dbACP: A Comprehensive Database of Anti-Cancer Peptides

123 result(s) have been found!

Accession Name Sequence Source/Organism Mechanism Assay Type Cell Line Cancer Type Activity
dbacp00571 [L9]-P18 KWKLFKKILKFLHLAKKF Ceropin A Cell membrane disintegration MTT/MTS assay Jurkat Blood cancer IC50 : 9 µM
dbacp00619 [S9]-P18 KWKLFKKISKFLHLAKKF Ceropin A Cell membrane disintegration MTT/MTS assay Jurkat Blood cancer IC50 : 7 µM
dbacp00701 072RB DMRPEIYI(Aib)QELRRIGDAFN(Aib)YRQIKIWFQNRRMKWKK BH3-only, Direct activators, BIM analogues Inducing apoptosis Not specified Jurkat Leukemia Not found
dbacp01457 Bax 1 STKKLSECLKRIGDELDSnM Effectors (BAK, BAX) Inducing apoptosis Not specified Jurkat Not specified IC50 : 2.0 μmol/L
dbacp01461 Bax 10 KLSECLKRIGDELDS Effectors (BAK, BAX) Inducing apoptosis Not specified Jurkat Not specified IC50 : > 500 μmol/L
dbacp01465 Bax 11 LSECLKRIGDELDSN Effectors (BAK, BAX) Inducing apoptosis Not specified Jurkat Not specified IC50 : > 500 μmol/L
dbacp01469 Bax 12 STKKLECLKRIGDELDSnM Effectors (BAK, BAX) Inducing apoptosis Not specified Jurkat Not specified IC50 : > 500 μmol/L
dbacp01473 Bax 13 STKKLCLKRIGDELDSnM Effectors (BAK, BAX) Inducing apoptosis Not specified Jurkat Not specified IC50 : > 500 μmol/L
dbacp01477 Bax 14 STKKLLKRIGDELDSnM Effectors (BAK, BAX) Inducing apoptosis Not specified Jurkat Not specified IC50 : > 500 μmol/L
dbacp01481 Bax 15 STKKLSECLGDELDSnM Effectors (BAK, BAX) Inducing apoptosis Not specified Jurkat Not specified IC50 : > 500 μmol/L
dbacp01485 Bax 16 STKKLSECLKRIGDEL Effectors (BAK, BAX) Inducing apoptosis Not specified Jurkat Not specified IC50 : 20 μmol/L
dbacp01489 Bax 17 TKKLSECLKRIGDEL Effectors (BAK, BAX) Inducing apoptosis Not specified Jurkat Not specified IC50 : 79 μmol/L
dbacp01493 Bax 18 TKKLSECLKRIGDE Effectors (BAK, BAX) Inducing apoptosis Not specified Jurkat Not specified IC50 : > 500 μmol/L
dbacp01497 Bax 2 AAKKLSECLKRIGDELDSnM Effectors (BAK, BAX) Inducing apoptosis Not specified Jurkat Not specified IC50 : 2.3 μmol/L
dbacp01501 Bax 3 STKKLSECLKRIGDELDS Effectors (BAK, BAX) Inducing apoptosis Not specified Jurkat Not specified IC50 : 18.3 μmol/L
dbacp01505 Bax 4 STKKLSECLKRIGDELDSM Effectors (BAK, BAX) Inducing apoptosis Not specified Jurkat Not specified IC50 : 7.6 μmol/L
dbacp01509 Bax 5 STKKLSECLKRIGDELDM Effectors (BAK, BAX) Inducing apoptosis Not specified Jurkat Not specified IC50 : 2.1 μmol/L
dbacp01513 Bax 6 STKKLSECLKRIGDELM Effectors (BAK, BAX) Inducing apoptosis Not specified Jurkat Not specified IC50 : 8.0 μmol/L
