57 result(s) have been found!
| Accession | Name | Sequence | Source/Organism | Mechanism | Assay Type | Cell Line | Cancer Type | Activity |
|---|---|---|---|---|---|---|---|---|
| dbacp02326 | Cecropin A | KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK | Silkmoth | Membrane disruption | WST-1 assay | 486P | Bladder cancer | IC50 : 251.47 µg/ml |
| dbacp02327 | Cecropin A | KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK | Silkmoth | Membrane disruption | WST-1 assay | RT4 | Bladder cancer | IC50 : 231.26 µg/ml |
| dbacp02328 | Cecropin A | KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK | Silkmoth | Membrane disruption | WST-1 assay | 647V | Bladder cancer | IC50 : 185.39 µg/ml |
| dbacp02329 | Cecropin A | KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK | Silkmoth | Membrane disruption | WST-1 assay | J82 | Bladder cancer | IC50 : 212.07 µg/ml |
| dbacp02330 | Cecropin A | KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK | Silkmoth | Membrane disruption | Cell viability assay | 486P | Bladder cancer | IC50 : 69.2 µg/ml |
| dbacp02331 | Cecropin A | KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK | Silkmoth | Membrane disruption | Cell viability assay | RT4 | Bladder cancer | IC50 : 96.22 µg/ml |
| dbacp02332 | Cecropin A | KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK | Silkmoth | Membrane disruption | Cell viability assay | 647V | Bladder cancer | IC50 : 28.74 µg/ml |
| dbacp02333 | Cecropin A | KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK | Silkmoth | Membrane disruption | Cell viability assay | J82 | Bladder cancer | IC50 : 99.01 µg/ml |
| dbacp02334 | Cecropin A | KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK | Silkmoth | Membrane disruption | LDH leakage assay | 486P | Bladder cancer | IC50 : 373.3/ µg/ml |
| dbacp02335 | Cecropin A | KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK | Silkmoth | Membrane disruption | LDH leakage assay | RT4 | Bladder cancer | IC50 : 289.3 µg/ml |
| dbacp02336 | Cecropin A | KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK | Silkmoth | Membrane disruption | LDH leakage assay | 647V | Bladder cancer | IC50 : 200.7 µg/ml |
| dbacp02337 | Cecropin A | KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK | Silkmoth | Membrane disruption | LDH leakage assay | J82 | Bladder cancer | IC50 : 319.2 µg/ml |
| dbacp02345 | Cecropin B | KWKIFKKIEKVGRNIRNGIIKAGPAVAVLGEAKAL | Chinese oak silk moth | Membrane disruption | WST-1 assay | 486P | Bladder cancer | IC50 : 161.76 µg/ml |
| dbacp02346 | Cecropin B | KWKIFKKIEKVGRNIRNGIIKAGPAVAVLGEAKAL | Chinese oak silk moth | Membrane disruption | WST-1 assay | RT4 | Bladder cancer | IC50 : 184.81 µg/ml |
| dbacp02347 | Cecropin B | KWKIFKKIEKVGRNIRNGIIKAGPAVAVLGEAKAL | Chinese oak silk moth | Membrane disruption | WST-1 assay | 647V | Bladder cancer | IC50 : 115.12 µg/ml |
| dbacp02348 | Cecropin B | KWKIFKKIEKVGRNIRNGIIKAGPAVAVLGEAKAL | Chinese oak silk moth | Membrane disruption | WST-1 assay | J82 | Bladder cancer | IC50 : 97.93 µg/ml |
| dbacp02349 | Cecropin B | KWKIFKKIEKVGRNIRNGIIKAGPAVAVLGEAKAL | Chinese oak silk moth | Membrane disruption | Cell viability assay | 486P | Bladder cancer | IC50 : 87.47 µg/ml |
