21 result(s) have been found!
| Accession | Name | Sequence | Source/Organism | Mechanism | Assay Type | Cell Line | Cancer Type | Activity |
|---|---|---|---|---|---|---|---|---|
| dbacp02725 | Dermaseptin-PS3 | ALWKDILKNAGKAALNEINQIVQ | Skin, the waxy monkey tree frog, South America | Membrane rupture | MTT assay | H157 | Lung cancer | IC50 : 15.67 μM |
| dbacp02726 | Dermaseptin-PS3 | ALWKDILKNAGKAALNEINQIVQ | Skin, the waxy monkey tree frog, South America | Membrane rupture | MTT assay | PC3 | Human prostate carcinoma | IC50 : 18.20 μM |
| dbacp05038 | P18 | KWKLFKKIPKFLHLAKKF | Bovine lactoferrin (Lf-B) | Necrosis; Cell membrane rupture | MTT/MTS assay | M14 | Skin cancer | 92.2 ± 1.02% cell viability at 10 µM |
| dbacp05039 | P18 | KWKLFKKIPKFLHLAKKF | Synthetic peptide | Necrosis; Cell membrane rupture | MTT/MTS assay | M14 | Skin cancer | 71.1 ± 2.84% cell viability at 20 µM |
| dbacp05040 | P18 | KWKLFKKIPKFLHLAKKF | Synthetic peptide | Necrosis; Cell membrane rupture | MTT/MTS assay | M14 | Skin cancer | 50 ± 3.09% cell viability at 40 µM |
| dbacp05041 | P18 | KWKLFKKIPKFLHLAKKF | Synthetic peptide | Necrosis; Cell membrane rupture | MTT/MTS assay | M14 | Skin cancer | 31.5 ± 1.49% cell viability at 60 µM |
| dbacp05042 | P18 | KWKLFKKIPKFLHLAKKF | Synthetic peptide | Necrosis; Cell membrane rupture | MTT/MTS assay | M14 | Skin cancer | 13.8 ± 1.44% cell viability at 80 µM |
| dbacp05043 | P18 | KWKLFKKIPKFLHLAKKF | Synthetic peptide | Necrosis; Cell membrane rupture | MTT/MTS assay | A-375 | Skin cancer | 86 ± 0.57% cell viability at 10 µM |
| dbacp05044 | P18 | KWKLFKKIPKFLHLAKKF | Synthetic peptide | Necrosis; Cell membrane rupture | MTT/MTS assay | A-375 | Skin cancer | 63.8 ± 0.8% cell viability at 20 µM |
| dbacp05045 | P18 | KWKLFKKIPKFLHLAKKF | Synthetic peptide | Necrosis; Cell membrane rupture | MTT/MTS assay | A-375 | Skin cancer | 47.5 ± 1.66% cell viability at 40 µM |
| dbacp05046 | P18 | KWKLFKKIPKFLHLAKKF | Synthetic peptide | Necrosis; Cell membrane rupture | MTT/MTS assay | A-375 | Skin cancer | 26.9 ± 0.5% cell viability at 60 µM |
| dbacp05047 | P18 | KWKLFKKIPKFLHLAKKF | Synthetic peptide | Necrosis; Cell membrane rupture | MTT/MTS assay | A-375 | Skin cancer | 6.5 ± 1.07% cell viability at 80 µM |
| dbacp05697 | Psyle A | GIACGESCVFLGCFIPGCSCKSKVCYFN | **Eumachia leptothyrsa**, New Guinea, Philippines, Sulawesi | Necrosis; Cell membrane rupture | Not specified | Not found | Not found | Not found |
| dbacp05698 | Psyle A | GIACGESCVFLGCFIPGCSCKSKVCYFN | **Eumachia leptothyrsa**, New Guinea, Philippines, Sulawesi | Necrosis; Cell membrane rupture | Not specified | Not found | Not found | Not found |
| dbacp05699 | Psyle A | GIACGESCVFLGCFIPGCSCKSKVCYFN | **Eumachia leptothyrsa**, New Guinea, Philippines, Sulawesi | Necrosis; Cell membrane rupture | Not specified | Not found | Not found | Not found |
| dbacp05700 | Psyle C | KLCGETCFKFKCYTPGCSCSYPFCK | **Eumachia leptothyrsa**, New Guinea, Philippines, Sulawesi | Necrosis; Cell membrane rupture | Not specified | Not found | Not found | Not found |
| dbacp05701 | Psyle C | KLCGETCFKFKCYTPGCSCSYPFCK | **Eumachia leptothyrsa**, New Guinea, Philippines, Sulawesi | Necrosis; Cell membrane rupture | Not specified | Not found | Not found | Not found |
| dbacp05702 | Psyle C | KLCGETCFKFKCYTPGCSCSYPFCK | **Eumachia leptothyrsa**, New Guinea, Philippines, Sulawesi | Necrosis; Cell membrane rupture | Not specified | Not found | Not found | Not found |
| dbacp05703 | Psyle E | GVIPCGESCVFIPCISSVLGCSCKNKVCYRD | **Eumachia leptothyrsa**, New Guinea, Philippines, Sulawesi | Necrosis; Cell membrane rupture | Not specified | Not found | Not found | Not found |
| dbacp05704 | Psyle E | GVIPCGESCVFIPCISSVLGCSCKNKVCYRD | **Eumachia leptothyrsa**, New Guinea, Philippines, Sulawesi | Necrosis; Cell membrane rupture | Not specified | Not found | Not found | Not found |
| dbacp05705 | Psyle E | GVIPCGESCVFIPCISSVLGCSCKNKVCYRD | **Eumachia leptothyrsa**, New Guinea, Philippines, Sulawesi | Necrosis; Cell membrane rupture | Not specified | Not found | Not found | Not found |