dbACP: A Comprehensive Database of Anti-Cancer Peptides

8 result(s) have been found!

Accession Name Sequence Source/Organism Mechanism Assay Type Cell Line Cancer Type Activity
dbacp01597 BF-30 KFFRKLKKSVKKRAKEFFKKPRVIGVSIPF Banded krait Cytoplasmic membrane permeabilization and DNAspecified-binding Lactate dehydrogenase release assay, DNA retardation assay, Real-time PCR, Western blot, wound healing assay, and chick embryo chorioallantoic membrane assay B16 Human Cervical cancer IC50 : 13.9 μM
dbacp02581 CSP-FT FTPGGNTYAGQP Not found Cell membrane disintegration Not specified C-33A Human Cervical cancer Not found
dbacp02582 CSP-GD GDALFSVPLEVY Not found Cell membrane disintegration Not specified SiH Human Cervical cancer Not found
dbacp02583 CSP-KQ KQNLAEG Not found Cell membrane disintegration Not specified C-33A Human Cervical cancer Not found
dbacp02584 CSP-SI SIDDQRDVAEFA Not found Cell membrane disintegration Not specified C-33A Human Cervical cancer Not found
dbacp02585 CSP-TL TLHQPPSSANWI Not found Cell membrane disintegration Not specified SiH Human Cervical cancer Not found
dbacp04592 Mauriporin MNKKTLLVIFFITMLIVDEVNSFKIGGFIKKLWRSKLAKKLRAKGRELLKDYANRVINGGPEEEAAVPAERRR Fat-tailed scorpion Induce cell apoptosis; Targets on the cell membranes and caused membrane lysis MTT assay, Lactate dehydrogenase (LDH) Release assay Hela Human cervical cancer IC50 : 27.9 μM - 283.3 μM
dbacp05597 Polyphemusin III RRGCFRVCYRGFCFQRCR Atlantic horseshoe crab Induce permeabilization of the cytoplasmic membrane Trypan blue exclusion assay and Lactate dehydrogenase(LDH)-release assay HL-60 Human cervical cancer IC50 : < 10 μM