21 result(s) have been found!
| Accession | Name | Sequence | Source/Organism | Mechanism | Assay Type | Cell Line | Cancer Type | Activity |
|---|---|---|---|---|---|---|---|---|
| dbacp02357 | Cecropin B | KWKVFKKIEKMGRNIRNGIVKAGPAIAVLGEAKAL | Silkmoth | Pore formation at the cytoplasmic membrane | MTT/MTS assay | K-562 | Leukemia cancer | IC50 : 15.5 µM |
| dbacp02358 | Cecropin B | KWKVFKKIEKMGRNIRNGIVKAGPAIAVLGEAKAL | Silkmoth | Pore formation at the cytoplasmic membrane | MTT/MTS assay | BTS-30 | Breast cancer | IC50 : 24.8 µM |
| dbacp02359 | Cecropin B | KWKVFKKIEKMGRNIRNGIVKAGPAIAVLGEAKAL | Silkmoth | Pore formation at the cytoplasmic membrane | MTT/MTS assay | HRT-18 | Colon cancer | IC50 : 25.5 µM |
| dbacp02360 | Cecropin B | KWKVFKKIEKMGRNIRNGIVKAGPAIAVLGEAKAL | Silkmoth | Pore formation at the cytoplasmic membrane | MTT/MTS assay | DLD-1 | Colon cancer | IC50 : >100 µM |
| dbacp02361 | Cecropin B | KWKVFKKIEKMGRNIRNGIVKAGPAIAVLGEAKAL | Silkmoth | Pore formation at the cytoplasmic membrane | MTT/MTS assay | WEHI-3B | Leukemia cancer | IC50 : 4.4 µM |
| dbacp02362 | Cecropin B | KWKVFKKIEKMGRNIRNGIVKAGPAIAVLGEAKAL | Silkmoth | Pore formation at the cytoplasmic membrane | MTT/MTS assay | A-2780 | Ovarian cancer | IC50 : 30.6 µM |
| dbacp02363 | Cecropin B | KWKVFKKIEKMGRNIRNGIVKAGPAIAVLGEAKAL | Silkmoth | Pore formation at the cytoplasmic membrane | MTT/MTS assay | HCLO | Colon cancer | IC50 : 33.5 µM |
| dbacp02364 | Cecropin B | KWKVFKKIEKMGRNIRNGIVKAGPAIAVLGEAKAL | Silkmoth | Pore formation at the cytoplasmic membrane | MTT/MTS assay | CHO-KI | Ovarian cancer | IC50 : 32 µM |
| dbacp02365 | Cecropin B | KWKVFKKIEKMGRNIRNGIVKAGPAIAVLGEAKAL | Silkmoth | Pore formation at the cytoplasmic membrane | MTT/MTS assay | MAC15A | Colon cancer | IC50 : 37 µM |
| dbacp02366 | Cecropin B | KWKVFKKIEKMGRNIRNGIVKAGPAIAVLGEAKAL | Silkmoth | Pore formation at the cytoplasmic membrane | MTT/MTS assay | MCF-7 | Breast cancer | IC50 : 42.5 µM |
| dbacp02367 | Cecropin B | KWKVFKKIEKMGRNIRNGIVKAGPAIAVLGEAKAL | Silkmoth | Pore formation at the cytoplasmic membrane | MTT/MTS assay | HT-29 | Colon cancer | IC50 : >100 µM |
| dbacp02368 | Cecropin B | KWKVFKKIEKMGRNIRNGIVKAGPAIAVLGEAKAL | Silkmoth | Pore formation at the cytoplasmic membrane | MTT/MTS assay | A-2780R | Ovarian cancer | IC50 : 34.5 µM |
| dbacp02369 | Cecropin B | KWKVFKKIEKMGRNIRNGIVKAGPAIAVLGEAKAL | Silkmoth | Pore formation at the cytoplasmic membrane | MTT/MTS assay | MCF-7R | Breast cancer | IC50 : 24.5 µM |
| dbacp02371 | Cecropin P1 | SWLSKTAKKLENSAKKRISEGIAIAIQGGPR | Small Intestine of Pig | Pore formation at the cytoplasmic membrane | MTT/MTS assay | K-562 | Leukemia cancer | IC50 : 93 µM |
| dbacp02372 | Cecropin P1 | SWLSKTAKKLENSAKKRISEGIAIAIQGGPR | Small Intestine of Pig | Pore formation at the cytoplasmic membrane | MTT/MTS assay | BTS-30 | Breast cancer | IC50 : >100 µM |
| dbacp02373 | Cecropin P1 | SWLSKTAKKLENSAKKRISEGIAIAIQGGPR | Small Intestine of Pig | Pore formation at the cytoplasmic membrane | MTT/MTS assay | HRT-18 | Colon cancer | IC50 : >100 µM |
| dbacp02374 | Cecropin P1 | SWLSKTAKKLENSAKKRISEGIAIAIQGGPR | Small Intestine of Pig | Pore formation at the cytoplasmic membrane | MTT/MTS assay | DLD-1 | Colon cancer | IC50 : >100 µM |
| dbacp06075 | Shiva-1 | MPRWRLFRRIDRVGKQIKQGILRAGPAIALVGDARAVG | African clawed frog | Pore formation at the cytoplasmic membrane | MTT/MTS assay | K-562 | Leukemia cancer | IC50 : 28.7 µM |
| dbacp06076 | Shiva-1 | MPRWRLFRRIDRVGKQIKQGILRAGPAIALVGDARAVG | African clawed frog | Pore formation at the cytoplasmic membrane | MTT/MTS assay | BTS-30 | Breast cancer | IC50 : 56 µM |
| dbacp06077 | Shiva-1 | MPRWRLFRRIDRVGKQIKQGILRAGPAIALVGDARAVG | African clawed frog | Pore formation at the cytoplasmic membrane | MTT/MTS assay | HRT-18 | Colon cancer | IC50 : 49.3 µM |
| dbacp06078 | Shiva-1 | MPRWRLFRRIDRVGKQIKQGILRAGPAIALVGDARAVG | African clawed frog | Pore formation at the cytoplasmic membrane | MTT/MTS assay | DLD-1 | Colon cancer | IC50 : >100 µM |