dbACP: A Comprehensive Database of Anti-Cancer Peptides

33 result(s) have been found!

Accession Name Sequence Source/Organism Mechanism Assay Type Cell Line Cancer Type Activity
dbacp01006 Alyteserin-2 ILGKLLSTAAGLLSNL Common midwife toad Cell penetration Cytotoxicity assay HepG2 Human hepatocarcinoma LC50 : 26 µM
dbacp01007 Alyteserin-2 ILGKLLSTAAGLLSNL Common midwife toad Cell penetration Cytotoxicity assay MDA-MB-231 Breast adenocarcinoma LC50 : 20 µM
dbacp01008 Alyteserin-2 ILGKLLSTAAGLLSNL Common midwife toad Cell penetration Cytotoxicity assay HT29 Colorectal adenocarcinoma LC50 : 28 µM
dbacp05103 PA10 RQIKIWFQNRRMKWKKGGGGNNETTSIQIAGSLHHHHHH Synthetic construct Cell proliferation inhibition; Cell penetration; Apoptosis Cell viability assay MDA-MB231 Breast cancer MIC : 10 μM
dbacp05104 PA10 RQIKIWFQNRRMKWKKGGGGNNETTSIQIAGSLHHHHHH Synthetic construct Cell proliferation inhibition; Cell penetration; Apoptosis Cell viability assay HCC1806 Breast cancer MIC : 10 μM
dbacp05105 PA10 RQIKIWFQNRRMKWKKGGGGNNETTSIQIAGSLHHHHHH Synthetic construct Cell proliferation inhibition; Cell penetration; Apoptosis Cell viability assay 184B5 Breast cancer MIC : 10 μM
dbacp05106 PA10 RQIKIWFQNRRMKWKKGGGGNNETTSIQIAGSLHHHHHH Synthetic construct Cell proliferation inhibition; Cell penetration; Apoptosis Cell viability assay MCF10A Breast cancer MIC : 10 μM
dbacp05107 PA15 RQIKIWFQNRRMKWKKGGSLSAACHEQWSLGAQHHHHHH Synthetic construct Cell proliferation inhibition; Cell penetration; Apoptosis Cell viability assay MDA-MB231 Breast cancer MIC : 10 μM
dbacp05108 PA15 RQIKIWFQNRRMKWKKGGSLSAACHEQWSLGAQHHHHHH Synthetic construct Cell proliferation inhibition; Cell penetration; Apoptosis Cell viability assay HCC1806 Breast cancer MIC : 10 μM
dbacp05109 PA15 RQIKIWFQNRRMKWKKGGSLSAACHEQWSLGAQHHHHHH Synthetic construct Cell proliferation inhibition; Cell penetration; Apoptosis Cell viability assay 184B5 Breast cancer MIC : 10 μM
dbacp05110 PA15 RQIKIWFQNRRMKWKKGGSLSAACHEQWSLGAQHHHHHH Synthetic construct Cell proliferation inhibition; Cell penetration; Apoptosis Cell viability assay MCF10A Breast cancer MIC : 10 μM
dbacp05111 PA2 RQIKIWFQNRRMKWKKGGATRPRVDTQPELCGMHHHHHH Synthetic construct Cell proliferation inhibition; Cell penetration; Apoptosis Cell viability assay MDA-MB231 Breast cancer MIC : 10 μM
dbacp05112 PA2 RQIKIWFQNRRMKWKKGGATRPRVDTQPELCGMHHHHHH Synthetic construct Cell proliferation inhibition; Cell penetration; Apoptosis Cell viability assay HCC1806 Breast cancer MIC : 10 μM
dbacp05113 PA2 RQIKIWFQNRRMKWKKGGATRPRVDTQPELCGMHHHHHH Synthetic construct Cell proliferation inhibition; Cell penetration; Apoptosis Cell viability assay 184B5 Breast cancer MIC : 10 μM
dbacp05114 PA2 RQIKIWFQNRRMKWKKGGATRPRVDTQPELCGMHHHHHH Synthetic construct Cell proliferation inhibition; Cell penetration; Apoptosis Cell viability assay MCF10A Breast cancer MIC : 10 μM
dbacp05115 PA3 RQIKIWFQNRRMKWKKGGDCLCISRRARLLRATHHHHHH Synthetic construct Cell proliferation inhibition; Cell penetration; Apoptosis Cell viability assay MDA-MB231 Breast cancer MIC : 10 μM
