123 result(s) have been found!
| Accession | Name | Sequence | Source/Organism | Mechanism | Assay Type | Cell Line | Cancer Type | Activity |
|---|---|---|---|---|---|---|---|---|
| dbacp00571 | [L9]-P18 | KWKLFKKILKFLHLAKKF | Ceropin A | Cell membrane disintegration | MTT/MTS assay | Jurkat | Blood cancer | IC50 : 9 µM |
| dbacp00619 | [S9]-P18 | KWKLFKKISKFLHLAKKF | Ceropin A | Cell membrane disintegration | MTT/MTS assay | Jurkat | Blood cancer | IC50 : 7 µM |
| dbacp00701 | 072RB | DMRPEIYI(Aib)QELRRIGDAFN(Aib)YRQIKIWFQNRRMKWKK | BH3-only, Direct activators, BIM analogues | Inducing apoptosis | Not specified | Jurkat | Leukemia | Not found |
| dbacp01457 | Bax 1 | STKKLSECLKRIGDELDSnM | Effectors (BAK, BAX) | Inducing apoptosis | Not specified | Jurkat | Not specified | IC50 : 2.0 μmol/L |
| dbacp01461 | Bax 10 | KLSECLKRIGDELDS | Effectors (BAK, BAX) | Inducing apoptosis | Not specified | Jurkat | Not specified | IC50 : > 500 μmol/L |
| dbacp01465 | Bax 11 | LSECLKRIGDELDSN | Effectors (BAK, BAX) | Inducing apoptosis | Not specified | Jurkat | Not specified | IC50 : > 500 μmol/L |
| dbacp01469 | Bax 12 | STKKLECLKRIGDELDSnM | Effectors (BAK, BAX) | Inducing apoptosis | Not specified | Jurkat | Not specified | IC50 : > 500 μmol/L |
| dbacp01473 | Bax 13 | STKKLCLKRIGDELDSnM | Effectors (BAK, BAX) | Inducing apoptosis | Not specified | Jurkat | Not specified | IC50 : > 500 μmol/L |
| dbacp01477 | Bax 14 | STKKLLKRIGDELDSnM | Effectors (BAK, BAX) | Inducing apoptosis | Not specified | Jurkat | Not specified | IC50 : > 500 μmol/L |
| dbacp01481 | Bax 15 | STKKLSECLGDELDSnM | Effectors (BAK, BAX) | Inducing apoptosis | Not specified | Jurkat | Not specified | IC50 : > 500 μmol/L |
| dbacp01485 | Bax 16 | STKKLSECLKRIGDEL | Effectors (BAK, BAX) | Inducing apoptosis | Not specified | Jurkat | Not specified | IC50 : 20 μmol/L |
| dbacp01489 | Bax 17 | TKKLSECLKRIGDEL | Effectors (BAK, BAX) | Inducing apoptosis | Not specified | Jurkat | Not specified | IC50 : 79 μmol/L |
| dbacp01493 | Bax 18 | TKKLSECLKRIGDE | Effectors (BAK, BAX) | Inducing apoptosis | Not specified | Jurkat | Not specified | IC50 : > 500 μmol/L |
| dbacp01497 | Bax 2 | AAKKLSECLKRIGDELDSnM | Effectors (BAK, BAX) | Inducing apoptosis | Not specified | Jurkat | Not specified | IC50 : 2.3 μmol/L |
| dbacp01501 | Bax 3 | STKKLSECLKRIGDELDS | Effectors (BAK, BAX) | Inducing apoptosis | Not specified | Jurkat | Not specified | IC50 : 18.3 μmol/L |
| dbacp01505 | Bax 4 | STKKLSECLKRIGDELDSM | Effectors (BAK, BAX) | Inducing apoptosis | Not specified | Jurkat | Not specified | IC50 : 7.6 μmol/L |
| dbacp01509 | Bax 5 | STKKLSECLKRIGDELDM | Effectors (BAK, BAX) | Inducing apoptosis | Not specified | Jurkat | Not specified | IC50 : 2.1 μmol/L |
| dbacp01513 | Bax 6 | STKKLSECLKRIGDELM | Effectors (BAK, BAX) | Inducing apoptosis | Not specified | Jurkat | Not specified | IC50 : 8.0 μmol/L |
