dbACP: A Comprehensive Database of Anti-Cancer Peptides

41 result(s) have been found!

Accession Name Sequence Source/Organism Mechanism Assay Type Cell Line Cancer Type Activity
dbacp05134 Pardaxin GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE Red sea moses sole Inducing apoptosis MTT/MTS assay HT-1080 Fibrosarcoma IC50 : 15.74 µg/ml
dbacp05135 Pardaxin GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE Red sea moses sole Inducing apoptosis MTT/MTS assay HT-1080 Fibrosarcoma IC50 : 15.40 µg/ml
dbacp05136 Pardaxin GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE Red sea moses sole Inducing apoptosis MTT/MTS assay HT-1080 Fibrosarcoma IC50 : 14.51 µg/ml
dbacp05137 Pardaxin GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE Red sea moses sole Inducing apoptosis MTT/MTS assay HT-1080 Fibrosarcoma IC50 : 14.52 µg/ml
dbacp05138 Pardaxin 4 GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE Red sea moses sole Interference with ionic transport of the osmoregulatory system in epithelium causing cell lysis Not specified Not found Not found Not found
dbacp05139 Pardaxin-1 GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HeLa Cervical cancer 62 % Cytotoxicity at 50 mg/L
dbacp05140 Pardaxin-1 GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HeLa Cervical cancer 44 % Cytotoxicity at 25 mg/L
dbacp05141 Pardaxin-1 GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HeLa Cervical cancer 4 % Cytotoxicity at 12.5 mg/L
dbacp05142 Pardaxin-1 GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HeLa Cervical cancer 75 % Cytotoxicity at 50 mg/L
dbacp05143 Pardaxin-1 GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HeLa Cervical cancer 70 % Cytotoxicity at 25 mg/L
dbacp05144 Pardaxin-1 GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HeLa Cervical cancer 4 % Cytotoxicity at 3.125 mg/L
dbacp05145 Pardaxin-1 GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HeLa Cervical cancer 78 % Cytotoxicity at 50 mg/L
dbacp05146 Pardaxin-1 GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HeLa Cervical cancer 68 % Cytotoxicity at 25 mg/L
dbacp05147 Pardaxin-1 GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HeLa Cervical cancer 4 % Cytotoxicity at 12.5 mg/L
dbacp05148 Pardaxin-1 GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HeLa Cervical cancer 5 % Cytotoxicity at 6.25 mg/L
dbacp05149 Pardaxin-1 GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HeLa Cervical cancer 10 % Cytotoxicity at 3.125 mg/L
dbacp05150 Pardaxin-1 GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HeLa Cervical cancer 90 % Cytotoxicity at 50 mg/L
dbacp05151 Pardaxin-1 GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HeLa Cervical cancer 80 % Cytotoxicity at 25 mg/L
dbacp05152 Pardaxin-1 GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HeLa Cervical cancer 15 % Cytotoxicity at 12.5 mg/L
dbacp05153 Pardaxin-1 GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HeLa Cervical cancer 12 % Cytotoxicity at 6.25 mg/L
dbacp05154 Pardaxin-1 GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HeLa Cervical cancer 5 % Cytotoxicity at 3.125 mg/L
dbacp05155 Pardaxin-1 GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 88 % Cytotoxicity at 50 mg/L
dbacp05156 Pardaxin-1 GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 82 % Cytotoxicity at 25 mg/L
dbacp05157 Pardaxin-1 GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 40 % Cytotoxicity at 12.5 mg/L
dbacp05158 Pardaxin-1 GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 35 % Cytotoxicity at 6.25 mg/L
dbacp05159 Pardaxin-1 GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 35 % Cytotoxicity at 3.125 mg/L
dbacp05160 Pardaxin-1 GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 90 % Cytotoxicity at 50 mg/L
dbacp05161 Pardaxin-1 GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 90 % Cytotoxicity at 25 mg/L
dbacp05162 Pardaxin-1 GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 30 % Cytotoxicity at 12.5 mg/L
dbacp05163 Pardaxin-1 GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 30 % Cytotoxicity at 6.25 mg/L
dbacp05164 Pardaxin-1 GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 30 % Cytotoxicity at 3.125 mg/L
dbacp05165 Pardaxin-1 GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 97 % Cytotoxicity at 50 mg/L
dbacp05166 Pardaxin-1 GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 95 % Cytotoxicity at 25 mg/L
dbacp05167 Pardaxin-1 GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 39 % Cytotoxicity at 12.5 mg/L
dbacp05168 Pardaxin-1 GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 28 % Cytotoxicity at 6.25 mg/L
dbacp05169 Pardaxin-1 GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 38 % Cytotoxicity at 3.125 mg/L
dbacp05170 Pardaxin-1 GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 90 % Cytotoxicity at 50 mg/L
dbacp05171 Pardaxin-1 GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 90 % Cytotoxicity at 25 mg/L
dbacp05172 Pardaxin-1 GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 15 % Cytotoxicity at 12.5 mg/L
dbacp05173 Pardaxin-1 GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 5 % Cytotoxicity at 6.25 mg/L
dbacp05174 Pardaxin-1 GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 10 % Cytotoxicity at 3.125 mg/L