32 result(s) have been found!
| Accession | Name | Sequence | Source/Organism | Mechanism | Assay Type | Cell Line | Cancer Type | Activity |
|---|---|---|---|---|---|---|---|---|
| dbacp02652 | Dermaseptin PS4 | MDILKKSIFLVLFLGLVSLSICEEEKRENEDEEKQEDDEQSEEKRALWKTLLKHVGKAAGKAALNAVTDMVNQGEQ | Sauvage's leaf frog | Membrane disruption | Lactate dehydrogenase (LDH) cytotoxicity assay, MTT assay | H157 | Glioma | MIC : 10−9 to 10−4 M |
| dbacp02684 | Dermaseptin-PH | ALWKEVLKNAGKAALNEINNLV | Orange-legged leaf frog, Northern orange-legged leaf frog, South America | Cell membrane permeabilization | MTT cell proliferation assay | H157 | Glioma | IC50 : 2.01 μM |
| dbacp02728 | Dermaseptin-PS4 | ALWKTLLKHVGKAAGKAALNAVTDMVNQ | Waxy monkey tree frog | Membrane disruption | Lactate dehydrogenase (LDH) cytotoxicity assay, MTT assay | H157 | Glioma | MIC : 10−9 to 10−4 M |
| dbacp04581 | Mastoparan-Cimals. XXA; UCLL1c) | LNLKALLAVAKKIL | Venom, the European Hornet | Inducing apoptosis | MTT cell viability assay and Lactate dehydrogenase (LDH) leakage assay | U251-MG | Glioma | MIC : 6.26 - 36.65 μM |
| dbacp04583 | Mastoparan-Cimals. XXA; UCLL1c) | LNLKALLAVAKKIL | Venom, the European Hornet | Inducing apoptosis | MTT cell viability assay and Lactate dehydrogenase (LDH) leakage assay | HMEC-1 | Glioma | MIC : 6.26 - 36.65 μM |
| dbacp04587 | Mastoparan-Cimals. XXA; UCLL1c) | LNLKALLAVAKKIL | Venom, the European Hornet | Inducing apoptosis | MTT cell viability assay and Lactate dehydrogenase (LDH) leakage assay | U251-MG | Glioma | IC50 : < 4 μM |
| dbacp04589 | Mastoparan-Cimals. XXA; UCLL1c) | LNLKALLAVAKKIL | Venom, the European Hornet | Inducing apoptosis | MTT cell viability assay and Lactate dehydrogenase (LDH) leakage assay | HMEC-1 | Glioma | IC50 : < 4 μM |
| dbacp04830 | Neurotoxin BmK AGAP-SYPU2 | VKDGYIVDDKNCAYFCGRNAYCDDECEKNGAESGYCQWAGVYGNACWCYKLPDKVPIRVPGRCNG | Manchurian scorpion | Blocker of chloride channels and can inhibit the migration of glioma cells | Antitumor activity assays | Ehrlich ascites cells | Glioma | ED50 : 1.42 mg/kg |
| dbacp05009 | Okinawa Habu apoxin protein-1(OHAP-1) | ADDRNPLEECFRETDYEEFLEIARNGLKKT | Venom base | Inducing apoptosis | DNA gel electrophoresis assay,TUNEL assay, MTT assay | RBR17T | Glioma | IC50 : 2.1 ± 0.58 µg/ml |
| dbacp05010 | Okinawa Habu apoxin protein-1(OHAP-1) | ADDRNPLEECFRETDYEEFLEIARNGLKKT | Venom base | Inducing apoptosis | DNA gel electrophoresis assay,TUNEL assay, MTT assay | OHAP-1 | Glioma | IC50 : 1.9 ± 0.31 µg/ml |
| dbacp05011 | Okinawa Habu apoxin protein-1(OHAP-1) | ADDRNPLEECFRETDYEEFLEIARNGLKKT | Venom base | Inducing apoptosis | DNA gel electrophoresis assay,TUNEL assay, MTT assay | C6 | Glioma | IC50 : 2.48 ± 0.26 µg/ml |
| dbacp05215 | PcTx-1 | EDCIPKWKGCVNRHGDCCEGLECWKRRRSFEVCVPKTPKTOHa | Trinidad chevron tarantula | Membrane permeabilization | Transwell Migration assay, Scratch wound migration assay | D54-MG | Glioma | Not found |
| dbacp05799 | R2PLx-22 | GIMDTVKNAAKNLAGQLLDKLK | Not found | Inducing apoptosis | MTT and LDH assay | H157 | Glioma | IC50 : 843.40 µM |