| dbacp01517 | Bax 7 | STKKLSECLKRIGDEM | Effectors (BAK, BAX) | Inducing apoptosis | Not specified | Jurkat | Not specified | IC50 : 7.4 μmol/L |
| dbacp01521 | Bax 8 | STKKLSECLKRIGDM | Effectors (BAK, BAX) | Inducing apoptosis | Not specified | Jurkat | Not specified | IC50 : > 500 μmol/L |
| dbacp01525 | Bax 9 | KKLSECLKRIGDELDSnM | Effectors (BAK, BAX) | Inducing apoptosis | Not specified | Jurkat | Not specified | IC50 : 148.0 μmol/L |
| dbacp01834 | Bim-BH3W89Y | DMRPEIYIAQELRRIGDEFNAY | BH3-only, Direct activators, BIM analogues | Inducing apoptosis | Not specified | Jurkat | Leukemia | Not found |
| dbacp01837 | Bim-BH3YA2Aib | DMRPEIYI(Aib)QELRRIGDAFN(Aib)Y | BH3-only, Direct activators, BIM analogues | Inducing apoptosis | Not specified | Jurkat | Leukemia | Not found |
| dbacp01913 | BpirLAAO-I | ADDKNPLEEFRETNYEVFLEIAKNGLKATSNPKRVVIVGAGMAGLSAAY | Venom base | Inducing apoptosis | MTT assay | Jurkat | Acute T cell Leukemia | Not found |
| dbacp01959 | Brevinin-2R | KLKNFAKGVAQSLLNKASCKLSGQC | Skin, Marsh frog, Europe | Activates the lysosomal-mitochondrial death pathway; Involves autophagy-like cell death | MTT-assay | Jurkat | T-cell Leukemia | LD50 : 10 – 15 μg/ml |
| dbacp01960 | Brevinin-2R | KLKNFAKGVAQSLLNKASCKLSGQC | Skin, Marsh frog, Europe | Activates the lysosomal-mitochondrial death pathway; Involves autophagy-like cell death | MTT-assay | Jurkat | T-cell Leukemia | LD50 : 20 – 25 μg/ml |
| dbacp01961 | Brevinin-2R | KLKNFAKGVAQSLLNKASCKLSGQC | Skin, Marsh frog, Europe | Activates the lysosomal-mitochondrial death pathway; Involves autophagy-like cell death | MTT-assay | Jurkat | T-cell Leukemia | LD50 : 30 – 40 μg/ml |
| dbacp01980 | Brevinin-2R | KLKNFAKGVAQSLLNKASCKLSGQC | Skin, Marsh frog, Europe | Activates the lysosomal-mitochondrial death pathway; Involves autophagy-like cell death | MTT-assay | Jurkat | T-cell Leukemia | LD50 : 20 – 25 µg/mll |
| dbacp02114 | C-1 | KWKLFKKIPFLHLAKKF | Ceropin A | Cell membrane disintegration | MTT/MTS assay | Jurkat | Blood cancer | IC50 : 32 µM |
| dbacp02117 | C-10 | KWKLFKKIPKFLH | Ceropin A | Cell membrane disintegration | MTT/MTS assay | Jurkat | Blood cancer | IC50 : <100 µM |
| dbacp02120 | C-2 | KWKLFKKIPKFLHLAKK | Ceropin A | Cell membrane disintegration | MTT/MTS assay | Jurkat | Blood cancer | IC50 : 26 µM |
| dbacp02123 | C-3 | KWKLFKKIPLHLAKKF | Ceropin A | Cell membrane disintegration | MTT/MTS assay | Jurkat | Blood cancer | IC50 : 74 µM |
| dbacp02126 | C-4 | KWKLFKKIPKFLHLAK | Ceropin A | Cell membrane disintegration | MTT/MTS assay | Jurkat | Blood cancer | IC50 : 31 µM |
| dbacp02129 | C-5 | KWKLFKKIPHLAKKF | Ceropin A | Cell membrane disintegration | MTT/MTS assay | Jurkat | Blood cancer | IC50 : 81 µM |
| dbacp02132 | C-6 | KWKLFKKIPKFLHLA | Ceropin A | Cell membrane disintegration | MTT/MTS assay | Jurkat | Blood cancer | IC50 : 21 µM |
