dbACP: A Comprehensive Database of Anti-Cancer Peptides

21 result(s) have been found!

Accession Name Sequence Source/Organism Mechanism Assay Type Cell Line Cancer Type Activity
dbacp02357 Cecropin B KWKVFKKIEKMGRNIRNGIVKAGPAIAVLGEAKAL Silkmoth Pore formation at the cytoplasmic membrane MTT/MTS assay K-562 Leukemia cancer IC50 : 15.5 µM
dbacp02358 Cecropin B KWKVFKKIEKMGRNIRNGIVKAGPAIAVLGEAKAL Silkmoth Pore formation at the cytoplasmic membrane MTT/MTS assay BTS-30 Breast cancer IC50 : 24.8 µM
dbacp02359 Cecropin B KWKVFKKIEKMGRNIRNGIVKAGPAIAVLGEAKAL Silkmoth Pore formation at the cytoplasmic membrane MTT/MTS assay HRT-18 Colon cancer IC50 : 25.5 µM
dbacp02360 Cecropin B KWKVFKKIEKMGRNIRNGIVKAGPAIAVLGEAKAL Silkmoth Pore formation at the cytoplasmic membrane MTT/MTS assay DLD-1 Colon cancer IC50 : >100 µM
dbacp02361 Cecropin B KWKVFKKIEKMGRNIRNGIVKAGPAIAVLGEAKAL Silkmoth Pore formation at the cytoplasmic membrane MTT/MTS assay WEHI-3B Leukemia cancer IC50 : 4.4 µM
dbacp02362 Cecropin B KWKVFKKIEKMGRNIRNGIVKAGPAIAVLGEAKAL Silkmoth Pore formation at the cytoplasmic membrane MTT/MTS assay A-2780 Ovarian cancer IC50 : 30.6 µM
dbacp02363 Cecropin B KWKVFKKIEKMGRNIRNGIVKAGPAIAVLGEAKAL Silkmoth Pore formation at the cytoplasmic membrane MTT/MTS assay HCLO Colon cancer IC50 : 33.5 µM
dbacp02364 Cecropin B KWKVFKKIEKMGRNIRNGIVKAGPAIAVLGEAKAL Silkmoth Pore formation at the cytoplasmic membrane MTT/MTS assay CHO-KI Ovarian cancer IC50 : 32 µM
dbacp02365 Cecropin B KWKVFKKIEKMGRNIRNGIVKAGPAIAVLGEAKAL Silkmoth Pore formation at the cytoplasmic membrane MTT/MTS assay MAC15A Colon cancer IC50 : 37 µM
dbacp02366 Cecropin B KWKVFKKIEKMGRNIRNGIVKAGPAIAVLGEAKAL Silkmoth Pore formation at the cytoplasmic membrane MTT/MTS assay MCF-7 Breast cancer IC50 : 42.5 µM
dbacp02367 Cecropin B KWKVFKKIEKMGRNIRNGIVKAGPAIAVLGEAKAL Silkmoth Pore formation at the cytoplasmic membrane MTT/MTS assay HT-29 Colon cancer IC50 : >100 µM
dbacp02368 Cecropin B KWKVFKKIEKMGRNIRNGIVKAGPAIAVLGEAKAL Silkmoth Pore formation at the cytoplasmic membrane MTT/MTS assay A-2780R Ovarian cancer IC50 : 34.5 µM
dbacp02369 Cecropin B KWKVFKKIEKMGRNIRNGIVKAGPAIAVLGEAKAL Silkmoth Pore formation at the cytoplasmic membrane MTT/MTS assay MCF-7R Breast cancer IC50 : 24.5 µM
dbacp02371 Cecropin P1 SWLSKTAKKLENSAKKRISEGIAIAIQGGPR Small Intestine of Pig Pore formation at the cytoplasmic membrane MTT/MTS assay K-562 Leukemia cancer IC50 : 93 µM
dbacp02372 Cecropin P1 SWLSKTAKKLENSAKKRISEGIAIAIQGGPR Small Intestine of Pig Pore formation at the cytoplasmic membrane MTT/MTS assay BTS-30 Breast cancer IC50 : >100 µM
dbacp02373 Cecropin P1 SWLSKTAKKLENSAKKRISEGIAIAIQGGPR Small Intestine of Pig Pore formation at the cytoplasmic membrane MTT/MTS assay HRT-18 Colon cancer IC50 : >100 µM
dbacp02374 Cecropin P1 SWLSKTAKKLENSAKKRISEGIAIAIQGGPR Small Intestine of Pig Pore formation at the cytoplasmic membrane MTT/MTS assay DLD-1 Colon cancer IC50 : >100 µM
dbacp06075 Shiva-1 MPRWRLFRRIDRVGKQIKQGILRAGPAIALVGDARAVG African clawed frog Pore formation at the cytoplasmic membrane MTT/MTS assay K-562 Leukemia cancer IC50 : 28.7 µM
dbacp06076 Shiva-1 MPRWRLFRRIDRVGKQIKQGILRAGPAIALVGDARAVG African clawed frog Pore formation at the cytoplasmic membrane MTT/MTS assay BTS-30 Breast cancer IC50 : 56 µM
dbacp06077 Shiva-1 MPRWRLFRRIDRVGKQIKQGILRAGPAIALVGDARAVG African clawed frog Pore formation at the cytoplasmic membrane MTT/MTS assay HRT-18 Colon cancer IC50 : 49.3 µM
dbacp06078 Shiva-1 MPRWRLFRRIDRVGKQIKQGILRAGPAIALVGDARAVG African clawed frog Pore formation at the cytoplasmic membrane MTT/MTS assay DLD-1 Colon cancer IC50 : >100 µM