dbACP: A Comprehensive Database of Anti-Cancer Peptides

57 result(s) have been found!

Accession Name Sequence Source/Organism Mechanism Assay Type Cell Line Cancer Type Activity
dbacp02326 Cecropin A KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK Silkmoth Membrane disruption WST-1 assay 486P Bladder cancer IC50 : 251.47 µg/ml
dbacp02327 Cecropin A KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK Silkmoth Membrane disruption WST-1 assay RT4 Bladder cancer IC50 : 231.26 µg/ml
dbacp02328 Cecropin A KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK Silkmoth Membrane disruption WST-1 assay 647V Bladder cancer IC50 : 185.39 µg/ml
dbacp02329 Cecropin A KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK Silkmoth Membrane disruption WST-1 assay J82 Bladder cancer IC50 : 212.07 µg/ml
dbacp02330 Cecropin A KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK Silkmoth Membrane disruption Cell viability assay 486P Bladder cancer IC50 : 69.2 µg/ml
dbacp02331 Cecropin A KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK Silkmoth Membrane disruption Cell viability assay RT4 Bladder cancer IC50 : 96.22 µg/ml
dbacp02332 Cecropin A KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK Silkmoth Membrane disruption Cell viability assay 647V Bladder cancer IC50 : 28.74 µg/ml
dbacp02333 Cecropin A KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK Silkmoth Membrane disruption Cell viability assay J82 Bladder cancer IC50 : 99.01 µg/ml
dbacp02334 Cecropin A KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK Silkmoth Membrane disruption LDH leakage assay 486P Bladder cancer IC50 : 373.3/ µg/ml
dbacp02335 Cecropin A KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK Silkmoth Membrane disruption LDH leakage assay RT4 Bladder cancer IC50 : 289.3 µg/ml
dbacp02336 Cecropin A KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK Silkmoth Membrane disruption LDH leakage assay 647V Bladder cancer IC50 : 200.7 µg/ml
dbacp02337 Cecropin A KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK Silkmoth Membrane disruption LDH leakage assay J82 Bladder cancer IC50 : 319.2 µg/ml
dbacp02345 Cecropin B KWKIFKKIEKVGRNIRNGIIKAGPAVAVLGEAKAL Chinese oak silk moth Membrane disruption WST-1 assay 486P Bladder cancer IC50 : 161.76 µg/ml
dbacp02346 Cecropin B KWKIFKKIEKVGRNIRNGIIKAGPAVAVLGEAKAL Chinese oak silk moth Membrane disruption WST-1 assay RT4 Bladder cancer IC50 : 184.81 µg/ml
dbacp02347 Cecropin B KWKIFKKIEKVGRNIRNGIIKAGPAVAVLGEAKAL Chinese oak silk moth Membrane disruption WST-1 assay 647V Bladder cancer IC50 : 115.12 µg/ml
dbacp02348 Cecropin B KWKIFKKIEKVGRNIRNGIIKAGPAVAVLGEAKAL Chinese oak silk moth Membrane disruption WST-1 assay J82 Bladder cancer IC50 : 97.93 µg/ml
dbacp02349 Cecropin B KWKIFKKIEKVGRNIRNGIIKAGPAVAVLGEAKAL Chinese oak silk moth Membrane disruption Cell viability assay 486P Bladder cancer IC50 : 87.47 µg/ml