| dbacp02135 | C-7 | KWKLFKKIPLAKKF | Ceropin A | Cell membrane disintegration | MTT/MTS assay | Jurkat | Blood cancer | IC50 : <100 µM |
| dbacp02138 | C-8 | KWKLFKKIPKFLHL | Ceropin A | Cell membrane disintegration | MTT/MTS assay | Jurkat | Blood cancer | IC50 : 54 µM |
| dbacp02141 | C-9 | KWKLFKKIPLKKF | Ceropin A | Cell membrane disintegration | MTT/MTS assay | Jurkat | Blood cancer | IC50 : <100 µM |
| dbacp02227 | CA-MA | KWKLFKKIGIGKFLHSAKKF | Ceropin-Melittin hybrid | Membrane disruptive mode of action | MTT/MTS assay | Jurkat | Blood cancer | Activity : 100% survival rate at 10 µM |
| dbacp02228 | CA-MA | KWKLFKKIGIGKFLHSAKKF | Ceropin-Melittin hybrid | Membrane disruptive mode of action | MTT/MTS assay | Jurkat | Blood cancer | Activity : 0% survival rate at 100 µM |
| dbacp02233 | CA-MA | KWKLFKKIGIGKFLHSAKKF | Ceropin-African clawed frog hybrid peptides | Cell membrane disintegration | MTT/MTS assay | Jurkat | Blood cancer | IC50 : 30 µM |
| dbacp02239 | CA-MA-P | KWKLFKKIPKFLHSAKKF | Ceropin A | Cell membrane disintegration | MTT/MTS assay | Jurkat | Blood cancer | IC50 : 20 µM |
| dbacp02243 | CA-MA1 | KWKLFKKIKFLHSAKKF | Ceropin-African clawed frog hybrid peptides | Cell membrane disintegration | MTT/MTS assay | Jurkat | Blood cancer | IC50 : 65 µM |
| dbacp02247 | CA-MA2 | KWKLFKKIPKFLHSAKKF | Ceropin-African clawed frog hybrid peptides | Cell membrane disintegration | MTT/MTS assay | Jurkat | Blood cancer | IC50 : 20 µM |
| dbacp02251 | CA-MA3 | KWKLFKKIGPGKFLHSAKKF | Ceropin-African clawed frog hybrid peptides | Cell membrane disintegration | MTT/MTS assay | Jurkat | Blood cancer | IC50 : 75 µM |
| dbacp02565 | CRAMP-18 E2K | GKKLKKIGQKIKNFFQKL | Synthetic | Disrupt cell membrane structure | MTT assay | Jurkat | Acute T cell Leukemia | IC50 : 20–34 uM |
| dbacp03280 | Harmoniasin | IGGYCSELDL-NH | Harlequin lady beetle | Induce apoptotic and necrotic cell deaths | MTS assay and LDH release assay | Jurkat | Human leukemia | MIC : approx. 200 µg/ml |
| dbacp03522 | KillerFLIP | YGRKKRRQRRRREADFFWSLCTADMS | Not found | Apoptotic activity and necroptosis; Plasma membrane permeabilization | Not specified | Jurkat | Blood cancer | Not found |
| dbacp03541 | L-amino-acid oxidase (BatroxLAAO) (LAO) (EC 1.4.3.2) | MNVFFTFSLLFLAALGSCADDRNPLEECFRETDYEEFLEIAKNGLSTTSNPKRVVIVGAGMSGLSAAYVLANAGHQVTVLEASERAGGRVKTYRNEKEGWYANLGPMRLPEKHRIVREYIRKFDLQLNEFSQENENAWYFIKNIRKRVGEVNKDPGVLEYPVKPSEVGKSAGQLYEESLQKAVEELRRTNCSYMLNKYDTYSTKEYLLKEGNLSPGAVDMIGDLLNEDSGYYVSFIESLKHDDIFAYEKRFDEIVGGMDKLPTSMYQAIQEKVHLNARVIKIQQDVKEVTVTYQTSEKETLSVTADYVIVCTTSRAARRIKFEPPLPPKKAHALRSVHYRSGTKIFLTCTKKFWEDDGIHGGKSTTDLPSRFIYYPNHNFPNGVGVIIAYGIGDDANYFQALDFEDCGDIVINDLSLIHQLPKEEIQAICRPSMIQRWSLDKYAMGGITTFTPYQFQHFSEALTAPVDRIYFAGEYTAQAHGWIDSTIKSGLRAARDVNRASEIKK | Common lancehead | Inducing apoptosis | MTT assay | Jurkat | Acute T-cell Leukemia | Not found |