| dbacp05803 | R2PLx-22 | GIMDTVKNAAKNLAGQLLDKLK | Not found | Inducing apoptosis | MTT and LDH assay | MBD-MB-435s | Glioma | IC50 : 872.70 µM |
| dbacp05807 | R2PLx-22 | GIMDTVKNAAKNLAGQLLDKLK | Not found | Inducing apoptosis | MTT and LDH assay | PC-3 | Glioma | IC50 : 283.90 µM |
| dbacp05811 | R2PLx-22 | GIMDTVKNAAKNLAGQLLDKLK | Not found | Inducing apoptosis | MTT and LDH assay | U251-MG | Glioma | IC50 : 104.10 µM |
| dbacp05815 | R2PLx-22 | GIMDTVKNAAKNLAGQLLDKLK | Not found | Inducing apoptosis | MTT and LDH assay | MCF-7 | Glioma | IC50 : 109.30 µM |
| dbacp05819 | R2PLx-22 | GIMDTVKNAAKNLAGQLLDKLK | Not found | Inducing apoptosis | MTT and LDH assay | HMEC-1 | Glioma | IC50 : 588.20 µM |
| dbacp05880 | Ranatuerin-2PLx | GIMDTVKNAAKNLAGQLLDKLKCKITAC | Not found | Inducing apoptosis | MTT and LDH assay | H157 | Glioma | IC50 : 5.90 µM |
| dbacp05884 | Ranatuerin-2PLx | GIMDTVKNAAKNLAGQLLDKLKCKITAC | Not found | Inducing apoptosis | MTT and LDH assay | MBD-MB-435s | Glioma | IC50 : 15.44 µM |
| dbacp05888 | Ranatuerin-2PLx | GIMDTVKNAAKNLAGQLLDKLKCKITAC | Not found | Inducing apoptosis | MTT and LDH assay | PC-3 | Glioma | IC50 : 5.79 µM |
| dbacp05892 | Ranatuerin-2PLx | GIMDTVKNAAKNLAGQLLDKLKCKITAC | Not found | Inducing apoptosis | MTT and LDH assay | U251-MG | Glioma | IC50 : 16.14 µM |
| dbacp05896 | Ranatuerin-2PLx | GIMDTVKNAAKNLAGQLLDKLKCKITAC | Not found | Inducing apoptosis | MTT and LDH assay | MCF-7) | Glioma | IC50 : 20.19 µM |
| dbacp05900 | Ranatuerin-2PLx | GIMDTVKNAAKNLAGQLLDKLKCKITAC | Not found | Inducing apoptosis | MTT and LDH assay | HMEC-1 | Glioma | IC50 : 79.50 µM |
| dbacp05909 | Ranatuerin-2PLx | GIMDTVKNAAKNLAGQLLDKLKCSITAC | Skin secretions, the pickerel frog, North America | Inducing apoptosis | MTT Cell viability assay and Lactate dehydrogenase (LDH) leakage assay | U251-MG | Glioma | IC50 : 16.14 µM |
| dbacp05911 | Ranatuerin-2PLx | GIMDTVKNAAKNLAGQLLDKLKCSITAC | Skin secretions, the pickerel frog, North America | Inducing apoptosis | MTT Cell viability assay and Lactate dehydrogenase (LDH) leakage assay | HMEC-1 | Glioma | IC50 : 79.50 µM |
| dbacp05987 | S−24-R2PLx | GIMDTVKNAAKNLAGQLLDKLKCSITAC | Not found | Inducing apoptosis | MTT and LDH assay | H157 | Glioma | IC50 : 58.18 µM |
| dbacp05991 | S−24-R2PLx | GIMDTVKNAAKNLAGQLLDKLKCSITAC | Not found | Inducing apoptosis | MTT and LDH assay | MBD-MB-435s | Glioma | IC50 : 179.00 µM |
| dbacp05995 | S−24-R2PLx | GIMDTVKNAAKNLAGQLLDKLKCSITAC | Not found | Inducing apoptosis | MTT and LDH assay | PC-3 | Glioma | IC50 : 792.60 µM |
| dbacp05999 | S−24-R2PLx | GIMDTVKNAAKNLAGQLLDKLKCSITAC | Not found | Inducing apoptosis | MTT and LDH assay | U251-MG | Glioma | IC50 : 278.30 µM |
| dbacp06003 | S−24-R2PLx | GIMDTVKNAAKNLAGQLLDKLKCSITAC | Not found | Inducing apoptosis | MTT and LDH assay | MCF-7 | Glioma | IC50 : 316.90 µM |
| dbacp06007 | S−24-R2PLx | GIMDTVKNAAKNLAGQLLDKLKCSITAC | Not found | Inducing apoptosis | MTT and LDH assay | HMEC-1 | Glioma | IC50 : 1185.00 µM |