dbACP: A Comprehensive Database of Anti-Cancer Peptides

32 result(s) have been found!

Accession Name Sequence Source/Organism Mechanism Assay Type Cell Line Cancer Type Activity
dbacp02652 Dermaseptin PS4 MDILKKSIFLVLFLGLVSLSICEEEKRENEDEEKQEDDEQSEEKRALWKTLLKHVGKAAGKAALNAVTDMVNQGEQ Sauvage's leaf frog Membrane disruption Lactate dehydrogenase (LDH) cytotoxicity assay, MTT assay H157 Glioma MIC : 10−9 to 10−4 M
dbacp02684 Dermaseptin-PH ALWKEVLKNAGKAALNEINNLV Orange-legged leaf frog, Northern orange-legged leaf frog, South America Cell membrane permeabilization MTT cell proliferation assay H157 Glioma IC50 : 2.01 μM
dbacp02728 Dermaseptin-PS4 ALWKTLLKHVGKAAGKAALNAVTDMVNQ Waxy monkey tree frog Membrane disruption Lactate dehydrogenase (LDH) cytotoxicity assay, MTT assay H157 Glioma MIC : 10−9 to 10−4 M
dbacp04581 Mastoparan-Cimals. XXA; UCLL1c) LNLKALLAVAKKIL Venom, the European Hornet Inducing apoptosis MTT cell viability assay and Lactate dehydrogenase (LDH) leakage assay U251-MG Glioma MIC : 6.26 - 36.65 μM
dbacp04583 Mastoparan-Cimals. XXA; UCLL1c) LNLKALLAVAKKIL Venom, the European Hornet Inducing apoptosis MTT cell viability assay and Lactate dehydrogenase (LDH) leakage assay HMEC-1 Glioma MIC : 6.26 - 36.65 μM
dbacp04587 Mastoparan-Cimals. XXA; UCLL1c) LNLKALLAVAKKIL Venom, the European Hornet Inducing apoptosis MTT cell viability assay and Lactate dehydrogenase (LDH) leakage assay U251-MG Glioma IC50 : < 4 μM
dbacp04589 Mastoparan-Cimals. XXA; UCLL1c) LNLKALLAVAKKIL Venom, the European Hornet Inducing apoptosis MTT cell viability assay and Lactate dehydrogenase (LDH) leakage assay HMEC-1 Glioma IC50 : < 4 μM
dbacp04830 Neurotoxin BmK AGAP-SYPU2 VKDGYIVDDKNCAYFCGRNAYCDDECEKNGAESGYCQWAGVYGNACWCYKLPDKVPIRVPGRCNG Manchurian scorpion Blocker of chloride channels and can inhibit the migration of glioma cells Antitumor activity assays Ehrlich ascites cells Glioma ED50 : 1.42 mg/kg
dbacp05009 Okinawa Habu apoxin protein-1(OHAP-1) ADDRNPLEECFRETDYEEFLEIARNGLKKT Venom base Inducing apoptosis DNA gel electrophoresis assay,TUNEL assay, MTT assay RBR17T Glioma IC50 : 2.1 ± 0.58 µg/ml
dbacp05010 Okinawa Habu apoxin protein-1(OHAP-1) ADDRNPLEECFRETDYEEFLEIARNGLKKT Venom base Inducing apoptosis DNA gel electrophoresis assay,TUNEL assay, MTT assay OHAP-1 Glioma IC50 : 1.9 ± 0.31 µg/ml
dbacp05011 Okinawa Habu apoxin protein-1(OHAP-1) ADDRNPLEECFRETDYEEFLEIARNGLKKT Venom base Inducing apoptosis DNA gel electrophoresis assay,TUNEL assay, MTT assay C6 Glioma IC50 : 2.48 ± 0.26 µg/ml
dbacp05215 PcTx-1 EDCIPKWKGCVNRHGDCCEGLECWKRRRSFEVCVPKTPKTOHa Trinidad chevron tarantula Membrane permeabilization Transwell Migration assay, Scratch wound migration assay D54-MG Glioma Not found