| dbacp03741 | LfcinB (Bovine lactoferricin) | FKCRRWQWRM | Not found | Inducing apoptosis | MTT assay | Jurkat | Leukemia | Not found |
| dbacp04292 | Lt-MAP2 | LIKKLKEYLKKLI | Derivatives of Latarcin-3a | Not specified | Not specified | Jurkat | Not found | Not found |
| dbacp04568 | Mastoparan | INLKALAALAKKIL | Venom base | Inducing apoptosis | Not specified | Jurkat | Not specified | IC50 : 77.9 ± 6.7 µM |
| dbacp04731 | N-1 | WKLFKKIPKFLHLAKKF | Ceropin A | Cell membrane disintegration | MTT/MTS assay | Jurkat | Blood cancer | IC50 : 12 µM |
| dbacp04734 | N-2 | FKLFKKIPKFLHLAKKF | Ceropin A | Cell membrane disintegration | MTT/MTS assay | Jurkat | Blood cancer | IC50 : 11 µM |
| dbacp04737 | N-3 | KWFKKIPKFLHLAKKF | Ceropin A | Cell membrane disintegration | MTT/MTS assay | Jurkat | Blood cancer | IC50 : 17 µM |
| dbacp04740 | N-3L | KWFKKIPKFLHLLKKF | Ceropin A | Cell membrane disintegration | MTT/MTS assay | Jurkat | Blood cancer | IC50 : 4 µM |
| dbacp04743 | N-4 | WFKKIPKFLHLAKKF | Ceropin A | Cell membrane disintegration | MTT/MTS assay | Jurkat | Blood cancer | IC50 : 23 µM |
| dbacp04746 | N-4L | WFKKIPKFLHLLKKF | Ceropin A | Cell membrane disintegration | MTT/MTS assay | Jurkat | Blood cancer | IC50 : 6 µM |
| dbacp04749 | N-5 | WKKIPKFLHLAKKF | Ceropin A | Cell membrane disintegration | MTT/MTS assay | Jurkat | Blood cancer | IC50 : < 100 µM |
| dbacp04752 | N-5L | WKKIPKFLHLLKKF | Ceropin A | Cell membrane disintegration | MTT/MTS assay | Jurkat | Blood cancer | IC50 :14 µM |
| dbacp05049 | P18 | KWKFKKIPKFLHLAKKF | Ceropin A | Cell membrane disintegration | MTT/MTS assay | Jurkat | Blood cancer | IC50 : 4 µM |
| dbacp05127 | PaDef | ATCETPSKHFNGLCIRSSNCASVCHGEHFTDGRCQGVRRRCMCLKPC | Plant sources | Inducing apoptosis | MTT assay | Jurkat | Leukemia | Not found |
| dbacp05248 | Pep27 | MRKEFHNVLSSGQLLADKRPARDYNRK | Pneumococcus | Apoptosis inducing | MTT/MTS assay | Jurkat | Blood cancer | IC50 : > 70 µM |
| dbacp05253 | Pep27 | MRKEFHNVLSSGQLLADKRPARDYNRK | Not found | Inducing apoptosis | MTT assay | Jurkat | T-cell leukemia | IC50 : > 70 µM |
| dbacp05259 | Pep27 anal1 | MWKWFHNVLSSWQLLADKRPARDYNRK | Not found | Inducing apoptosis | MTT assay | Jurkat | T-cell leukemia | IC50 : 47 µM |
| dbacp05264 | Pep27 anal2 | MWKWFHNVLSWWWLLADKRPARDYNRK | Not found | Inducing apoptosis | MTT assay | Jurkat | T cell leukemia | IC50 : 23 µM |
| dbacp05269 | Pep27 anal3 | MRKWFHNVLSSGQLLADKWPAWDYNRK | Not found | Inducing apoptosis | MTT assay | Jurkat | T cell leukemia | IC50 : 50 µM |
| dbacp05274 | Pep27 anal4 | MWKEFHNVLSSGQLLADKRWARWYNRW | Not found | Inducing apoptosis | MTT assay | Jurkat | T-cell Leukemia | IC50 : 46 µM |
| dbacp05279 | Pep27 anal5 | MWKWFHNVLSSGQLLADKWWAWWYNWW | Not found | Inducing apoptosis | MTT assay | Jurkat | T cell leukemia | IC50 : > 70 µM |
| dbacp05284 | Pep27anal1 | MWKWFHNVLSSWQLLADKRPARDYNRK | Pneumococcus | Apoptosis inducing | MTT/MTS assay | Jurkat | Blood cancer | IC50 : 47 µM |