dbacp02350 Cecropin B KWKIFKKIEKVGRNIRNGIIKAGPAVAVLGEAKAL Chinese oak silk moth Membrane disruption Cell viability assay RT4 Bladder cancer IC50 : 92.9 µg/ml
dbacp02351 Cecropin B KWKIFKKIEKVGRNIRNGIIKAGPAVAVLGEAKAL Chinese oak silk moth Membrane disruption Cell viability assay 647V Bladder cancer IC50 : 61.86 µg/ml
dbacp02352 Cecropin B KWKIFKKIEKVGRNIRNGIIKAGPAVAVLGEAKAL Chinese oak silk moth Membrane disruption Cell viability assay J82 Bladder cancer IC50 : 77.51 µg/ml
dbacp02353 Cecropin B KWKIFKKIEKVGRNIRNGIIKAGPAVAVLGEAKAL Chinese oak silk moth Membrane disruption LDH leakage assay 486P Bladder cancer IC50 : 232.4 µg/ml
dbacp02354 Cecropin B KWKIFKKIEKVGRNIRNGIIKAGPAVAVLGEAKAL Chinese oak silk moth Membrane disruption LDH leakage assay RT4 Bladder cancer IC50 : 240.4 µg/ml
dbacp02355 Cecropin B KWKIFKKIEKVGRNIRNGIIKAGPAVAVLGEAKAL Chinese oak silk moth Membrane disruption LDH leakage assay 647V Bladder cancer IC50 : 181.1 µg/ml
dbacp02356 Cecropin B KWKIFKKIEKVGRNIRNGIIKAGPAVAVLGEAKAL Chinese oak silk moth Membrane disruption LDH leakage assay J82 Bladder cancer Cytotoxicity : 196.3 µg/ml
dbacp02468 ChBac3.4 RFRLPFRRPPIRIHPPPFYPPFRRFL Goat Cell necrosis; Inhibiting processes of protein synthesis; Damaging the mitochondrial membrane TUNEL assay, Reactive oxygen intermediates (ROS) assay Not specified Bladder cancer Not found
dbacp04320 LvHemB1 DVNFLLHKIYGNIRY Marine invertebrates Inducing apoptosis MTT assay HeLa Bladder cancer Not found
dbacp04324 LvHemB1 DVNFLLHKIYGNIRY Marine invertebrates Inducing apoptosis MTT assay EC109 Bladder cancer Not found
dbacp04328 LvHemB1 DVNFLLHKIYGNIRY Marine invertebrates Inducing apoptosis MTT assay HepG2 Bladder cancer Not found
dbacp04332 LvHemB1 DVNFLLHKIYGNIRY Marine invertebrates Inducing apoptosis MTT assay EJ Bladder cancer Not found
dbacp04336 LvHemB1 DVNFLLHKIYGNIRY Marine invertebrates Inducing apoptosis MTT assay THLE-3 Bladder cancer Not found
dbacp04477 Magainin 2 GIGKFLHSAKKFGKAFVGEIMNS African clawed frog Membrane perforation LDH leakage assay RT4(G1) Bladder cancer IC50 : 32.3 µM
dbacp04478 Magainin 2 GIGKFLHSAKKFGKAFVGEIMNS African clawed frog Membrane perforation LDH leakage assay 647V(G2) Bladder cancer IC50 : 54.1 µM
dbacp04479 Magainin 2 GIGKFLHSAKKFGKAFVGEIMNS African clawed frog Membrane perforation LDH leakage assay 486P(G4) Bladder cancer IC50 : 28.6 µM
dbacp04480 Magainin 2 GIGKFLHSAKKFGKAFVGEIMNS African clawed frog Membrane perforation WST-1 assay RT4(G1) Bladder cancer IC50 : 484 µM
dbacp04481 Magainin 2 GIGKFLHSAKKFGKAFVGEIMNS African clawed frog Membrane perforation WST-1 assay 647V(G2) Bladder cancer IC50 : 52.4 µM
dbacp04482 Magainin 2 GIGKFLHSAKKFGKAFVGEIMNS African clawed frog Membrane perforation WST-1 assay 486P(G4) Bladder cancer IC50 : 57.8 µM
dbacp04483 Magainin 2 GIGKFLHSAKKFGKAFVGEIMNS African clawed frog Membrane perforation Cell viability assay RT4(G1) Bladder cancer IC50 : 135.3 µM
