dbACP: A Comprehensive Database of Anti-Cancer Peptides

91 result(s) have been found!

Accession Name Sequence Source/Organism Mechanism Assay Type Cell Line Cancer Type Activity
dbacp00301 (cpm)-1285 KNLWAAQRYGRELRRMSDEFEGSFKGL BH3-only, Sensizers (BAD, HRK, Noxa) Apoptosis inducing Not specified HL-60 Various cancers Not found
dbacp00352 [C/U, G1K, L5Y, K8R]cGm KURRYUYRQRUVTYURGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay HL-60 Epithelial cancer CC50 : 33.3 ±7.4 μM
dbacp00353 [C/U, G1K, L5Y, K8R]cGm KURRYUYRQRUVTYURGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay HL-60 Chronic myeloid Leukemia CC50 : 33.3 ±7.4 μM
dbacp00354 [C/U, G1K, L5Y, K8R]cGm KURRYUYRQRUVTYURGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay HL-60 Gastric cancer CC50 : 33.3 ±7.4 μM
dbacp00355 [C/U, G1K, L5Y, K8R]cGm KURRYUYRQRUVTYURGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay HL-60 Breast cancer CC50 : 33.3 ±7.4 μM
dbacp00356 [C/U, G1K, L5Y, K8R]cGm KURRYUYRQRUVTYURGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay HL-60 Cervical cancer CC50 : 33.3 ±7.4 μM
dbacp00392 [C/U]cGm GURRLUYKQRUVTYURGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay HL-60 Epithelial cancer CC50 : 38.5 ± 4.8 μM
dbacp00393 [C/U]cGm GURRLUYKQRUVTYURGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay HL-60 Chronic myeloid Leukemia CC50 : 38.5 ± 4.8 μM
dbacp00394 [C/U]cGm GURRLUYKQRUVTYURGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay HL-60 Gastric cancer CC50 : 38.5 ± 4.8 μM
dbacp00395 [C/U]cGm GURRLUYKQRUVTYURGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay HL-60 Breast cancer CC50 : 38.5 ± 4.8 μM
dbacp00396 [C/U]cGm GURRLUYKQRUVTYURGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay HL-60 Cervical cancer CC50 : 38.5 ± 4.8 μM
dbacp00470 [G1K, K8R]cGm KCRRLCYRQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay HL-60 Epithelial cancer CC50 : 9.0 ± 1.1μM
dbacp00471 [G1K, K8R]cGm KCRRLCYRQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay HL-60 Chronic myeloid Leukemia CC50 : 9.0 ± 1.1μM
dbacp00472 [G1K, K8R]cGm KCRRLCYRQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay HL-60 Gastric cancer CC50 : 9.0 ± 1.1μM
dbacp00473 [G1K, K8R]cGm KCRRLCYRQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay HL-60 Breast cancer CC50 : 9.0 ± 1.1μM
dbacp00474 [G1K, K8R]cGm KCRRLCYRQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay HL-60 Cervical cancer CC50 : 9.0 ± 1.1μM
dbacp00510 [G1K, L5Y, K8R]cGm KCRRYCYRQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay HL-60 Epithelial cancer CC50 : 15.7 ±1.1μM
dbacp00511 [G1K, L5Y, K8R]cGm KCRRYCYRQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay HL-60 Chronic myeloid Leukemia CC50 : 15.7 ±1.1μM