| dbacp05289 | Pep27anal2 | MWKWFHNVLSWWWLLADKRPARDYNRK | Pneumococcus | Apoptosis inducing | MTT/MTS assay | Jurkat | Blood cancer | IC50 : 23 µM |
| dbacp05294 | Pep27anal3 | MRKWFHNVLSSGQLLADKWPAWDYNRK | Pneumococcus | Apoptosis inducing | MTT/MTS assay | Jurkat | Blood cancer | IC50 : 50 µM |
| dbacp05299 | Pep27anal4 | MWKEFHNVLSSGQLLADKRWARWYNRW | Pneumococcus | Apoptosis inducing | MTT/MTS assay | Jurkat | Blood cancer | IC50 : 46 µM |
| dbacp05304 | Pep27anal5 | MWKWFHNVLSSGQLLADKWWAWWYNWW | Pneumococcus | Apoptosis inducing | MTT/MTS assay | Jurkat | Blood cancer | IC50 : >70 µM |
| dbacp06034 | Scolopendrasin VII | FCTCNVKGFNAKNKRGIIYP | Chinese red-headed centipede, Asia | Necrotic cell death | MTS assay | Jurkat | Leukemia | Not found |
| dbacp06179 | Synthetic peptide | KWKKLLKKPPPLLKKLLKKL | Synthetic peptide | Not specified | MTT/MTS assay | Jurkat | Blood cancer | ~60% survival rate at 10 µM |
| dbacp06180 | Synthetic peptide | KWKKLLKKPPPLLKKLLKKL | Synthetic peptide | Not specified | MTT/MTS assay | Jurkat | Blood cancer | 0% survival rate at 100 µM |
| dbacp06794 | CM11 | WKLFKKILKVL | Cecropin-Melittin Hybrid Peptide | Apoptosis inducing | MTT assay | Jurkat | Blood Cancer | Survival rate = 47% at 32 μg/ml |
| dbacp06864 | AMP-WF3 | FLKSLWRGVKAIFNGARQGYKEHKN | Poecilia Mexicana fish | Apoptosis inducing | MTT assay | Jurkat | Blood Cancer | IC50 = 50 µM |
| dbacp06905 | LFcin17–30 | FKCRRWQWRMKKLG | Lectoferrin Peptide | Apoptosis inducing | MTT assay | Jurkat | Blood Cancer | cell viability ~ 70% at 20 µM |
| dbacp06907 | LFampin265–284 | DLIWKLLSKAQEKFGKNKSR | Lectoferrin Peptide | Apoptosis inducing | MTT assay | Jurkat | Blood Cancer | cell viability ~ 47% at 10 µM |
| dbacp06909 | LFchimera | FKCRRWQWRMKKLG-K-RSKNKGFKEQAKSLLKWILD | Synthetic - Lectoferrin chimera | Apoptosis inducing | MTT assay | Jurkat | Blood Cancer | cell viability ~ 8% at 20 µM |
| dbacp07343 | HMP-S7 | SFIPRAKSTWLNNIKLL | Human Milk | Membrane penetration, cytoplasmic leakage | Trypan blue assay | Jurkat | Blood Cancer | IC50 = 186 ± 37 µM |
| dbacp07599 | Tritrp-Agb | V(Agb)(Agb)FPWWWPFL(Agb)(Agb) | Synthetic | Membrane permeabilization via lysine substitution | MTT assay | Jurkat | Blood Cancer | IC50 = 9.6 μM |
| dbacp07600 | Tritrp-hArg | V(hArg)(hArg)FPWWWPFL(hArg)(hArg) | Synthetic | Membrane permeabilization via lysine substitution | MTT assay | Jurkat | Blood Cancer | IC50 = 13.3 μM |
| dbacp07601 | Tritrp-Lys | VKKFPWWWPFLKK | Synthetic | Membrane permeabilization via lysine substitution | MTT assay | Jurkat | Blood Cancer | IC50 = 11.5 μM |
| dbacp07602 | Tritrp-Dap | V(Dap)(Dap)FPWWWPFL(Dap)(Dap) | Synthetic | Membrane permeabilization via lysine substitution | MTT assay | Jurkat | Blood Cancer | IC50 ≥ 65 μM |
| dbacp07603 | Tritrp-Dab | V(Dab)(Dab)FPWWWPFL(Dab)(Dab) | Synthetic | Membrane permeabilization via lysine substitution | MTT assay | Jurkat | Blood Cancer | IC50 ≤ 6.5 μM |