dbacp01517 Bax 7 STKKLSECLKRIGDEM Effectors (BAK, BAX) Inducing apoptosis Not specified Jurkat Not specified IC50 : 7.4 μmol/L
dbacp01521 Bax 8 STKKLSECLKRIGDM Effectors (BAK, BAX) Inducing apoptosis Not specified Jurkat Not specified IC50 : > 500 μmol/L
dbacp01525 Bax 9 KKLSECLKRIGDELDSnM Effectors (BAK, BAX) Inducing apoptosis Not specified Jurkat Not specified IC50 : 148.0 μmol/L
dbacp01834 Bim-BH3W89Y DMRPEIYIAQELRRIGDEFNAY BH3-only, Direct activators, BIM analogues Inducing apoptosis Not specified Jurkat Leukemia Not found
dbacp01837 Bim-BH3YA2Aib DMRPEIYI(Aib)QELRRIGDAFN(Aib)Y BH3-only, Direct activators, BIM analogues Inducing apoptosis Not specified Jurkat Leukemia Not found
dbacp01913 BpirLAAO-I ADDKNPLEEFRETNYEVFLEIAKNGLKATSNPKRVVIVGAGMAGLSAAY Venom base Inducing apoptosis MTT assay Jurkat Acute T cell Leukemia Not found
dbacp01959 Brevinin-2R KLKNFAKGVAQSLLNKASCKLSGQC Skin, Marsh frog, Europe Activates the lysosomal-mitochondrial death pathway; Involves autophagy-like cell death MTT-assay Jurkat T-cell Leukemia LD50 : 10 – 15 μg/ml
dbacp01960 Brevinin-2R KLKNFAKGVAQSLLNKASCKLSGQC Skin, Marsh frog, Europe Activates the lysosomal-mitochondrial death pathway; Involves autophagy-like cell death MTT-assay Jurkat T-cell Leukemia LD50 : 20 – 25 μg/ml
dbacp01961 Brevinin-2R KLKNFAKGVAQSLLNKASCKLSGQC Skin, Marsh frog, Europe Activates the lysosomal-mitochondrial death pathway; Involves autophagy-like cell death MTT-assay Jurkat T-cell Leukemia LD50 : 30 – 40 μg/ml
dbacp01980 Brevinin-2R KLKNFAKGVAQSLLNKASCKLSGQC Skin, Marsh frog, Europe Activates the lysosomal-mitochondrial death pathway; Involves autophagy-like cell death MTT-assay Jurkat T-cell Leukemia LD50 : 20 – 25 µg/mll
dbacp02114 C-1 KWKLFKKIPFLHLAKKF Ceropin A Cell membrane disintegration MTT/MTS assay Jurkat Blood cancer IC50 : 32 µM
dbacp02117 C-10 KWKLFKKIPKFLH Ceropin A Cell membrane disintegration MTT/MTS assay Jurkat Blood cancer IC50 : <100 µM
dbacp02120 C-2 KWKLFKKIPKFLHLAKK Ceropin A Cell membrane disintegration MTT/MTS assay Jurkat Blood cancer IC50 : 26 µM
dbacp02123 C-3 KWKLFKKIPLHLAKKF Ceropin A Cell membrane disintegration MTT/MTS assay Jurkat Blood cancer IC50 : 74 µM
dbacp02126 C-4 KWKLFKKIPKFLHLAK Ceropin A Cell membrane disintegration MTT/MTS assay Jurkat Blood cancer IC50 : 31 µM
dbacp02129 C-5 KWKLFKKIPHLAKKF Ceropin A Cell membrane disintegration MTT/MTS assay Jurkat Blood cancer IC50 : 81 µM
dbacp02132 C-6 KWKLFKKIPKFLHLA Ceropin A Cell membrane disintegration MTT/MTS assay Jurkat Blood cancer IC50 : 21 µM
