10 result(s) have been found!
| Accession | Name | Sequence | Source/Organism | Mechanism | Assay Type | Cell Line | Cancer Type | Activity |
|---|---|---|---|---|---|---|---|---|
| dbacp03600 | l3,10,13K7,8K4R2L9 | KLlRLLkkLlRLlLK | Diastereomeric peptide | Plasma membrane perturbation; Necrosis | XTT assay | B16-F10 | Skin cancer | LC50 : 2.5 µM |
| dbacp03601 | l3,10,13K7,8K4R2L9 | KLlRLLkkLlRLlLK | Diastereomeric peptide | Plasma membrane perturbation; Necrosis | XTT assay | D-122 | Lung cancer | LC50 : 4.5 µM |
| dbacp03602 | l3,4,8,10K5L7 | KlllKLKlKlLK | Diastereomeric peptide | Plasma membrane perturbation; Necrosis | XTT assay | B16-F10 | Skin cancer | LC50 : 100 µM |
| dbacp03603 | l3,4,8,10K5L7 | KLllKLKlKlLK | Diastereomeric peptide | Plasma membrane perturbation; Necrosis | XTT assay | D-122 | Lung cancer | LC50 : >50 µM |
| dbacp04148 | LL 37 | [LL-37, 37 aa] | Also known human cathelicidin | Plasma membrane perturbations | MTT/MTS assay | MCF-7 | Breast cancer | LC50 : 21 at 100 µM |
| dbacp04149 | LL 37 | [LL-37, 37 aa] | Also known human cathelicidin | Plasma membrane perturbations | MTT/MTS assay | LNCaP | Prostate cancer | LC50 : 27 at 100 µM |
| dbacp04150 | LL 37 | [LL-37, 37 aa] | Also known human cathelicidin | Plasma membrane perturbations | MTT/MTS assay | OVRCAR-3 | Ovarian cancer | LC50 : 24 at 100 µM |
| dbacp05484 | Pexiganan | GIGKFLKKAKKFGKAFVKILKK | Analog of African clawed frog | Plasma membrane perturbations | MTT/MTS assay | MCF-7 | Breast cancer | LC50 : 8 at 100 µM |
| dbacp05485 | Pexiganan | GIGKFLKKAKKFGKAFVKILKK | Analog of African clawed frog | Plasma membrane perturbations | MTT/MTS assay | LNCaP | Prostate cancer | LC50 : 6 at 100 µM |
| dbacp05486 | Pexiganan | GIGKFLKKAKKFGKAFVKILKK | Analog of African clawed frog | Plasma membrane perturbations | MTT/MTS assay | OVRCAR-3 | Ovarian cancer | LC50 : 13 at 100 µM |