| dbacp07604 | Tritrp-Orn | V(Orn)(Orn)FPWWWPFL(Orn)(Orn) | Synthetic | Membrane permeabilization via lysine substitution | MTT assay | Jurkat | Blood Cancer | IC50 ≤ 6.5 μM |
| dbacp07605 | Tritrp-P59A | VRRFAWWWAFLRR | Synthetic | Membrane permeabilization via lysine substitution | MTT assay | Jurkat | Blood Cancer | IC50 = 12.5 μM |
| dbacp07606 | Tritrp-P59A-Lys | VKKFAWWWAFLKK | Synthetic | Membrane permeabilization via lysine substitution | MTT assay | Jurkat | Blood Cancer | IC50 = 27.6 μM |
| dbacp07607 | Tritrp-P5A | VRRFAWWWPFLRR | Synthetic | Membrane permeabilization via lysine substitution | MTT assay | Jurkat | Blood Cancer | IC50 = 16.2 μM |
| dbacp07608 | Tritrp-P5A-Lys | VKKFAWWWPFLKK | Synthetic | Membrane permeabilization via lysine substitution | MTT assay | Jurkat | Blood Cancer | IC50 = 27.6 μM |
| dbacp07609 | Tritrp-P9A | VRRFPWWWAFLRR | Synthetic | Membrane permeabilization via lysine substitution | MTT assay | Jurkat | Blood Cancer | IC50 = 6.8 μM |
| dbacp07610 | Tritrp-P9A-Lys | VKKFPWWWAFLKK | Synthetic | Membrane permeabilization via lysine substitution | MTT assay | Jurkat | Blood Cancer | IC50 = 15.1 μM |
| dbacp07611 | Tritrp-W678F | VRRFPFFFPFLRR | Synthetic | Membrane permeabilization via lysine substitution | MTT assay | Jurkat | Blood Cancer | IC50 = 24.6 μM |
| dbacp07612 | Tritrp-W678bTA | VRRFP(bTA)(bTA)(bTA)PFLRR | Synthetic | Membrane permeabilization via lysine substitution | MTT assay | Jurkat | Blood Cancer | IC50 = 9.6 μM |
| dbacp07613 | Tritrp-W6hW | VRRFP(hW)WWPFLRR | Synthetic | Membrane permeabilization via lysine substitution | MTT assay | Jurkat | Blood Cancer | IC50 = 16.1 μM |
| dbacp07614 | Tritrp-W7hW | VRRFPW(hW)WPFLRR | Synthetic | Membrane permeabilization via lysine substitution | MTT assay | Jurkat | Blood Cancer | IC50 = 15.1 μM |
| dbacp07615 | Tritrp-W8hW | VRRFPWW(hW)PFLRR | Synthetic | Membrane permeabilization via lysine substitution | MTT assay | Jurkat | Blood Cancer | IC50 = 10.7 μM |
| dbacp07616 | Tritrp-W789hW | VRRFP(hW)(hW)(hW)PFLRR | Synthetic | Membrane permeabilization via lysine substitution | MTT assay | Jurkat | Blood Cancer | IC50 = 44.8 μM |
| dbacp07617 | Tritrp-W6A | VRRFPAWWPFLRR | Synthetic | Membrane permeabilization via lysine substitution | MTT assay | Jurkat | Blood Cancer | IC50 = 36.5 μM |
| dbacp07618 | Tritrp-W7A | VRRFPWAWPFLRR | Synthetic | Membrane permeabilization via lysine substitution | MTT assay | Jurkat | Blood Cancer | IC50 = 48.2 μM |
| dbacp07619 | Tritrp-W8A | VRRFPWWAPFLRR | Synthetic | Membrane permeabilization via lysine substitution | MTT assay | Jurkat | Blood Cancer | IC50 = 22.8 μM |
| dbacp07620 | Tritrp-W67A | VRRFPAAWPFLRR | Synthetic | Membrane permeabilization via lysine substitution | MTT assay | Jurkat | Blood Cancer | IC50 ≥ 65 μM |