dbacp02135 C-7 KWKLFKKIPLAKKF Ceropin A Cell membrane disintegration MTT/MTS assay Jurkat Blood cancer IC50 : <100 µM
dbacp02138 C-8 KWKLFKKIPKFLHL Ceropin A Cell membrane disintegration MTT/MTS assay Jurkat Blood cancer IC50 : 54 µM
dbacp02141 C-9 KWKLFKKIPLKKF Ceropin A Cell membrane disintegration MTT/MTS assay Jurkat Blood cancer IC50 : <100 µM
dbacp02227 CA-MA KWKLFKKIGIGKFLHSAKKF Ceropin-Melittin hybrid Membrane disruptive mode of action MTT/MTS assay Jurkat Blood cancer Activity : 100% survival rate at 10 µM
dbacp02228 CA-MA KWKLFKKIGIGKFLHSAKKF Ceropin-Melittin hybrid Membrane disruptive mode of action MTT/MTS assay Jurkat Blood cancer Activity : 0% survival rate at 100 µM
dbacp02233 CA-MA KWKLFKKIGIGKFLHSAKKF Ceropin-African clawed frog hybrid peptides Cell membrane disintegration MTT/MTS assay Jurkat Blood cancer IC50 : 30 µM
dbacp02239 CA-MA-P KWKLFKKIPKFLHSAKKF Ceropin A Cell membrane disintegration MTT/MTS assay Jurkat Blood cancer IC50 : 20 µM
dbacp02243 CA-MA1 KWKLFKKIKFLHSAKKF Ceropin-African clawed frog hybrid peptides Cell membrane disintegration MTT/MTS assay Jurkat Blood cancer IC50 : 65 µM
dbacp02247 CA-MA2 KWKLFKKIPKFLHSAKKF Ceropin-African clawed frog hybrid peptides Cell membrane disintegration MTT/MTS assay Jurkat Blood cancer IC50 : 20 µM
dbacp02251 CA-MA3 KWKLFKKIGPGKFLHSAKKF Ceropin-African clawed frog hybrid peptides Cell membrane disintegration MTT/MTS assay Jurkat Blood cancer IC50 : 75 µM
dbacp02565 CRAMP-18 E2K GKKLKKIGQKIKNFFQKL Synthetic Disrupt cell membrane structure MTT assay Jurkat Acute T cell Leukemia IC50 : 20–34 uM
dbacp03280 Harmoniasin IGGYCSELDL-NH Harlequin lady beetle Induce apoptotic and necrotic cell deaths MTS assay and LDH release assay Jurkat Human leukemia MIC : approx. 200 µg/ml
dbacp03522 KillerFLIP YGRKKRRQRRRREADFFWSLCTADMS Not found Apoptotic activity and necroptosis; Plasma membrane permeabilization Not specified Jurkat Blood cancer Not found
dbacp03541 L-amino-acid oxidase (BatroxLAAO) (LAO) (EC 1.4.3.2) MNVFFTFSLLFLAALGSCADDRNPLEECFRETDYEEFLEIAKNGLSTTSNPKRVVIVGAGMSGLSAAYVLANAGHQVTVLEASERAGGRVKTYRNEKEGWYANLGPMRLPEKHRIVREYIRKFDLQLNEFSQENENAWYFIKNIRKRVGEVNKDPGVLEYPVKPSEVGKSAGQLYEESLQKAVEELRRTNCSYMLNKYDTYSTKEYLLKEGNLSPGAVDMIGDLLNEDSGYYVSFIESLKHDDIFAYEKRFDEIVGGMDKLPTSMYQAIQEKVHLNARVIKIQQDVKEVTVTYQTSEKETLSVTADYVIVCTTSRAARRIKFEPPLPPKKAHALRSVHYRSGTKIFLTCTKKFWEDDGIHGGKSTTDLPSRFIYYPNHNFPNGVGVIIAYGIGDDANYFQALDFEDCGDIVINDLSLIHQLPKEEIQAICRPSMIQRWSLDKYAMGGITTFTPYQFQHFSEALTAPVDRIYFAGEYTAQAHGWIDSTIKSGLRAARDVNRASEIKK Common lancehead Inducing apoptosis MTT assay Jurkat Acute T-cell Leukemia Not found
