dbACP: A Comprehensive Database of Anti-Cancer Peptides

17 result(s) have been found!

Accession Name Sequence Source/Organism Mechanism Assay Type Cell Line Cancer Type Activity
dbacp02229 CA-MA KWKLFKKIGIGKFLHSAKKF Ceropin-Melittin hybrid Membrane disruptive mode of action MTT/MTS assay SNU-601 Gastric cancer Activity : ~80% survival rate at 10 µM
dbacp02230 CA-MA KWKLFKKIGIGKFLHSAKKF Ceropin-Melittin hybrid Membrane disruptive mode of action MTT/MTS assay SNU-601 Gastric cancer Activity : 10% survival rate at 100 µM
dbacp02641 Defensin coprisin MAKLIAFALVASLCLSMVLCNPLPEEVQEEGLVRQKRVTCDVLSFEAKGIAVNHSACALHCIALRKKGGSCQNGVCVCRN Dung beetle Induces apoptosis and necrosis Radial diffusion assay, MIC assay SNU-601 Gastric cancer MIC : ≤ 50 μM
dbacp05249 Pep27 MRKEFHNVLSSGQLLADKRPARDYNRK Pneumococcus Apoptosis inducing MTT/MTS assay SNU-601 Gastric cancer IC50 : > 70 µM
dbacp05254 Pep27 MRKEFHNVLSSGQLLADKRPARDYNRK Not found Inducing apoptosis MTT assay SNU-601 Gastric cancer IC50 : > 70 µM
dbacp05260 Pep27 anal1 MWKWFHNVLSSWQLLADKRPARDYNRK Not found Inducing apoptosis MTT assay SNU-601 Gastric cancer IC50 : 37 µM
dbacp05265 Pep27 anal2 MWKWFHNVLSWWWLLADKRPARDYNRK Not found Inducing apoptosis MTT assay SNU-601 Gastric cancer IC50 : 25 µM
dbacp05270 Pep27 anal3 MRKWFHNVLSSGQLLADKWPAWDYNRK Not found Inducing apoptosis MTT assay SNU-601 Gastric cancer IC50 : 50 µM
dbacp05275 Pep27 anal4 MWKEFHNVLSSGQLLADKRWARWYNRW Not found Inducing apoptosis MTT assay SNU-601 Gastric cancer IC50 : 46 µM
dbacp05280 Pep27 anal5 MWKWFHNVLSSGQLLADKWWAWWYNWW Not found Inducing apoptosis MTT assay SNU-601 Gastric cancer IC50 : > 70 µM
dbacp05285 Pep27anal1 MWKWFHNVLSSWQLLADKRPARDYNRK Pneumococcus Apoptosis inducing MTT/MTS assay SNU-601 Gastric cancer IC50 : 37 µM
dbacp05290 Pep27anal2 MWKWFHNVLSWWWLLADKRPARDYNRK Pneumococcus Apoptosis inducing MTT/MTS assay SNU-601 Gastric cancer IC50 : 25 µM
dbacp05295 Pep27anal3 MRKWFHNVLSSGQLLADKWPAWDYNRK Pneumococcus Apoptosis inducing MTT/MTS assay SNU-601 Gastric cancer IC50 : 50 µM
dbacp05300 Pep27anal4 MWKEFHNVLSSGQLLADKRWARWYNRW Pneumococcus Apoptosis inducing MTT/MTS assay SNU-601 Gastric cancer IC50 : 37 µM
dbacp05305 Pep27anal5 MWKWFHNVLSSGQLLADKWWAWWYNWW Pneumococcus Apoptosis inducing MTT/MTS assay SNU-601 Gastric cancer IC50 : >70 µM
dbacp06181 Synthetic peptide KWKKLLKKPPPLLKKLLKKL Synthetic peptide Not specified MTT/MTS assay SNU-601 Gastric cancer ~20% survival rate at 10 µM
dbacp06182 Synthetic peptide KWKKLLKKPPPLLKKLLKKL Synthetic peptide Not specified MTT/MTS assay SNU-601 Gastric cancer 0% survival rate at 100 µM