| dbacp02350 | Cecropin B | KWKIFKKIEKVGRNIRNGIIKAGPAVAVLGEAKAL | Chinese oak silk moth | Membrane disruption | Cell viability assay | RT4 | Bladder cancer | IC50 : 92.9 µg/ml |
| dbacp02351 | Cecropin B | KWKIFKKIEKVGRNIRNGIIKAGPAVAVLGEAKAL | Chinese oak silk moth | Membrane disruption | Cell viability assay | 647V | Bladder cancer | IC50 : 61.86 µg/ml |
| dbacp02352 | Cecropin B | KWKIFKKIEKVGRNIRNGIIKAGPAVAVLGEAKAL | Chinese oak silk moth | Membrane disruption | Cell viability assay | J82 | Bladder cancer | IC50 : 77.51 µg/ml |
| dbacp02353 | Cecropin B | KWKIFKKIEKVGRNIRNGIIKAGPAVAVLGEAKAL | Chinese oak silk moth | Membrane disruption | LDH leakage assay | 486P | Bladder cancer | IC50 : 232.4 µg/ml |
| dbacp02354 | Cecropin B | KWKIFKKIEKVGRNIRNGIIKAGPAVAVLGEAKAL | Chinese oak silk moth | Membrane disruption | LDH leakage assay | RT4 | Bladder cancer | IC50 : 240.4 µg/ml |
| dbacp02355 | Cecropin B | KWKIFKKIEKVGRNIRNGIIKAGPAVAVLGEAKAL | Chinese oak silk moth | Membrane disruption | LDH leakage assay | 647V | Bladder cancer | IC50 : 181.1 µg/ml |
| dbacp02356 | Cecropin B | KWKIFKKIEKVGRNIRNGIIKAGPAVAVLGEAKAL | Chinese oak silk moth | Membrane disruption | LDH leakage assay | J82 | Bladder cancer | Cytotoxicity : 196.3 µg/ml |
| dbacp02468 | ChBac3.4 | RFRLPFRRPPIRIHPPPFYPPFRRFL | Goat | Cell necrosis; Inhibiting processes of protein synthesis; Damaging the mitochondrial membrane | TUNEL assay, Reactive oxygen intermediates (ROS) assay | Not specified | Bladder cancer | Not found |
| dbacp04320 | LvHemB1 | DVNFLLHKIYGNIRY | Marine invertebrates | Inducing apoptosis | MTT assay | HeLa | Bladder cancer | Not found |
| dbacp04324 | LvHemB1 | DVNFLLHKIYGNIRY | Marine invertebrates | Inducing apoptosis | MTT assay | EC109 | Bladder cancer | Not found |
| dbacp04328 | LvHemB1 | DVNFLLHKIYGNIRY | Marine invertebrates | Inducing apoptosis | MTT assay | HepG2 | Bladder cancer | Not found |
| dbacp04332 | LvHemB1 | DVNFLLHKIYGNIRY | Marine invertebrates | Inducing apoptosis | MTT assay | EJ | Bladder cancer | Not found |
| dbacp04336 | LvHemB1 | DVNFLLHKIYGNIRY | Marine invertebrates | Inducing apoptosis | MTT assay | THLE-3 | Bladder cancer | Not found |
| dbacp04477 | Magainin 2 | GIGKFLHSAKKFGKAFVGEIMNS | African clawed frog | Membrane perforation | LDH leakage assay | RT4(G1) | Bladder cancer | IC50 : 32.3 µM |
| dbacp04478 | Magainin 2 | GIGKFLHSAKKFGKAFVGEIMNS | African clawed frog | Membrane perforation | LDH leakage assay | 647V(G2) | Bladder cancer | IC50 : 54.1 µM |
| dbacp04479 | Magainin 2 | GIGKFLHSAKKFGKAFVGEIMNS | African clawed frog | Membrane perforation | LDH leakage assay | 486P(G4) | Bladder cancer | IC50 : 28.6 µM |
| dbacp04480 | Magainin 2 | GIGKFLHSAKKFGKAFVGEIMNS | African clawed frog | Membrane perforation | WST-1 assay | RT4(G1) | Bladder cancer | IC50 : 484 µM |
| dbacp04481 | Magainin 2 | GIGKFLHSAKKFGKAFVGEIMNS | African clawed frog | Membrane perforation | WST-1 assay | 647V(G2) | Bladder cancer | IC50 : 52.4 µM |
| dbacp04482 | Magainin 2 | GIGKFLHSAKKFGKAFVGEIMNS | African clawed frog | Membrane perforation | WST-1 assay | 486P(G4) | Bladder cancer | IC50 : 57.8 µM |
| dbacp04483 | Magainin 2 | GIGKFLHSAKKFGKAFVGEIMNS | African clawed frog | Membrane perforation | Cell viability assay | RT4(G1) | Bladder cancer | IC50 : 135.3 µM |