dbacp00512 [G1K, L5Y, K8R]cGm KCRRYCYRQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay HL-60 Gastric cancer CC50 : 15.7 ±1.1μM
dbacp00513 [G1K, L5Y, K8R]cGm KCRRYCYRQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay HL-60 Breast cancer CC50 : 15.7 ±1.1μM
dbacp00514 [G1K, L5Y, K8R]cGm KCRRYCYRQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay HL-60 Cervical cancer CC50 : 15.7 ±1.1μM
dbacp00603 [R4A, R18A]cGm GCRALCYKQRCVTYCRGA Synthetic construct Target and destroy tumor cell membranes Cell viability assay HL-60 Epithelial cancer CC50 : 34.1 ± 3.9 μM
dbacp00604 [R4A, R18A]cGm GCRALCYKQRCVTYCRGA Synthetic construct Target and destroy tumor cell membranes Cell viability assay HL-60 Chronic myeloid Leukemia CC50 : 34.1 ± 3.9 μM
dbacp00605 [R4A, R18A]cGm GCRALCYKQRCVTYCRGA Synthetic construct Target and destroy tumor cell membranes Cell viability assay HL-60 Gastric cancer CC50 : 34.1 ± 3.9 μM
dbacp00606 [R4A, R18A]cGm GCRALCYKQRCVTYCRGA Synthetic construct Target and destroy tumor cell membranes Cell viability assay HL-60 Breast cancer CC50 : 34.1 ± 3.9 μM
dbacp00607 [R4A, R18A]cGm GCRALCYKQRCVTYCRGA Synthetic construct Target and destroy tumor cell membranes Cell viability assay HL-60 Cervical cancer CC50 : 34.1 ± 3.9 μM
dbacp00962 ACL LAO L-amino acid oxidase(LAO) ADSRNPLEEEFRETNYEEF Venom base Apoptosis inducing HL-60 cell culture assay HL-60 Not specified Not found
dbacp01371 Aurein-3.2 GLFDIVKKIAGHIASSI Southern bell frog Cell membrane disintegration One-dose and five-dose assay HL-60(TB) Leukemia IC50 : 4-5 μM
dbacp01458 Bax 1 STKKLSECLKRIGDELDSnM Effectors (BAK, BAX) Inducing apoptosis Not specified HL-60 Not specified IC50 : 2.0 μmol/L
dbacp01462 Bax 10 KLSECLKRIGDELDS Effectors (BAK, BAX) Inducing apoptosis Not specified HL-60 Not specified IC50 : > 500 μmol/L
dbacp01466 Bax 11 LSECLKRIGDELDSN Effectors (BAK, BAX) Inducing apoptosis Not specified HL-60 Not specified IC50 : > 500 μmol/L
dbacp01470 Bax 12 STKKLECLKRIGDELDSnM Effectors (BAK, BAX) Inducing apoptosis Not specified HL-60 Not specified IC50 : > 500 μmol/L
dbacp01474 Bax 13 STKKLCLKRIGDELDSnM Effectors (BAK, BAX) Inducing apoptosis Not specified HL-60 Not specified IC50 : > 500 μmol/L
dbacp01478 Bax 14 STKKLLKRIGDELDSnM Effectors (BAK, BAX) Inducing apoptosis Not specified HL-60 Not specified IC50 : > 500 μmol/L
dbacp01482 Bax 15 STKKLSECLGDELDSnM Effectors (BAK, BAX) Inducing apoptosis Not specified HL-60 Not specified IC50 : > 500 μmol/L
dbacp01486 Bax 16 STKKLSECLKRIGDEL Effectors (BAK, BAX) Inducing apoptosis Not specified HL-60 Not specified IC50 : 20 μmol/L
dbacp01490 Bax 17 TKKLSECLKRIGDEL Effectors (BAK, BAX) Inducing apoptosis Not specified HL-60 Not specified IC50 : 79 μmol/L
dbacp01494 Bax 18 TKKLSECLKRIGDE Effectors (BAK, BAX) Inducing apoptosis Not specified HL-60 Not specified IC50 : > 500 μmol/L
