17 result(s) have been found!
| Accession | Name | Sequence | Source/Organism | Mechanism | Assay Type | Cell Line | Cancer Type | Activity |
|---|---|---|---|---|---|---|---|---|
| dbacp02229 | CA-MA | KWKLFKKIGIGKFLHSAKKF | Ceropin-Melittin hybrid | Membrane disruptive mode of action | MTT/MTS assay | SNU-601 | Gastric cancer | Activity : ~80% survival rate at 10 µM |
| dbacp02230 | CA-MA | KWKLFKKIGIGKFLHSAKKF | Ceropin-Melittin hybrid | Membrane disruptive mode of action | MTT/MTS assay | SNU-601 | Gastric cancer | Activity : 10% survival rate at 100 µM |
| dbacp02641 | Defensin coprisin | MAKLIAFALVASLCLSMVLCNPLPEEVQEEGLVRQKRVTCDVLSFEAKGIAVNHSACALHCIALRKKGGSCQNGVCVCRN | Dung beetle | Induces apoptosis and necrosis | Radial diffusion assay, MIC assay | SNU-601 | Gastric cancer | MIC : ≤ 50 μM |
| dbacp05249 | Pep27 | MRKEFHNVLSSGQLLADKRPARDYNRK | Pneumococcus | Apoptosis inducing | MTT/MTS assay | SNU-601 | Gastric cancer | IC50 : > 70 µM |
| dbacp05254 | Pep27 | MRKEFHNVLSSGQLLADKRPARDYNRK | Not found | Inducing apoptosis | MTT assay | SNU-601 | Gastric cancer | IC50 : > 70 µM |
| dbacp05260 | Pep27 anal1 | MWKWFHNVLSSWQLLADKRPARDYNRK | Not found | Inducing apoptosis | MTT assay | SNU-601 | Gastric cancer | IC50 : 37 µM |
| dbacp05265 | Pep27 anal2 | MWKWFHNVLSWWWLLADKRPARDYNRK | Not found | Inducing apoptosis | MTT assay | SNU-601 | Gastric cancer | IC50 : 25 µM |
| dbacp05270 | Pep27 anal3 | MRKWFHNVLSSGQLLADKWPAWDYNRK | Not found | Inducing apoptosis | MTT assay | SNU-601 | Gastric cancer | IC50 : 50 µM |
| dbacp05275 | Pep27 anal4 | MWKEFHNVLSSGQLLADKRWARWYNRW | Not found | Inducing apoptosis | MTT assay | SNU-601 | Gastric cancer | IC50 : 46 µM |
| dbacp05280 | Pep27 anal5 | MWKWFHNVLSSGQLLADKWWAWWYNWW | Not found | Inducing apoptosis | MTT assay | SNU-601 | Gastric cancer | IC50 : > 70 µM |
| dbacp05285 | Pep27anal1 | MWKWFHNVLSSWQLLADKRPARDYNRK | Pneumococcus | Apoptosis inducing | MTT/MTS assay | SNU-601 | Gastric cancer | IC50 : 37 µM |
| dbacp05290 | Pep27anal2 | MWKWFHNVLSWWWLLADKRPARDYNRK | Pneumococcus | Apoptosis inducing | MTT/MTS assay | SNU-601 | Gastric cancer | IC50 : 25 µM |
| dbacp05295 | Pep27anal3 | MRKWFHNVLSSGQLLADKWPAWDYNRK | Pneumococcus | Apoptosis inducing | MTT/MTS assay | SNU-601 | Gastric cancer | IC50 : 50 µM |
| dbacp05300 | Pep27anal4 | MWKEFHNVLSSGQLLADKRWARWYNRW | Pneumococcus | Apoptosis inducing | MTT/MTS assay | SNU-601 | Gastric cancer | IC50 : 37 µM |
| dbacp05305 | Pep27anal5 | MWKWFHNVLSSGQLLADKWWAWWYNWW | Pneumococcus | Apoptosis inducing | MTT/MTS assay | SNU-601 | Gastric cancer | IC50 : >70 µM |
| dbacp06181 | Synthetic peptide | KWKKLLKKPPPLLKKLLKKL | Synthetic peptide | Not specified | MTT/MTS assay | SNU-601 | Gastric cancer | ~20% survival rate at 10 µM |
| dbacp06182 | Synthetic peptide | KWKKLLKKPPPLLKKLLKKL | Synthetic peptide | Not specified | MTT/MTS assay | SNU-601 | Gastric cancer | 0% survival rate at 100 µM |