8 result(s) have been found!
| Accession | Name | Sequence | Source/Organism | Mechanism | Assay Type | Cell Line | Cancer Type | Activity |
|---|---|---|---|---|---|---|---|---|
| dbacp01597 | BF-30 | KFFRKLKKSVKKRAKEFFKKPRVIGVSIPF | Banded krait | Cytoplasmic membrane permeabilization and DNAspecified-binding | Lactate dehydrogenase release assay, DNA retardation assay, Real-time PCR, Western blot, wound healing assay, and chick embryo chorioallantoic membrane assay | B16 | Human Cervical cancer | IC50 : 13.9 μM |
| dbacp02581 | CSP-FT | FTPGGNTYAGQP | Not found | Cell membrane disintegration | Not specified | C-33A | Human Cervical cancer | Not found |
| dbacp02582 | CSP-GD | GDALFSVPLEVY | Not found | Cell membrane disintegration | Not specified | SiH | Human Cervical cancer | Not found |
| dbacp02583 | CSP-KQ | KQNLAEG | Not found | Cell membrane disintegration | Not specified | C-33A | Human Cervical cancer | Not found |
| dbacp02584 | CSP-SI | SIDDQRDVAEFA | Not found | Cell membrane disintegration | Not specified | C-33A | Human Cervical cancer | Not found |
| dbacp02585 | CSP-TL | TLHQPPSSANWI | Not found | Cell membrane disintegration | Not specified | SiH | Human Cervical cancer | Not found |
| dbacp04592 | Mauriporin | MNKKTLLVIFFITMLIVDEVNSFKIGGFIKKLWRSKLAKKLRAKGRELLKDYANRVINGGPEEEAAVPAERRR | Fat-tailed scorpion | Induce cell apoptosis; Targets on the cell membranes and caused membrane lysis | MTT assay, Lactate dehydrogenase (LDH) Release assay | Hela | Human cervical cancer | IC50 : 27.9 μM - 283.3 μM |
| dbacp05597 | Polyphemusin III | RRGCFRVCYRGFCFQRCR | Atlantic horseshoe crab | Induce permeabilization of the cytoplasmic membrane | Trypan blue exclusion assay and Lactate dehydrogenase(LDH)-release assay | HL-60 | Human cervical cancer | IC50 : < 10 μM |