17 result(s) have been found!
| Accession | Name | Sequence | Source/Organism | Mechanism | Assay Type | Cell Line | Cancer Type | Activity |
|---|---|---|---|---|---|---|---|---|
| dbacp02326 | Cecropin A | KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK | Silkmoth | Membrane disruption | WST-1 assay | 486P | Bladder cancer | IC50 : 251.47 µg/ml |
| dbacp02327 | Cecropin A | KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK | Silkmoth | Membrane disruption | WST-1 assay | RT4 | Bladder cancer | IC50 : 231.26 µg/ml |
| dbacp02328 | Cecropin A | KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK | Silkmoth | Membrane disruption | WST-1 assay | 647V | Bladder cancer | IC50 : 185.39 µg/ml |
| dbacp02329 | Cecropin A | KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK | Silkmoth | Membrane disruption | WST-1 assay | J82 | Bladder cancer | IC50 : 212.07 µg/ml |
| dbacp02330 | Cecropin A | KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK | Silkmoth | Membrane disruption | Cell viability assay | 486P | Bladder cancer | IC50 : 69.2 µg/ml |
| dbacp02331 | Cecropin A | KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK | Silkmoth | Membrane disruption | Cell viability assay | RT4 | Bladder cancer | IC50 : 96.22 µg/ml |
| dbacp02332 | Cecropin A | KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK | Silkmoth | Membrane disruption | Cell viability assay | 647V | Bladder cancer | IC50 : 28.74 µg/ml |
| dbacp02333 | Cecropin A | KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK | Silkmoth | Membrane disruption | Cell viability assay | J82 | Bladder cancer | IC50 : 99.01 µg/ml |
| dbacp02334 | Cecropin A | KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK | Silkmoth | Membrane disruption | LDH leakage assay | 486P | Bladder cancer | IC50 : 373.3/ µg/ml |
| dbacp02335 | Cecropin A | KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK | Silkmoth | Membrane disruption | LDH leakage assay | RT4 | Bladder cancer | IC50 : 289.3 µg/ml |
| dbacp02336 | Cecropin A | KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK | Silkmoth | Membrane disruption | LDH leakage assay | 647V | Bladder cancer | IC50 : 200.7 µg/ml |
| dbacp02337 | Cecropin A | KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK | Silkmoth | Membrane disruption | LDH leakage assay | J82 | Bladder cancer | IC50 : 319.2 µg/ml |
| dbacp02338 | Cecropin A | KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK | Isolated from the giant silk moth, cecropia moth | Membrane damage; Apoptotic cell death; Necrosis | MTT/MTS assay | SCC12 | Skin cancer | IC50 : 1 µM |
| dbacp02339 | Cecropin A | KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK | Isolated from the giant silk moth, cecropia moth | Membrane damage; Apoptotic cell death; Necrosis | MTT/MTS assay | SCC25 | Skin cancer | IC50 : 2.2 µM |
| dbacp02340 | Cecropin A | KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK | Isolated from the giant silk moth, cecropia moth | Membrane damage; Apoptotic cell death; Necrosis | Cell viability assay | SCC25 | Skin cancer | 0.6 ± 0.6% cell growth inhibition at 10 µM |
| dbacp02341 | Cecropin A | KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK | Isolated from the giant silk moth, cecropia moth | Membrane damage; Apoptotic cell death; Necrosis | Cell viability assay | SCC25 | Skin cancer | 107.0 ± 5.0% cell growth inhibition at 1 µM |
| dbacp02343 | Cecropin A | KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK | Giant silk moth, cecropia moth | Cell membrane disintegration | Not specified | Not found | Not found | Not found |