dbacp01498 Bax 2 AAKKLSECLKRIGDELDSnM Effectors (BAK, BAX) Inducing apoptosis Not specified HL-60 Not specified IC50 : 2.3 μmol/L
dbacp01502 Bax 3 STKKLSECLKRIGDELDS Effectors (BAK, BAX) Inducing apoptosis Not specified HL-60 Not specified IC50 : 18.3 μmol/L
dbacp01506 Bax 4 STKKLSECLKRIGDELDSM Effectors (BAK, BAX) Inducing apoptosis Not specified HL-60 Not specified IC50 : 7.6 μmol/L
dbacp01510 Bax 5 STKKLSECLKRIGDELDM Effectors (BAK, BAX) Inducing apoptosis Not specified HL-60 Not specified IC50 : 2.1 μmol/L
dbacp01514 Bax 6 STKKLSECLKRIGDELM Effectors (BAK, BAX) Inducing apoptosis Not specified HL-60 Not specified IC50 : 8.0 μmol/L
dbacp01518 Bax 7 STKKLSECLKRIGDEM Effectors (BAK, BAX) Inducing apoptosis Not specified HL-60 Not specified IC50 : 7.4 μmol/L
dbacp01522 Bax 8 STKKLSECLKRIGDM Effectors (BAK, BAX) Inducing apoptosis Not specified HL-60 Not specified IC50 : > 500 μmol/L
dbacp01526 Bax 9 KKLSECLKRIGDELDSnM Effectors (BAK, BAX) Inducing apoptosis Not specified HL-60 Not specified IC50 : 148.0 μmol/L
dbacp01990 Buforin IIb RAGLQFPVGRLLRRLLRRLLR Histone H2A Inducing mitochondria-dependent apoptosis MTT/MTS assay HL-60 Leukemia cancer IC50 : 11.3 µg/ml
dbacp02048 Buforin Iib RAGLQFPVGRLLRRLLRRLLR Not found Inducing apoptosis MTT/MTS assay HL-60 Not specified IC50 : 11.3 µg/ml
dbacp02318 Cationic Amphiphilic GIIKKIIIKKI AMP Membrane disruption WST-1 assay HL-60 Pancreatic cancer IC50 : >500 µM
dbacp02319 Cationic Amphiphilic GIIKKIIIKKIIIKKI AMP Membrane disruption WST-1 assay HL-60 Pancreatic cancer IC50 : 25 µM
dbacp02320 Cationic Amphiphilic GIIKKIIIKKIIIKKIIIKKI AMP Membrane disruption WST-1 assay HL-60 Pancreatic cancer IC50 : 10 µM
dbacp02478 ChMAP-28 GRFKRFRKKLKRLWHKVGPFVGPILHY Domestic goat Cause cell membrane permeability; Induce necrotic death Cytotoxic Activity assay, Lactate dehydrogenase (LDH)-Releaseassay, MTT assay HL-60 Acute promyelocytic leukemia IC50 : 3.39 ± 0.15 μM
dbacp02552 Cpm-1285 KNLWAAQRYGRELRRMSDEFEGSFKGL BH3-only, Sensizers (BAD, HRK, Noxa) Inducing apoptosis Not specified HL-60 Not specified IC50 : 130 nM
dbacp02554 Cpm-1285m KNLWAAQRYGREARRMSDEFEGSFKGL BH3-only, Sensizers (BAD, HRK, Noxa) Inducing apoptosis Not specified HL-60 Not specified Not found
dbacp03540 L-amino-acid oxidase (BatroxLAAO) (LAO) (EC 1.4.3.2) MNVFFTFSLLFLAALGSCADDRNPLEECFRETDYEEFLEIAKNGLSTTSNPKRVVIVGAGMSGLSAAYVLANAGHQVTVLEASERAGGRVKTYRNEKEGWYANLGPMRLPEKHRIVREYIRKFDLQLNEFSQENENAWYFIKNIRKRVGEVNKDPGVLEYPVKPSEVGKSAGQLYEESLQKAVEELRRTNCSYMLNKYDTYSTKEYLLKEGNLSPGAVDMIGDLLNEDSGYYVSFIESLKHDDIFAYEKRFDEIVGGMDKLPTSMYQAIQEKVHLNARVIKIQQDVKEVTVTYQTSEKETLSVTADYVIVCTTSRAARRIKFEPPLPPKKAHALRSVHYRSGTKIFLTCTKKFWEDDGIHGGKSTTDLPSRFIYYPNHNFPNGVGVIIAYGIGDDANYFQALDFEDCGDIVINDLSLIHQLPKEEIQAICRPSMIQRWSLDKYAMGGITTFTPYQFQHFSEALTAPVDRIYFAGEYTAQAHGWIDSTIKSGLRAARDVNRASEIKK Common lancehead Inducing apoptosis MTT assay HL-60 Not found Not found