| dbacp04484 | Magainin 2 | GIGKFLHSAKKFGKAFVGEIMNS | African clawed frog | Membrane perforation | Cell viability assay | 647V(G2) | Bladder cancer | IC50 : 31 µM |
| dbacp04485 | Magainin 2 | GIGKFLHSAKKFGKAFVGEIMNS | African clawed frog | Membrane perforation | Cell viability assay | 486P(G4) | Bladder cancer | IC50 : 59.4 µM |
| dbacp04497 | Magainin 2 | GIGKFLHSAKKFGKAFVGEIMNS | Yunnan firebelly toad | Membrane perforation | Cell viability assay | 486P(G4) | Bladder cancer | IC50 : 59.4 µM |
| dbacp04603 | Maximin H1 | ILGPVISTIGGVLGGLLKNL | Yunnan firebelly toad, China, Asia | Not specified | MTT assay | C8166 | Bladder cancer | Not found |
| dbacp04604 | Maximin H1 | ILGPVISTIGGVLGGLLKNL | Yunnan firebelly toad, China, Asia | Not specified | MTT assay | BIU-87 | Bladder cancer | Not found |
| dbacp04605 | Maximin H1 | ILGPVISTIGGVLGGLLKNL | Yunnan firebelly toad, China, Asia | Not specified | MTT assay | T27 | Bladder cancer | Not found |
| dbacp04609 | Maximin1 | GIGTKILGGVKTALKGALKELASTYAN | Yunnan firebelly toad | Not specified | MTT/MTS assay | BIU-87 | Bladder cancer | IC50 : 20.5 µg/ml |
| dbacp04610 | Maximin1 | GIGTKILGGVKTALKGALKELASTYAN | Yunnan firebelly toad | Not specified | MTT/MTS assay | T-24 | Bladder cancer | IC50 : 35.4 µg/ml |
| dbacp04613 | Maximin3 | GIGGKILSGLKTALKGAAKELASTYLH | Yunnan firebelly toad | Not specified | MTT/MTS assay | BIU-87 | Bladder cancer | IC50 : 28 µg/ml |
| dbacp04614 | Maximin3 | GIGGKILSGLKTALKGAAKELASTYLH | Yunnan firebelly toad | Not specified | MTT/MTS assay | T-24 | Bladder cancer | IC50 : 18 µg/ml |
| dbacp04617 | Maximin4 | GIGVLLSAGKAALKGLAKVLAEKYAN | Yunnan firebelly toad | Not specified | MTT/MTS assay | BIU-87 | Bladder cancer | IC50 : >50 µg/ml |
| dbacp04618 | Maximin4 | GIGVLLSAGKAALKGLAKVLAEKYAN | Yunnan firebelly toad | Not specified | MTT/MTS assay | T-24 | Bladder cancer | IC50 : >50 µg/ml |
| dbacp04621 | Maximin5 | SIGAKILGGVKTFFKGALKELASTYLQ | Yunnan firebelly toad | Not specified | MTT/MTS assay | BIU-87 | Bladder cancer | IC50 : >50 µg/ml |
| dbacp04622 | Maximin5 | SIGAKILGGVKTFFKGALKELASTYLQ | Yunnan firebelly toad | Not specified | MTT/MTS assay | T-24 | Bladder cancer | IC50 : >50 µg/ml |
| dbacp05588 | Polyarginine (R11) | RRRRRRRRRRR | Not found | Not specified | Not specified | T24, 5637, RT4 | Bladder cancer | Not found |
| dbacp06764 | M1-21 | rrrqrrkkrg-QTQPRLGPPQTPAGGCSILIF | Synthetic | FOXM1 inhibitor | Cell Viability assay | 5637 | Bladder cancer | IC50 = 9.33 µM |
| dbacp07104 | rScyreprocin | MKEDSNILDKTAKMTKQNKALLFTAGGAAAFMAGYYYYHCNYRNPAPKKSGSTTSQDKTDAQAVQSIPSPSGNKGKESKDPKVKHHHHHH | Recombinant product of Scyreprocin | Membrane disruption triggers ROS-mediated apoptosis | MTS assay | T-24 | Urinary Bladder Cancer | IC50 = 1.94 x 105 µM |
| dbacp07407 | LvHemB1 | DVNFLLHKIYGNIRY | hemocyanin of Litopenaeus vannamei | Mitochondrial targeting induces apoptosis | MTS assay | EJ | Bladder Cancer | 89.6% apoptotic cells at 50 μg/mL |
| dbacp07848 | Carnosine | (Beta-A)H | Muscular and Nervous tissues of vertebrates | Inhibits VEGFR-2 angiogenic signaling | MTT assay | MGH-U1 (EJ) | Bladder Cancer | IC50 = 50 mM |
| dbacp08310 | DAP1 | LWKRWVGVWRKWL | Synthetic | Not Available | MTT assay | T-24 | Bladder Cancer | IC50 = 15.3 μM |