dbacp03741 LfcinB (Bovine lactoferricin) FKCRRWQWRM Not found Inducing apoptosis MTT assay Jurkat Leukemia Not found
dbacp04292 Lt-MAP2 LIKKLKEYLKKLI Derivatives of Latarcin-3a Not specified Not specified Jurkat Not found Not found
dbacp04568 Mastoparan INLKALAALAKKIL Venom base Inducing apoptosis Not specified Jurkat Not specified IC50 : 77.9 ± 6.7 µM
dbacp04731 N-1 WKLFKKIPKFLHLAKKF Ceropin A Cell membrane disintegration MTT/MTS assay Jurkat Blood cancer IC50 : 12 µM
dbacp04734 N-2 FKLFKKIPKFLHLAKKF Ceropin A Cell membrane disintegration MTT/MTS assay Jurkat Blood cancer IC50 : 11 µM
dbacp04737 N-3 KWFKKIPKFLHLAKKF Ceropin A Cell membrane disintegration MTT/MTS assay Jurkat Blood cancer IC50 : 17 µM
dbacp04740 N-3L KWFKKIPKFLHLLKKF Ceropin A Cell membrane disintegration MTT/MTS assay Jurkat Blood cancer IC50 : 4 µM
dbacp04743 N-4 WFKKIPKFLHLAKKF Ceropin A Cell membrane disintegration MTT/MTS assay Jurkat Blood cancer IC50 : 23 µM
dbacp04746 N-4L WFKKIPKFLHLLKKF Ceropin A Cell membrane disintegration MTT/MTS assay Jurkat Blood cancer IC50 : 6 µM
dbacp04749 N-5 WKKIPKFLHLAKKF Ceropin A Cell membrane disintegration MTT/MTS assay Jurkat Blood cancer IC50 : < 100 µM
dbacp04752 N-5L WKKIPKFLHLLKKF Ceropin A Cell membrane disintegration MTT/MTS assay Jurkat Blood cancer IC50 :14 µM
dbacp05049 P18 KWKFKKIPKFLHLAKKF Ceropin A Cell membrane disintegration MTT/MTS assay Jurkat Blood cancer IC50 : 4 µM
dbacp05127 PaDef ATCETPSKHFNGLCIRSSNCASVCHGEHFTDGRCQGVRRRCMCLKPC Plant sources Inducing apoptosis MTT assay Jurkat Leukemia Not found
dbacp05248 Pep27 MRKEFHNVLSSGQLLADKRPARDYNRK Pneumococcus Apoptosis inducing MTT/MTS assay Jurkat Blood cancer IC50 : > 70 µM
dbacp05253 Pep27 MRKEFHNVLSSGQLLADKRPARDYNRK Not found Inducing apoptosis MTT assay Jurkat T-cell leukemia IC50 : > 70 µM
dbacp05259 Pep27 anal1 MWKWFHNVLSSWQLLADKRPARDYNRK Not found Inducing apoptosis MTT assay Jurkat T-cell leukemia IC50 : 47 µM
dbacp05264 Pep27 anal2 MWKWFHNVLSWWWLLADKRPARDYNRK Not found Inducing apoptosis MTT assay Jurkat T cell leukemia IC50 : 23 µM
dbacp05269 Pep27 anal3 MRKWFHNVLSSGQLLADKWPAWDYNRK Not found Inducing apoptosis MTT assay Jurkat T cell leukemia IC50 : 50 µM
dbacp05274 Pep27 anal4 MWKEFHNVLSSGQLLADKRWARWYNRW Not found Inducing apoptosis MTT assay Jurkat T-cell Leukemia IC50 : 46 µM
dbacp05279 Pep27 anal5 MWKWFHNVLSSGQLLADKWWAWWYNWW Not found Inducing apoptosis MTT assay Jurkat T cell leukemia IC50 : > 70 µM
dbacp05284 Pep27anal1 MWKWFHNVLSSWQLLADKRPARDYNRK Pneumococcus Apoptosis inducing MTT/MTS assay Jurkat Blood cancer IC50 : 47 µM
