41 result(s) have been found!
| Accession | Name | Sequence | Source/Organism | Mechanism | Assay Type | Cell Line | Cancer Type | Activity |
|---|---|---|---|---|---|---|---|---|
| dbacp05134 | Pardaxin | GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE | Red sea moses sole | Inducing apoptosis | MTT/MTS assay | HT-1080 | Fibrosarcoma | IC50 : 15.74 µg/ml |
| dbacp05135 | Pardaxin | GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE | Red sea moses sole | Inducing apoptosis | MTT/MTS assay | HT-1080 | Fibrosarcoma | IC50 : 15.40 µg/ml |
| dbacp05136 | Pardaxin | GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE | Red sea moses sole | Inducing apoptosis | MTT/MTS assay | HT-1080 | Fibrosarcoma | IC50 : 14.51 µg/ml |
| dbacp05137 | Pardaxin | GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE | Red sea moses sole | Inducing apoptosis | MTT/MTS assay | HT-1080 | Fibrosarcoma | IC50 : 14.52 µg/ml |
| dbacp05138 | Pardaxin 4 | GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE | Red sea moses sole | Interference with ionic transport of the osmoregulatory system in epithelium causing cell lysis | Not specified | Not found | Not found | Not found |
| dbacp05139 | Pardaxin-1 | GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HeLa | Cervical cancer | 62 % Cytotoxicity at 50 mg/L |
| dbacp05140 | Pardaxin-1 | GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HeLa | Cervical cancer | 44 % Cytotoxicity at 25 mg/L |
| dbacp05141 | Pardaxin-1 | GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HeLa | Cervical cancer | 4 % Cytotoxicity at 12.5 mg/L |
| dbacp05142 | Pardaxin-1 | GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HeLa | Cervical cancer | 75 % Cytotoxicity at 50 mg/L |
| dbacp05143 | Pardaxin-1 | GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HeLa | Cervical cancer | 70 % Cytotoxicity at 25 mg/L |
| dbacp05144 | Pardaxin-1 | GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HeLa | Cervical cancer | 4 % Cytotoxicity at 3.125 mg/L |
| dbacp05145 | Pardaxin-1 | GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HeLa | Cervical cancer | 78 % Cytotoxicity at 50 mg/L |
| dbacp05146 | Pardaxin-1 | GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HeLa | Cervical cancer | 68 % Cytotoxicity at 25 mg/L |
| dbacp05147 | Pardaxin-1 | GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HeLa | Cervical cancer | 4 % Cytotoxicity at 12.5 mg/L |
| dbacp05148 | Pardaxin-1 | GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HeLa | Cervical cancer | 5 % Cytotoxicity at 6.25 mg/L |
| dbacp05149 | Pardaxin-1 | GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HeLa | Cervical cancer | 10 % Cytotoxicity at 3.125 mg/L |
| dbacp05150 | Pardaxin-1 | GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HeLa | Cervical cancer | 90 % Cytotoxicity at 50 mg/L |
| dbacp05151 | Pardaxin-1 | GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HeLa | Cervical cancer | 80 % Cytotoxicity at 25 mg/L |
| dbacp05152 | Pardaxin-1 | GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HeLa | Cervical cancer | 15 % Cytotoxicity at 12.5 mg/L |
| dbacp05153 | Pardaxin-1 | GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HeLa | Cervical cancer | 12 % Cytotoxicity at 6.25 mg/L |
| dbacp05154 | Pardaxin-1 | GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HeLa | Cervical cancer | 5 % Cytotoxicity at 3.125 mg/L |
| dbacp05155 | Pardaxin-1 | GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HT-1080 | Fibrosarcoma | 88 % Cytotoxicity at 50 mg/L |
| dbacp05156 | Pardaxin-1 | GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HT-1080 | Fibrosarcoma | 82 % Cytotoxicity at 25 mg/L |
| dbacp05157 | Pardaxin-1 | GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HT-1080 | Fibrosarcoma | 40 % Cytotoxicity at 12.5 mg/L |
| dbacp05158 | Pardaxin-1 | GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HT-1080 | Fibrosarcoma | 35 % Cytotoxicity at 6.25 mg/L |
| dbacp05159 | Pardaxin-1 | GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HT-1080 | Fibrosarcoma | 35 % Cytotoxicity at 3.125 mg/L |
| dbacp05160 | Pardaxin-1 | GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HT-1080 | Fibrosarcoma | 90 % Cytotoxicity at 50 mg/L |
| dbacp05161 | Pardaxin-1 | GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HT-1080 | Fibrosarcoma | 90 % Cytotoxicity at 25 mg/L |
| dbacp05162 | Pardaxin-1 | GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HT-1080 | Fibrosarcoma | 30 % Cytotoxicity at 12.5 mg/L |
| dbacp05163 | Pardaxin-1 | GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HT-1080 | Fibrosarcoma | 30 % Cytotoxicity at 6.25 mg/L |
| dbacp05164 | Pardaxin-1 | GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HT-1080 | Fibrosarcoma | 30 % Cytotoxicity at 3.125 mg/L |
| dbacp05165 | Pardaxin-1 | GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HT-1080 | Fibrosarcoma | 97 % Cytotoxicity at 50 mg/L |
| dbacp05166 | Pardaxin-1 | GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HT-1080 | Fibrosarcoma | 95 % Cytotoxicity at 25 mg/L |
| dbacp05167 | Pardaxin-1 | GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HT-1080 | Fibrosarcoma | 39 % Cytotoxicity at 12.5 mg/L |
| dbacp05168 | Pardaxin-1 | GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HT-1080 | Fibrosarcoma | 28 % Cytotoxicity at 6.25 mg/L |
| dbacp05169 | Pardaxin-1 | GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HT-1080 | Fibrosarcoma | 38 % Cytotoxicity at 3.125 mg/L |
| dbacp05170 | Pardaxin-1 | GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HT-1080 | Fibrosarcoma | 90 % Cytotoxicity at 50 mg/L |
| dbacp05171 | Pardaxin-1 | GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HT-1080 | Fibrosarcoma | 90 % Cytotoxicity at 25 mg/L |
| dbacp05172 | Pardaxin-1 | GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HT-1080 | Fibrosarcoma | 15 % Cytotoxicity at 12.5 mg/L |
| dbacp05173 | Pardaxin-1 | GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HT-1080 | Fibrosarcoma | 5 % Cytotoxicity at 6.25 mg/L |
| dbacp05174 | Pardaxin-1 | GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HT-1080 | Fibrosarcoma | 10 % Cytotoxicity at 3.125 mg/L |