dbacp05116 PA3 RQIKIWFQNRRMKWKKGGDCLCISRRARLLRATHHHHHH Synthetic construct Cell proliferation inhibition; Cell penetration; Apoptosis Cell viability assay HCC1806 Breast cancer MIC : 10 μM
dbacp05117 PA3 RQIKIWFQNRRMKWKKGGDCLCISRRARLLRATHHHHHH Synthetic construct Cell proliferation inhibition; Cell penetration; Apoptosis Cell viability assay 184B5 Breast cancer MIC : 10 μM
dbacp05118 PA3 RQIKIWFQNRRMKWKKGGDCLCISRRARLLRATHHHHHH Synthetic construct Cell proliferation inhibition; Cell penetration; Apoptosis Cell viability assay MCF10A Breast cancer MIC : 10 μM
dbacp05119 PA38 RQIKIWFQNRRMKWKKGGKYNGRFTTHHLLHLLNHHHHHH Synthetic construct Cell proliferation inhibition; Cell penetration; Apoptosis Cell viability assay MDA-MB231 Breast cancer MIC : 10 μM
dbacp05120 PA38 RQIKIWFQNRRMKWKKGGKYNGRFTTHHLLHLLNHHHHHH Synthetic construct Cell proliferation inhibition; Cell penetration; Apoptosis Cell viability assay HCC1806 Breast cancer MIC : 10 μM
dbacp05121 PA38 RQIKIWFQNRRMKWKKGGKYNGRFTTHHLLHLLNHHHHHH Synthetic construct Cell proliferation inhibition; Cell penetration; Apoptosis Cell viability assay 184B5 Breast cancer MIC : 10 μM
dbacp05122 PA38 RQIKIWFQNRRMKWKKGGKYNGRFTTHHLLHLLNHHHHHH Synthetic construct Cell proliferation inhibition; Cell penetration; Apoptosis Cell viability assay MCF10A Breast cancer MIC : 10 μM
dbacp05123 PA49 RQIKIWFQNRRMKWKKGGAGVYTFLVGADNRGWEHHHHHH Synthetic construct Cell proliferation inhibition; Cell penetration; Apoptosis Cell viability assay MDA-MB231 Breast cancer MIC : 10 μM
dbacp05124 PA49 RQIKIWFQNRRMKWKKGGAGVYTFLVGADNRGWEHHHHHH Synthetic construct Cell proliferation inhibition; Cell penetration; Apoptosis Cell viability assay HCC1806 Breast cancer MIC : 10 μM
dbacp05125 PA49 RQIKIWFQNRRMKWKKGGAGVYTFLVGADNRGWEHHHHHH Synthetic construct Cell proliferation inhibition; Cell penetration; Apoptosis Cell viability assay 184B5 Breast cancer MIC : 10 μM
dbacp05126 PA49 RQIKIWFQNRRMKWKKGGAGVYTFLVGADNRGWEHHHHHH Synthetic construct Cell proliferation inhibition; Cell penetration; Apoptosis Cell viability assay MCF10A Breast cancer MIC : 10 μM
dbacp06903 CIGB-300 GRKKRRQRRRPPQ-X-CWMSPRHLGTC Synthetic Cell Penetration Crystal Violet assay NCI-H-460 Lung Cancer IC50 = 30 ± 5.3 µM
dbacp07468 Protonectin ILGTILGLLKGL Parachartergus fraternus Cell penetration without toxic accumulation Resazurin dye assay MM96L Skin Cancer CC50 = 14.8 ± 0.9 µM
dbacp07469 Protonectin ILGTILGLLKGL Parachartergus fraternus Cell penetration without toxic accumulation Resazurin dye assay HCT-116 Colon Cancer CC50 = 8.0 ± 0.5 µM
dbacp07470 Protonectin-F IFGTILGFLKGL Protonoectin Cell penetration without toxic accumulation Resazurin dye assay MM96L Skin Cancer CC50 = 16.0 ± 1.2 µM
dbacp07471 Protonectin-F IFGTILGFLKGL Protonoectin Cell penetration without toxic accumulation Resazurin dye assay HCT-116 Colon Cancer CC50 = 9.8 ± 1.2 µM
dbacp07931 myristoyl-CM4 GRWKIFKKIEKVGQNIRDGIVKAGPAVAVVGQAATI Bombyx mori Cell penetration, Mitochondrial dysfunction, Apoptosis pathway activation MTT assay MCF-7 Breast cancer IC50 = 6 μM