dbacp04484 Magainin 2 GIGKFLHSAKKFGKAFVGEIMNS African clawed frog Membrane perforation Cell viability assay 647V(G2) Bladder cancer IC50 : 31 µM
dbacp04485 Magainin 2 GIGKFLHSAKKFGKAFVGEIMNS African clawed frog Membrane perforation Cell viability assay 486P(G4) Bladder cancer IC50 : 59.4 µM
dbacp04497 Magainin 2 GIGKFLHSAKKFGKAFVGEIMNS Yunnan firebelly toad Membrane perforation Cell viability assay 486P(G4) Bladder cancer IC50 : 59.4 µM
dbacp04603 Maximin H1 ILGPVISTIGGVLGGLLKNL Yunnan firebelly toad, China, Asia Not specified MTT assay C8166 Bladder cancer Not found
dbacp04604 Maximin H1 ILGPVISTIGGVLGGLLKNL Yunnan firebelly toad, China, Asia Not specified MTT assay BIU-87 Bladder cancer Not found
dbacp04605 Maximin H1 ILGPVISTIGGVLGGLLKNL Yunnan firebelly toad, China, Asia Not specified MTT assay T27 Bladder cancer Not found
dbacp04609 Maximin1 GIGTKILGGVKTALKGALKELASTYAN Yunnan firebelly toad Not specified MTT/MTS assay BIU-87 Bladder cancer IC50 : 20.5 µg/ml
dbacp04610 Maximin1 GIGTKILGGVKTALKGALKELASTYAN Yunnan firebelly toad Not specified MTT/MTS assay T-24 Bladder cancer IC50 : 35.4 µg/ml
dbacp04613 Maximin3 GIGGKILSGLKTALKGAAKELASTYLH Yunnan firebelly toad Not specified MTT/MTS assay BIU-87 Bladder cancer IC50 : 28 µg/ml
dbacp04614 Maximin3 GIGGKILSGLKTALKGAAKELASTYLH Yunnan firebelly toad Not specified MTT/MTS assay T-24 Bladder cancer IC50 : 18 µg/ml
dbacp04617 Maximin4 GIGVLLSAGKAALKGLAKVLAEKYAN Yunnan firebelly toad Not specified MTT/MTS assay BIU-87 Bladder cancer IC50 : >50 µg/ml
dbacp04618 Maximin4 GIGVLLSAGKAALKGLAKVLAEKYAN Yunnan firebelly toad Not specified MTT/MTS assay T-24 Bladder cancer IC50 : >50 µg/ml
dbacp04621 Maximin5 SIGAKILGGVKTFFKGALKELASTYLQ Yunnan firebelly toad Not specified MTT/MTS assay BIU-87 Bladder cancer IC50 : >50 µg/ml
dbacp04622 Maximin5 SIGAKILGGVKTFFKGALKELASTYLQ Yunnan firebelly toad Not specified MTT/MTS assay T-24 Bladder cancer IC50 : >50 µg/ml
dbacp05588 Polyarginine (R11) RRRRRRRRRRR Not found Not specified Not specified T24, 5637, RT4 Bladder cancer Not found
dbacp06764 M1-21 rrrqrrkkrg-QTQPRLGPPQTPAGGCSILIF Synthetic FOXM1 inhibitor Cell Viability assay 5637 Bladder cancer IC50 = 9.33 µM
dbacp07104 rScyreprocin MKEDSNILDKTAKMTKQNKALLFTAGGAAAFMAGYYYYHCNYRNPAPKKSGSTTSQDKTDAQAVQSIPSPSGNKGKESKDPKVKHHHHHH Recombinant product of Scyreprocin Membrane disruption triggers ROS-mediated apoptosis MTS assay T-24 Urinary Bladder Cancer IC50 = 1.94 x 105 µM
dbacp07407 LvHemB1 DVNFLLHKIYGNIRY hemocyanin of Litopenaeus vannamei Mitochondrial targeting induces apoptosis MTS assay EJ Bladder Cancer 89.6% apoptotic cells at 50 μg/mL
dbacp07848 Carnosine (Beta-A)H Muscular and Nervous tissues of vertebrates Inhibits VEGFR-2 angiogenic signaling MTT assay MGH-U1 (EJ) Bladder Cancer IC50 = 50 mM
dbacp08310 DAP1 LWKRWVGVWRKWL Synthetic Not Available MTT assay T-24 Bladder Cancer IC50 = 15.3 μM