dbACP: A Comprehensive Database of Anti-Cancer Peptides

21 result(s) have been found!

Accession Name Sequence Source/Organism Mechanism Assay Type Cell Line Cancer Type Activity
dbacp02725 Dermaseptin-PS3 ALWKDILKNAGKAALNEINQIVQ Skin, the waxy monkey tree frog, South America Membrane rupture MTT assay H157 Lung cancer IC50 : 15.67 μM
dbacp02726 Dermaseptin-PS3 ALWKDILKNAGKAALNEINQIVQ Skin, the waxy monkey tree frog, South America Membrane rupture MTT assay PC3 Human prostate carcinoma IC50 : 18.20 μM
dbacp05038 P18 KWKLFKKIPKFLHLAKKF Bovine lactoferrin (Lf-B) Necrosis; Cell membrane rupture MTT/MTS assay M14 Skin cancer 92.2 ± 1.02% cell viability at 10 µM
dbacp05039 P18 KWKLFKKIPKFLHLAKKF Synthetic peptide Necrosis; Cell membrane rupture MTT/MTS assay M14 Skin cancer 71.1 ± 2.84% cell viability at 20 µM
dbacp05040 P18 KWKLFKKIPKFLHLAKKF Synthetic peptide Necrosis; Cell membrane rupture MTT/MTS assay M14 Skin cancer 50 ± 3.09% cell viability at 40 µM
dbacp05041 P18 KWKLFKKIPKFLHLAKKF Synthetic peptide Necrosis; Cell membrane rupture MTT/MTS assay M14 Skin cancer 31.5 ± 1.49% cell viability at 60 µM
dbacp05042 P18 KWKLFKKIPKFLHLAKKF Synthetic peptide Necrosis; Cell membrane rupture MTT/MTS assay M14 Skin cancer 13.8 ± 1.44% cell viability at 80 µM
dbacp05043 P18 KWKLFKKIPKFLHLAKKF Synthetic peptide Necrosis; Cell membrane rupture MTT/MTS assay A-375 Skin cancer 86 ± 0.57% cell viability at 10 µM
dbacp05044 P18 KWKLFKKIPKFLHLAKKF Synthetic peptide Necrosis; Cell membrane rupture MTT/MTS assay A-375 Skin cancer 63.8 ± 0.8% cell viability at 20 µM
dbacp05045 P18 KWKLFKKIPKFLHLAKKF Synthetic peptide Necrosis; Cell membrane rupture MTT/MTS assay A-375 Skin cancer 47.5 ± 1.66% cell viability at 40 µM
dbacp05046 P18 KWKLFKKIPKFLHLAKKF Synthetic peptide Necrosis; Cell membrane rupture MTT/MTS assay A-375 Skin cancer 26.9 ± 0.5% cell viability at 60 µM
dbacp05047 P18 KWKLFKKIPKFLHLAKKF Synthetic peptide Necrosis; Cell membrane rupture MTT/MTS assay A-375 Skin cancer 6.5 ± 1.07% cell viability at 80 µM
dbacp05697 Psyle A GIACGESCVFLGCFIPGCSCKSKVCYFN **Eumachia leptothyrsa**, New Guinea, Philippines, Sulawesi Necrosis; Cell membrane rupture Not specified Not found Not found Not found
dbacp05698 Psyle A GIACGESCVFLGCFIPGCSCKSKVCYFN **Eumachia leptothyrsa**, New Guinea, Philippines, Sulawesi Necrosis; Cell membrane rupture Not specified Not found Not found Not found
dbacp05699 Psyle A GIACGESCVFLGCFIPGCSCKSKVCYFN **Eumachia leptothyrsa**, New Guinea, Philippines, Sulawesi Necrosis; Cell membrane rupture Not specified Not found Not found Not found
dbacp05700 Psyle C KLCGETCFKFKCYTPGCSCSYPFCK **Eumachia leptothyrsa**, New Guinea, Philippines, Sulawesi Necrosis; Cell membrane rupture Not specified Not found Not found Not found
dbacp05701 Psyle C KLCGETCFKFKCYTPGCSCSYPFCK **Eumachia leptothyrsa**, New Guinea, Philippines, Sulawesi Necrosis; Cell membrane rupture Not specified Not found Not found Not found
dbacp05702 Psyle C KLCGETCFKFKCYTPGCSCSYPFCK **Eumachia leptothyrsa**, New Guinea, Philippines, Sulawesi Necrosis; Cell membrane rupture Not specified Not found Not found Not found
dbacp05703 Psyle E GVIPCGESCVFIPCISSVLGCSCKNKVCYRD **Eumachia leptothyrsa**, New Guinea, Philippines, Sulawesi Necrosis; Cell membrane rupture Not specified Not found Not found Not found
dbacp05704 Psyle E GVIPCGESCVFIPCISSVLGCSCKNKVCYRD **Eumachia leptothyrsa**, New Guinea, Philippines, Sulawesi Necrosis; Cell membrane rupture Not specified Not found Not found Not found
dbacp05705 Psyle E GVIPCGESCVFIPCISSVLGCSCKNKVCYRD **Eumachia leptothyrsa**, New Guinea, Philippines, Sulawesi Necrosis; Cell membrane rupture Not specified Not found Not found Not found