dbacp03683 Lasioglossin LL-III VNWKKILGKIIKVVK Broad-faced Furrow Bee Cell membrane disintegration XTT test HL-60 Not found IC50 : 4.5 μM
dbacp04701 mPep1 RKAFRWAWRMLKKAAPSITCVR Bovine lactoferrin (Lf-B) Necrotic cell death by destroying cellular membrane structure; Apoptotic cell death MTT/MTS assay HL-60 Skin cancer IC50 :8 µM
dbacp04871 NK-2 (Mammals, Animals) KILRGVCKKIMRTFLRRISKDILTGKK Mammal Not specified MTT assay HL-60 Not found IC50 : 13.7 μM
dbacp04875 NK-dpro (Derived from NK-2) KILPGVCKKIMRPFLRRISKDILTGKK Synthetic construct Not specified MTT assay HL-60 Not found IC50 : 48.4 μM
dbacp04879 NK-pro (Derived from NK-2) KILRGVCKKIMRPFLRRISKDILTGKK Synthetic construct Not specified MTT assay HL-60 Not found IC50 : 26.1 μM
dbacp05245 pep1 FKCRRWQWRMKKLGAPSITCVR Bovine lactoferrin (Lf-B) Activating an apoptosis-inducing pathway MTT/MTS assay HL-60 Prostate cancer IC50 :77 µM
dbacp05247 Pep27 MRKEFHNVLSSGQLLADKRPARDYNRK Pneumococcus Apoptosis inducing MTT/MTS assay HL-60 Leukemia cancer IC50 : > 70 µM
dbacp05252 Pep27 MRKEFHNVLSSGQLLADKRPARDYNRK Not found Inducing apoptosis MTT assay HL-60 Acute promyelocytic leukemia IC50 : > 70 µM
dbacp05258 Pep27 anal1 MWKWFHNVLSSWQLLADKRPARDYNRK Not found Inducing apoptosis MTT assay HL-60 Acute promyelocytic leukemia IC50 : 53 µM
dbacp05263 Pep27 anal2 MWKWFHNVLSWWWLLADKRPARDYNRK Not found Inducing apoptosis MTT assay HL-60 Acute promyelocytic leukemia IC50 : 20 µM
dbacp05268 Pep27 anal3 MRKWFHNVLSSGQLLADKWPAWDYNRK Not found Inducing apoptosis MTT assay HL-60 Acute promyelocytic leukemia IC50 : 52 µM
dbacp05273 Pep27 anal4 MWKEFHNVLSSGQLLADKRWARWYNRW Not found Inducing apoptosis MTT assay HL-60 Acute promyelocytic leukemia IC50 : 51 µM
dbacp05278 Pep27 anal5 MWKWFHNVLSSGQLLADKWWAWWYNWW Not found Inducing apoptosis MTT assay HL-60 Acute promyelocytic leukemia IC50 : > 70 µM
dbacp05283 Pep27anal1 MWKWFHNVLSSWQLLADKRPARDYNRK Pneumococcus Apoptosis inducing MTT/MTS assay HL-60 Leukemia cancer IC50 : 53 µM
dbacp05288 Pep27anal2 MWKWFHNVLSWWWLLADKRPARDYNRK Pneumococcus Apoptosis inducing MTT/MTS assay HL-60 Leukemia cancer IC50 : 20 µM
dbacp05293 Pep27anal3 MRKWFHNVLSSGQLLADKWPAWDYNRK Pneumococcus Apoptosis inducing MTT/MTS assay HL-60 Leukemia cancer IC50 : 52 µM
dbacp05298 Pep27anal4 MWKEFHNVLSSGQLLADKRWARWYNRW Pneumococcus Apoptosis inducing MTT/MTS assay HL-60 Leukemia cancer IC50 : 51 µM
dbacp05303 Pep27anal5 MWKWFHNVLSSGQLLADKWWAWWYNWW Pneumococcus Apoptosis inducing MTT/MTS assay HL-60 Leukemia cancer IC50 : >70 µM
dbacp05434 Peptide-1 IELLQARGGC-Pem Synthetic construct Cell membrane disintegration MTT/MTS assay HL-60 Leukemia cancer IC50 : 2.17 µM