dbacp05289 Pep27anal2 MWKWFHNVLSWWWLLADKRPARDYNRK Pneumococcus Apoptosis inducing MTT/MTS assay Jurkat Blood cancer IC50 : 23 µM
dbacp05294 Pep27anal3 MRKWFHNVLSSGQLLADKWPAWDYNRK Pneumococcus Apoptosis inducing MTT/MTS assay Jurkat Blood cancer IC50 : 50 µM
dbacp05299 Pep27anal4 MWKEFHNVLSSGQLLADKRWARWYNRW Pneumococcus Apoptosis inducing MTT/MTS assay Jurkat Blood cancer IC50 : 46 µM
dbacp05304 Pep27anal5 MWKWFHNVLSSGQLLADKWWAWWYNWW Pneumococcus Apoptosis inducing MTT/MTS assay Jurkat Blood cancer IC50 : >70 µM
dbacp06034 Scolopendrasin VII FCTCNVKGFNAKNKRGIIYP Chinese red-headed centipede, Asia Necrotic cell death MTS assay Jurkat Leukemia Not found
dbacp06179 Synthetic peptide KWKKLLKKPPPLLKKLLKKL Synthetic peptide Not specified MTT/MTS assay Jurkat Blood cancer ~60% survival rate at 10 µM
dbacp06180 Synthetic peptide KWKKLLKKPPPLLKKLLKKL Synthetic peptide Not specified MTT/MTS assay Jurkat Blood cancer 0% survival rate at 100 µM
dbacp06794 CM11 WKLFKKILKVL Cecropin-Melittin Hybrid Peptide Apoptosis inducing MTT assay Jurkat Blood Cancer Survival rate = 47% at 32 μg/ml
dbacp06864 AMP-WF3 FLKSLWRGVKAIFNGARQGYKEHKN Poecilia Mexicana fish Apoptosis inducing MTT assay Jurkat Blood Cancer IC50 = 50 µM
dbacp06905 LFcin17–30 FKCRRWQWRMKKLG Lectoferrin Peptide Apoptosis inducing MTT assay Jurkat Blood Cancer cell viability ~ 70% at 20 µM
dbacp06907 LFampin265–284 DLIWKLLSKAQEKFGKNKSR Lectoferrin Peptide Apoptosis inducing MTT assay Jurkat Blood Cancer cell viability ~ 47% at 10 µM
dbacp06909 LFchimera FKCRRWQWRMKKLG-K-RSKNKGFKEQAKSLLKWILD Synthetic - Lectoferrin chimera Apoptosis inducing MTT assay Jurkat Blood Cancer cell viability ~ 8% at 20 µM
dbacp07343 HMP-S7 SFIPRAKSTWLNNIKLL Human Milk Membrane penetration, cytoplasmic leakage Trypan blue assay Jurkat Blood Cancer IC50 = 186 ± 37 µM
dbacp07599 Tritrp-Agb V(Agb)(Agb)FPWWWPFL(Agb)(Agb) Synthetic Membrane permeabilization via lysine substitution MTT assay Jurkat Blood Cancer IC50 = 9.6 μM
dbacp07600 Tritrp-hArg V(hArg)(hArg)FPWWWPFL(hArg)(hArg) Synthetic Membrane permeabilization via lysine substitution MTT assay Jurkat Blood Cancer IC50 = 13.3 μM
dbacp07601 Tritrp-Lys VKKFPWWWPFLKK Synthetic Membrane permeabilization via lysine substitution MTT assay Jurkat Blood Cancer IC50 = 11.5 μM
dbacp07602 Tritrp-Dap V(Dap)(Dap)FPWWWPFL(Dap)(Dap) Synthetic Membrane permeabilization via lysine substitution MTT assay Jurkat Blood Cancer IC50 ≥ 65 μM
dbacp07603 Tritrp-Dab V(Dab)(Dab)FPWWWPFL(Dab)(Dab) Synthetic Membrane permeabilization via lysine substitution MTT assay Jurkat Blood Cancer IC50 ≤ 6.5 μM
