dbACP: A Comprehensive Database of Anti-Cancer Peptides

10 result(s) have been found!

Accession Name Sequence Source/Organism Mechanism Assay Type Cell Line Cancer Type Activity
dbacp03600 l3,10,13K7,8K4R2L9 KLlRLLkkLlRLlLK Diastereomeric peptide Plasma membrane perturbation; Necrosis XTT assay B16-F10 Skin cancer LC50 : 2.5 µM
dbacp03601 l3,10,13K7,8K4R2L9 KLlRLLkkLlRLlLK Diastereomeric peptide Plasma membrane perturbation; Necrosis XTT assay D-122 Lung cancer LC50 : 4.5 µM
dbacp03602 l3,4,8,10K5L7 KlllKLKlKlLK Diastereomeric peptide Plasma membrane perturbation; Necrosis XTT assay B16-F10 Skin cancer LC50 : 100 µM
dbacp03603 l3,4,8,10K5L7 KLllKLKlKlLK Diastereomeric peptide Plasma membrane perturbation; Necrosis XTT assay D-122 Lung cancer LC50 : >50 µM
dbacp04148 LL 37 [LL-37, 37 aa] Also known human cathelicidin Plasma membrane perturbations MTT/MTS assay MCF-7 Breast cancer LC50 : 21 at 100 µM
dbacp04149 LL 37 [LL-37, 37 aa] Also known human cathelicidin Plasma membrane perturbations MTT/MTS assay LNCaP Prostate cancer LC50 : 27 at 100 µM
dbacp04150 LL 37 [LL-37, 37 aa] Also known human cathelicidin Plasma membrane perturbations MTT/MTS assay OVRCAR-3 Ovarian cancer LC50 : 24 at 100 µM
dbacp05484 Pexiganan GIGKFLKKAKKFGKAFVKILKK Analog of African clawed frog Plasma membrane perturbations MTT/MTS assay MCF-7 Breast cancer LC50 : 8 at 100 µM
dbacp05485 Pexiganan GIGKFLKKAKKFGKAFVKILKK Analog of African clawed frog Plasma membrane perturbations MTT/MTS assay LNCaP Prostate cancer LC50 : 6 at 100 µM
dbacp05486 Pexiganan GIGKFLKKAKKFGKAFVKILKK Analog of African clawed frog Plasma membrane perturbations MTT/MTS assay OVRCAR-3 Ovarian cancer LC50 : 13 at 100 µM