dbacp05436 Peptide-2 IELLQARGGC-Pem-GGRRRRRRRR Synthetic construct Cell membrane disintegration MTT/MTS assay HL-60 Leukemia cancer IC50 : 2.64 µM
dbacp05438 Peptide-20 CSSRTMHHC Synthetic Peptide Inducing apoptosis MTT/MTS assay HL-60 Leukemia cancer At 100 µM 90% viablity
dbacp05445 Peptide-3 RRRRRRRRGGC-Pem Synthetic construct Cell membrane disintegration MTT/MTS assay HL-60 Leukemia cancer IC50 : 6.24 µM
dbacp05597 Polyphemusin III RRGCFRVCYRGFCFQRCR Atlantic horseshoe crab Induce permeabilization of the cytoplasmic membrane Trypan blue exclusion assay and Lactate dehydrogenase(LDH)-release assay HL-60 Human cervical cancer IC50 : < 10 μM
dbacp06082 Short α-helical peptide GIIKKIIKKI Alpha-helical proteins Cell membrane disruption; Cell apoptosis MTT/MTS assay HL-60 Leukemia cancer 100% Cytotoxicity at 4µM approx.
dbacp06083 Short α-helical peptide GIIKKIIKKIIKKI Alpha-helical proteins Cell membrane disruption; Cell apoptosis MTT/MTS assay HL-60 Leukemia cancer 90% Cytotoxicity at 4µM approx.
dbacp06084 Short α-helical peptide GIIKKIIKKIIKKIIKKI Alpha-helical proteins Cell membrane disruption; Cell apoptosis MTT/MTS assay HL-60 Leukemia cancer 70% Cytotoxicity at 5µM approx.
dbacp06752 Salamandrin - I FAVWGCADYRGY Salamandra salamandra Pyroptosis mediated MTT assay HL-60 Leukemia Cancer IC50 = 27 µM
dbacp06753 Salamandrin - I FAVWGCADYRGY Salamandra salamandra Pyroptosis mediated LDH leakage assay HL-60 Leukemia Cancer Absorbance ~ 2 at 490 nm at 27 27 µM
dbacp06808 [C/U, G1K, L5Y, K8R]cGm KURRYUYRQRUVTYURGR Synthetic Analogue of Gomesin Cell membrane penetration Resazurin dye assay HL-60 Leukemia Cancer CC50 = 33.3 ±7.4μM
dbacp06814 [G1K, L5Y, K8R]cGm KCRRYCYRQRCVTYCRGR Synthetic Analogue of Gomesin Cell membrane penetration Resazurin dye assay HL-60 Leukemia Cancer CC50 = 15.7 ±1.1μM
dbacp06824 [C/U]cGm GURRLUYKQRUVTYURGR Synthetic Analogue of Gomesin Cell membrane penetration Resazurin dye assay HL-60 Leukemia Cancer CC50 = 38.5 ± 4.8 μM
dbacp06830 [G1K, K8R]cGm KCRRLCYRQRCVTYCRGR Synthetic Analogue of Gomesin Cell membrane penetration Resazurin dye assay HL-60 Leukemia Cancer CC50 = 9.0 ± 1.1μM
dbacp06836 [R4A, R18A]cGm GCRALCYKQRCVTYCRGA Synthetic Analogue of Gomesin Cell membrane penetration Resazurin dye assay HL-60 Leukemia Cancer CC50 = 34.1 ± 3.9 μM
dbacp08378 IDP-LS05 RKRRNDLRSRFLALRDQ Synthetic Not Available MTT/Alamamar-Blue/Hexosaminidase activity test HL-60 Leukemia Cancer EC50 ~ 5 μM
dbacp08381 IDP-LS13 RKRRNDLRSRFLALRDQ Synthetic Not Available MTT/Alamamar-Blue/Hexosaminidase activity test HL-60 Leukemia Cancer EC50 ~ 7 μM
dbacp08426 5-2C NYPQRPCRGDKGPDC Synthetic Not Available MTT assay HL-60 Blood Cancer IC50 = 1.111 μM