dbacp07604 Tritrp-Orn V(Orn)(Orn)FPWWWPFL(Orn)(Orn) Synthetic Membrane permeabilization via lysine substitution MTT assay Jurkat Blood Cancer IC50 ≤ 6.5 μM
dbacp07605 Tritrp-P59A VRRFAWWWAFLRR Synthetic Membrane permeabilization via lysine substitution MTT assay Jurkat Blood Cancer IC50 = 12.5 μM
dbacp07606 Tritrp-P59A-Lys VKKFAWWWAFLKK Synthetic Membrane permeabilization via lysine substitution MTT assay Jurkat Blood Cancer IC50 = 27.6 μM
dbacp07607 Tritrp-P5A VRRFAWWWPFLRR Synthetic Membrane permeabilization via lysine substitution MTT assay Jurkat Blood Cancer IC50 = 16.2 μM
dbacp07608 Tritrp-P5A-Lys VKKFAWWWPFLKK Synthetic Membrane permeabilization via lysine substitution MTT assay Jurkat Blood Cancer IC50 = 27.6 μM
dbacp07609 Tritrp-P9A VRRFPWWWAFLRR Synthetic Membrane permeabilization via lysine substitution MTT assay Jurkat Blood Cancer IC50 = 6.8 μM
dbacp07610 Tritrp-P9A-Lys VKKFPWWWAFLKK Synthetic Membrane permeabilization via lysine substitution MTT assay Jurkat Blood Cancer IC50 = 15.1 μM
dbacp07611 Tritrp-W678F VRRFPFFFPFLRR Synthetic Membrane permeabilization via lysine substitution MTT assay Jurkat Blood Cancer IC50 = 24.6 μM
dbacp07612 Tritrp-W678bTA VRRFP(bTA)(bTA)(bTA)PFLRR Synthetic Membrane permeabilization via lysine substitution MTT assay Jurkat Blood Cancer IC50 = 9.6 μM
dbacp07613 Tritrp-W6hW VRRFP(hW)WWPFLRR Synthetic Membrane permeabilization via lysine substitution MTT assay Jurkat Blood Cancer IC50 = 16.1 μM
dbacp07614 Tritrp-W7hW VRRFPW(hW)WPFLRR Synthetic Membrane permeabilization via lysine substitution MTT assay Jurkat Blood Cancer IC50 = 15.1 μM
dbacp07615 Tritrp-W8hW VRRFPWW(hW)PFLRR Synthetic Membrane permeabilization via lysine substitution MTT assay Jurkat Blood Cancer IC50 = 10.7 μM
dbacp07616 Tritrp-W789hW VRRFP(hW)(hW)(hW)PFLRR Synthetic Membrane permeabilization via lysine substitution MTT assay Jurkat Blood Cancer IC50 = 44.8 μM
dbacp07617 Tritrp-W6A VRRFPAWWPFLRR Synthetic Membrane permeabilization via lysine substitution MTT assay Jurkat Blood Cancer IC50 = 36.5 μM
dbacp07618 Tritrp-W7A VRRFPWAWPFLRR Synthetic Membrane permeabilization via lysine substitution MTT assay Jurkat Blood Cancer IC50 = 48.2 μM
dbacp07619 Tritrp-W8A VRRFPWWAPFLRR Synthetic Membrane permeabilization via lysine substitution MTT assay Jurkat Blood Cancer IC50 = 22.8 μM
dbacp07620 Tritrp-W67A VRRFPAAWPFLRR Synthetic Membrane permeabilization via lysine substitution MTT assay Jurkat Blood Cancer IC50 ≥ 65 μM