| dbacp07621 | Tritrp-W68A | VRRFPAWAPFLRR | Synthetic | Membrane permeabilization via lysine substitution | MTT assay | Jurkat | Blood Cancer | IC50 ≥ 65 μM |
| dbacp07622 | Tritrp-W78A | VRRFPWAAPFLRR | Synthetic | Membrane permeabilization via lysine substitution | MTT assay | Jurkat | Blood Cancer | IC50 ≥ 65 μM |
| dbacp07623 | Tritrp-W678A | VRRFPAAAPFLRR | Synthetic | Membrane permeabilization via lysine substitution | MTT assay | Jurkat | Blood Cancer | IC50 ≥ 65 μM |
| dbacp07624 | Tritrp-W6Y | VRRFPYWWPFLRR | Synthetic | Membrane permeabilization via lysine substitution | MTT assay | Jurkat | Blood Cancer | IC50 = 19.3 μM |
| dbacp07625 | Tritrp-W7Y | VRRFPWYWPFLRR | Synthetic | Membrane permeabilization via lysine substitution | MTT assay | Jurkat | Blood Cancer | IC50 = 11.4 μM |
| dbacp07626 | Tritrp-W8Y | VRRFPWWYPFLRR | Synthetic | Membrane permeabilization via lysine substitution | MTT assay | Jurkat | Blood Cancer | IC50 = 12.0 μM |
| dbacp07627 | Tritrp-W67Y | VRRFPYYWPFLRR | Synthetic | Membrane permeabilization via lysine substitution | MTT assay | Jurkat | Blood Cancer | IC50 = 32.2 μM |
| dbacp07628 | Tritrp-W68Y | VRRFPYWYPFLRR | Synthetic | Membrane permeabilization via lysine substitution | MTT assay | Jurkat | Blood Cancer | IC50 = 35.4 μM |
| dbacp07629 | Tritrp-W78Y | VRRFPWYYPFLRR | Synthetic | Membrane permeabilization via lysine substitution | MTT assay | Jurkat | Blood Cancer | IC50 = 25.6 μM |
| dbacp07630 | Tritrp-W678Y | VRRFPYYYPFLRR | Synthetic | Membrane permeabilization via lysine substitution | MTT assay | Jurkat | Blood Cancer | IC50 ≥ 65 μM |
| dbacp07631 | Tritrp DiSu | CVRRFPWWYPFLRRC | Synthetic | Membrane permeabilization via lysine substitution | MTT assay | Jurkat | Blood Cancer | IC50 = 12.3 μM |
| dbacp07632 | MagaininF5W-Lys | GIGKWLHSAKKFGKAFVGEIMNS | Synthetic | Membrane permeabilization via lysine substitution | MTT assay | Jurkat | Blood Cancer | IC50 = 16.8 μM |
| dbacp07633 | MagaininF5W-Arg | GIGRWLHSARRFGRAFVGEIMNS | Synthetic | Membrane permeabilization via lysine substitution | MTT assay | Jurkat | Blood Cancer | IC50 = 16.8 μM |
| dbacp07634 | PuroA-Arg | FPVTWKWWKWWKG | Synthetic | Membrane permeabilization via lysine substitution | MTT assay | Jurkat | Blood Cancer | IC50 = 10.0 μM |
| dbacp07635 | PuroA-Lys | FPVTWRWWRWWRG | Synthetic | Membrane permeabilization via lysine substitution | MTT assay | Jurkat | Blood Cancer | IC50 = 12.0 μM |
| dbacp07636 | Indolicidin-Lys | ILPWKWPWWPWKK | Synthetic | Membrane permeabilization via lysine substitution | MTT assay | Jurkat | Blood Cancer | IC50 = 9.5 μM |
| dbacp07637 | MPG | GALFLGFLGAAGSTMGAWSQPKKKRKV | Synthetic | Membrane permeabilization via lysine substitution | MTT assay | Jurkat | Blood Cancer | IC50 = 15.8 μM |
| dbacp08438 | Balixafortide | ACSAp(Dab)RYCYQKpPYH | Synthetic | Not Available | HUVEC sprouting | Jurkat | Blood Cancer | IC50< 10 nM |