesin | Cell membrane penetration | Resazurin dye assay | MCF-7 | Breast Cancer | CC50 = 6.7 ± 0.7 μM |
| dbacp06829 | [G1K, K8R]cGm | KCRRLCYRQRCVTYCRGR | Synthetic Analogue of Gomesin | Cell membrane penetration | Resazurin dye assay | K-562 | Leukemia Cancer | CC50 = 2.1 ± 0.2 μM |
| dbacp06830 | [G1K, K8R]cGm | KCRRLCYRQRCVTYCRGR | Synthetic Analogue of Gomesin | Cell membrane penetration | Resazurin dye assay | HL-60 | Leukemia Cancer | CC50 = 9.0 ± 1.1μM |
| dbacp06831 | [R4A, R18A]cGm | GCRALCYKQRCVTYCRGA | Synthetic Analogue of Gomesin | Cell membrane penetration | Resazurin dye assay | CRL-1739 | Gastric Cancer | CC50 > 64 μM |
| dbacp06832 | [R4A, R18A]cGm | GCRALCYKQRCVTYCRGA | Synthetic Analogue of Gomesin | Cell membrane penetration | Resazurin dye assay | MM96L | Skin Cancer | CC50 = 10.3 ± 1.1 μM |
| dbacp06833 | [R4A, R18A]cGm | GCRALCYKQRCVTYCRGA | Synthetic Analogue of Gomesin | Cell membrane penetration | Resazurin dye assay | HeLa | Cervical Cancer | CC50 > 64 μM |
| dbacp06834 | [R4A, R18A]cGm | GCRALCYKQRCVTYCRGA | Synthetic Analogue of Gomesin | Cell membrane penetration | Resazurin dye assay | MCF-7 | Breast Cancer | CC50 = 48.4 ± 0.7 μM |
| dbacp06835 | [R4A, R18A]cGm | GCRALCYKQRCVTYCRGA | Synthetic Analogue of Gomesin | Cell membrane penetration | Resazurin dye assay | K-562 | Leukemia Cancer | CC50 = 11.5 ± 0.6 μM |
| dbacp06836 | [R4A, R18A]cGm | GCRALCYKQRCVTYCRGA | Synthetic Analogue of Gomesin | Cell membrane penetration | Resazurin dye assay | HL-60 | Leukemia Cancer | CC50 = 34.1 ± 3.9 μM |
| dbacp06837 | [Y7W, K8R, Y14W]cGm | GCRRLCWRQRCVTWCRGR | Synthetic Analogue of Gomesin | Cell membrane penetration | Resazurin dye assay | CRL-1739 | Gastric Cancer | CC50 = 31.6 ± 1.3 μM |
| dbacp06838 | [Y7W, K8R, Y14W]cGm | GCRRLCWRQRCVTWCRGR | Synthetic Analogue of Gomesin | Cell membrane penetration | Resazurin dye assay | MM96L | Skin Cancer | CC50 = 5.4 ± 0.3 μM |
| dbacp06839 | [Y7W, K8R, Y14W]cGm | GCRRLCWRQRCVTWCRGR | Synthetic Analogue of Gomesin | Cell membrane penetration | Resazurin dye assay | HeLa | Cervical Cancer | CC50 = 41.0 ± 4.2 μM |
| dbacp06840 | [Y7W, K8R, Y14W]cGm | GCRRLCWRQRCVTWCRGR | Synthetic Analogue of Gomesin | Cell membrane penetration | Resazurin dye assay | MCF-7 | Breast Cancer | CC50 = 15.1 ± 1.4 μM |
| dbacp06841 | [Y7W, K8R, Y14W]cGm | GCRRLCWRQRCVTWCRGR | Synthetic Analogue of Gomesin | Cell membrane penetration | Resazurin dye assay | K-562 | Leukemia Cancer | CC50 = 3.9 ± 0.1 μM |