dbACP: A Comprehensive Database of Anti-Cancer Peptides

17 result(s) have been found!

Accession Name Sequence Source/Organism Mechanism Assay Type Cell Line Cancer Type Activity
dbacp02326 Cecropin A KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK Silkmoth Membrane disruption WST-1 assay 486P Bladder cancer IC50 : 251.47 µg/ml
dbacp02327 Cecropin A KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK Silkmoth Membrane disruption WST-1 assay RT4 Bladder cancer IC50 : 231.26 µg/ml
dbacp02328 Cecropin A KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK Silkmoth Membrane disruption WST-1 assay 647V Bladder cancer IC50 : 185.39 µg/ml
dbacp02329 Cecropin A KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK Silkmoth Membrane disruption WST-1 assay J82 Bladder cancer IC50 : 212.07 µg/ml
dbacp02330 Cecropin A KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK Silkmoth Membrane disruption Cell viability assay 486P Bladder cancer IC50 : 69.2 µg/ml
dbacp02331 Cecropin A KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK Silkmoth Membrane disruption Cell viability assay RT4 Bladder cancer IC50 : 96.22 µg/ml
dbacp02332 Cecropin A KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK Silkmoth Membrane disruption Cell viability assay 647V Bladder cancer IC50 : 28.74 µg/ml
dbacp02333 Cecropin A KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK Silkmoth Membrane disruption Cell viability assay J82 Bladder cancer IC50 : 99.01 µg/ml
dbacp02334 Cecropin A KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK Silkmoth Membrane disruption LDH leakage assay 486P Bladder cancer IC50 : 373.3/ µg/ml
dbacp02335 Cecropin A KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK Silkmoth Membrane disruption LDH leakage assay RT4 Bladder cancer IC50 : 289.3 µg/ml
dbacp02336 Cecropin A KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK Silkmoth Membrane disruption LDH leakage assay 647V Bladder cancer IC50 : 200.7 µg/ml
dbacp02337 Cecropin A KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK Silkmoth Membrane disruption LDH leakage assay J82 Bladder cancer IC50 : 319.2 µg/ml
dbacp02338 Cecropin A KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK Isolated from the giant silk moth, cecropia moth Membrane damage; Apoptotic cell death; Necrosis MTT/MTS assay SCC12 Skin cancer IC50 : 1 µM
dbacp02339 Cecropin A KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK Isolated from the giant silk moth, cecropia moth Membrane damage; Apoptotic cell death; Necrosis MTT/MTS assay SCC25 Skin cancer IC50 : 2.2 µM
dbacp02340 Cecropin A KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK Isolated from the giant silk moth, cecropia moth Membrane damage; Apoptotic cell death; Necrosis Cell viability assay SCC25 Skin cancer 0.6 ± 0.6% cell growth inhibition at 10 µM
dbacp02341 Cecropin A KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK Isolated from the giant silk moth, cecropia moth Membrane damage; Apoptotic cell death; Necrosis Cell viability assay SCC25 Skin cancer 107.0 ± 5.0% cell growth inhibition at 1 µM
dbacp02343 Cecropin A KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK Giant silk moth, cecropia moth Cell membrane disintegration Not specified Not found Not found Not found