dbacp05799 R2PLx-22 GIMDTVKNAAKNLAGQLLDKLK Not found Inducing apoptosis MTT and LDH assay H157 Glioma IC50 : 843.40 µM
dbacp05803 R2PLx-22 GIMDTVKNAAKNLAGQLLDKLK Not found Inducing apoptosis MTT and LDH assay MBD-MB-435s Glioma IC50 : 872.70 µM
dbacp05807 R2PLx-22 GIMDTVKNAAKNLAGQLLDKLK Not found Inducing apoptosis MTT and LDH assay PC-3 Glioma IC50 : 283.90 µM
dbacp05811 R2PLx-22 GIMDTVKNAAKNLAGQLLDKLK Not found Inducing apoptosis MTT and LDH assay U251-MG Glioma IC50 : 104.10 µM
dbacp05815 R2PLx-22 GIMDTVKNAAKNLAGQLLDKLK Not found Inducing apoptosis MTT and LDH assay MCF-7 Glioma IC50 : 109.30 µM
dbacp05819 R2PLx-22 GIMDTVKNAAKNLAGQLLDKLK Not found Inducing apoptosis MTT and LDH assay HMEC-1 Glioma IC50 : 588.20 µM
dbacp05880 Ranatuerin-2PLx GIMDTVKNAAKNLAGQLLDKLKCKITAC Not found Inducing apoptosis MTT and LDH assay H157 Glioma IC50 : 5.90 µM
dbacp05884 Ranatuerin-2PLx GIMDTVKNAAKNLAGQLLDKLKCKITAC Not found Inducing apoptosis MTT and LDH assay MBD-MB-435s Glioma IC50 : 15.44 µM
dbacp05888 Ranatuerin-2PLx GIMDTVKNAAKNLAGQLLDKLKCKITAC Not found Inducing apoptosis MTT and LDH assay PC-3 Glioma IC50 : 5.79 µM
dbacp05892 Ranatuerin-2PLx GIMDTVKNAAKNLAGQLLDKLKCKITAC Not found Inducing apoptosis MTT and LDH assay U251-MG Glioma IC50 : 16.14 µM
dbacp05896 Ranatuerin-2PLx GIMDTVKNAAKNLAGQLLDKLKCKITAC Not found Inducing apoptosis MTT and LDH assay MCF-7) Glioma IC50 : 20.19 µM
dbacp05900 Ranatuerin-2PLx GIMDTVKNAAKNLAGQLLDKLKCKITAC Not found Inducing apoptosis MTT and LDH assay HMEC-1 Glioma IC50 : 79.50 µM
dbacp05909 Ranatuerin-2PLx GIMDTVKNAAKNLAGQLLDKLKCSITAC Skin secretions, the pickerel frog, North America Inducing apoptosis MTT Cell viability assay and Lactate dehydrogenase (LDH) leakage assay U251-MG Glioma IC50 : 16.14 µM
dbacp05911 Ranatuerin-2PLx GIMDTVKNAAKNLAGQLLDKLKCSITAC Skin secretions, the pickerel frog, North America Inducing apoptosis MTT Cell viability assay and Lactate dehydrogenase (LDH) leakage assay HMEC-1 Glioma IC50 : 79.50 µM
dbacp05987 S−24-R2PLx GIMDTVKNAAKNLAGQLLDKLKCSITAC Not found Inducing apoptosis MTT and LDH assay H157 Glioma IC50 : 58.18 µM
dbacp05991 S−24-R2PLx GIMDTVKNAAKNLAGQLLDKLKCSITAC Not found Inducing apoptosis MTT and LDH assay MBD-MB-435s Glioma IC50 : 179.00 µM
dbacp05995 S−24-R2PLx GIMDTVKNAAKNLAGQLLDKLKCSITAC Not found Inducing apoptosis MTT and LDH assay PC-3 Glioma IC50 : 792.60 µM
dbacp05999 S−24-R2PLx GIMDTVKNAAKNLAGQLLDKLKCSITAC Not found Inducing apoptosis MTT and LDH assay U251-MG Glioma IC50 : 278.30 µM
dbacp06003 S−24-R2PLx GIMDTVKNAAKNLAGQLLDKLKCSITAC Not found Inducing apoptosis MTT and LDH assay MCF-7 Glioma IC50 : 316.90 µM
dbacp06007 S−24-R2PLx GIMDTVKNAAKNLAGQLLDKLKCSITAC Not found Inducing apoptosis MTT and LDH assay HMEC-1 Glioma IC50 : 1185.00 µM