dbacp07621 Tritrp-W68A VRRFPAWAPFLRR Synthetic Membrane permeabilization via lysine substitution MTT assay Jurkat Blood Cancer IC50 ≥ 65 μM
dbacp07622 Tritrp-W78A VRRFPWAAPFLRR Synthetic Membrane permeabilization via lysine substitution MTT assay Jurkat Blood Cancer IC50 ≥ 65 μM
dbacp07623 Tritrp-W678A VRRFPAAAPFLRR Synthetic Membrane permeabilization via lysine substitution MTT assay Jurkat Blood Cancer IC50 ≥ 65 μM
dbacp07624 Tritrp-W6Y VRRFPYWWPFLRR Synthetic Membrane permeabilization via lysine substitution MTT assay Jurkat Blood Cancer IC50 = 19.3 μM
dbacp07625 Tritrp-W7Y VRRFPWYWPFLRR Synthetic Membrane permeabilization via lysine substitution MTT assay Jurkat Blood Cancer IC50 = 11.4 μM
dbacp07626 Tritrp-W8Y VRRFPWWYPFLRR Synthetic Membrane permeabilization via lysine substitution MTT assay Jurkat Blood Cancer IC50 = 12.0 μM
dbacp07627 Tritrp-W67Y VRRFPYYWPFLRR Synthetic Membrane permeabilization via lysine substitution MTT assay Jurkat Blood Cancer IC50 = 32.2 μM
dbacp07628 Tritrp-W68Y VRRFPYWYPFLRR Synthetic Membrane permeabilization via lysine substitution MTT assay Jurkat Blood Cancer IC50 = 35.4 μM
dbacp07629 Tritrp-W78Y VRRFPWYYPFLRR Synthetic Membrane permeabilization via lysine substitution MTT assay Jurkat Blood Cancer IC50 = 25.6 μM
dbacp07630 Tritrp-W678Y VRRFPYYYPFLRR Synthetic Membrane permeabilization via lysine substitution MTT assay Jurkat Blood Cancer IC50 ≥ 65 μM
dbacp07631 Tritrp DiSu CVRRFPWWYPFLRRC Synthetic Membrane permeabilization via lysine substitution MTT assay Jurkat Blood Cancer IC50 = 12.3 μM
dbacp07632 MagaininF5W-Lys GIGKWLHSAKKFGKAFVGEIMNS Synthetic Membrane permeabilization via lysine substitution MTT assay Jurkat Blood Cancer IC50 = 16.8 μM
dbacp07633 MagaininF5W-Arg GIGRWLHSARRFGRAFVGEIMNS Synthetic Membrane permeabilization via lysine substitution MTT assay Jurkat Blood Cancer IC50 = 16.8 μM
dbacp07634 PuroA-Arg FPVTWKWWKWWKG Synthetic Membrane permeabilization via lysine substitution MTT assay Jurkat Blood Cancer IC50 = 10.0 μM
dbacp07635 PuroA-Lys FPVTWRWWRWWRG Synthetic Membrane permeabilization via lysine substitution MTT assay Jurkat Blood Cancer IC50 = 12.0 μM
dbacp07636 Indolicidin-Lys ILPWKWPWWPWKK Synthetic Membrane permeabilization via lysine substitution MTT assay Jurkat Blood Cancer IC50 = 9.5 μM
dbacp07637 MPG GALFLGFLGAAGSTMGAWSQPKKKRKV Synthetic Membrane permeabilization via lysine substitution MTT assay Jurkat Blood Cancer IC50 = 15.8 μM
dbacp08438 Balixafortide ACSAp(Dab)RYCYQKpPYH Synthetic Not Available HUVEC sprouting Jurkat Blood Cancer IC50< 10 nM