26 result(s) have been found!
| Accession | Name | Sequence | Source/Organism | Mechanism | Assay Type | Cell Line | Cancer Type | Activity |
|---|---|---|---|---|---|---|---|---|
| dbacp01158 | Anticancer bioactive peptide | NA | Goat spleen | Apoptosis inducing | Cell proliferation assay | HCT116 | Human Colorectal cancer | IC50 : 35 μg/mL |
| dbacp01167 | Antimicrobial peptide TsAP-2 | MQIKHLITIFFLVLIVADHCHAFLGMIPGLIGGLISAFKGRRKREITSQIEQYRNLQKREAELENLLANLPVY | Brazilian scorpion | Not specified | Cell proliferation assay | HepG2 | Human hepatocellular carcinoma | MIC : 40 µM |
| dbacp02106 | Buthus Occitanus RK1 | IDCSKVNLTAECSS | Common yellow scorpion RK1 | Reduce cell proliferation and migration | MTT assay, Cell proliferation assay | U87 | EpCAM-expressing cells | MIC 50 : approx. 2 µM |
| dbacp02107 | Buthus Occitanus RK1 | IDCSKVNLTAECSS | Common yellow scorpion RK1 | Reduce cell proliferation and migration | MTT assay, Cell proliferation assay | IGR39 | EpCAM-expressing cells | MIC 50 : approx. 2 µM |
| dbacp02309 | Catfish PACAP38 | HSDGIFTDSYSRYRKQMAVKKYLAAVLGRRYRQRFRNK | Sharptooth catfish, North Africa | Cell membrane penetration | In vitro cell proliferation assay | H460 | Lung cancer | IC50 :13.17 μM |
| dbacp02678 | Dermaseptin-PH | ALWKEVLKNAGKAALNEINNLVQ | Northern orange-legged leaf frog | Cell membrane permeabilization | Bioactivity assessment assay, MTT cell proliferation assay | MCF-7 | Not specified | IC50 : 0.69 μM |
| dbacp02679 | Dermaseptin-PH | ALWKEVLKNAGKAALNEINNLVQ | Northern orange-legged leaf frog | Cell membrane permeabilization | Bioactivity assessment assay, MTT cell proliferation assay | H157 | Not specified | IC50 : 2.01 μM |
| dbacp02680 | Dermaseptin-PH | ALWKEVLKNAGKAALNEINNLVQ | Northern orange-legged leaf frog | Cell membrane permeabilization | Bioactivity assessment assay, MTT cell proliferation assay | U251MG | Not specified | IC50 : 2.36 μM |
| dbacp02681 | Dermaseptin-PH | ALWKEVLKNAGKAALNEINNLVQ | Northern orange-legged leaf frog | Cell membrane permeabilization | Bioactivity assessment assay, MTT cell proliferation assay | MDA-MB-435S | Not specified | IC50 : 9.94 μM |
| dbacp02682 | Dermaseptin-PH | ALWKEVLKNAGKAALNEINNLVQ | Northern orange-legged leaf frog | Cell membrane permeabilization | Bioactivity assessment assay, MTT cell proliferation assay | PC-3 | Not specified | IC50 : 11.8 μM |
| dbacp02683 | Dermaseptin-PH | ALWKEVLKNAGKAALNEINNLV | Orange-legged leaf frog, Northern orange-legged leaf frog, South America | Cell membrane permeabilization | MTT cell proliferation assay | MCF-7 | Lung cancer | IC50 : 0.69 μM |
| dbacp02684 | Dermaseptin-PH | ALWKEVLKNAGKAALNEINNLV | Orange-legged leaf frog, Northern orange-legged leaf frog, South America | Cell membrane permeabilization | MTT cell proliferation assay | H157 | Glioma | IC50 : 2.01 μM |
| dbacp02685 | Dermaseptin-PH | ALWKEVLKNAGKAALNEINNLV | Orange-legged leaf frog, Northern orange-legged leaf frog, South America | Cell membrane permeabilization | MTT cell proliferation assay | U251MG | Prostate cancer | IC50 : 2.36 μM |
| dbacp02686 | Dermaseptin-PH | ALWKEVLKNAGKAALNEINNLV | Orange-legged leaf frog, Northern orange-legged leaf frog, South America | Cell membrane permeabilization | MTT cell proliferation assay | MDA-MB-435S | Breast cancer | IC50 : 9.94 μM |
| dbacp02687 | Dermaseptin-PH | ALWKEVLKNAGKAALNEINNLV | Orange-legged leaf frog, Northern orange-legged leaf frog, South America | Cell membrane permeabilization | MTT cell proliferation assay | PC-3 | Human prostate carcinoma | IC50 : 11.8 μM |
| dbacp02723 | Dermaseptin-PS1 | ALWKTMLKKLGTVALHAGKAALGAVADTISQ | Rock Kribensis Cichlid | Disrupting cell membranes; Apoptosis | Lactate dehydrogenase (LDH) assay, MTT cell proliferation assay | U251MG | Human glioblastoma | MIC : 10−5 M and above |
| dbacp06123 | SK84 | SQLGDLGSGAGQGGGGGGSIRAAGGAFGKLEAAREEEFFYKKQKEQLERLKNDQIHQAEFHHQQIKEHEEAIQRHKDFLNNLHK | Fruit fly | Destroying the cell membranes | Cell proliferation assay | THP-1 | Human Leukemia | MIC : 4 – 8 mM |
| dbacp06124 | SK84 | SQLGDLGSGAGQGGGGGGSIRAAGGAFGKLEAAREEEFFYKKQKEQLERLKNDQIHQAEFHHQQIKEHEEAIQRHKDFLNNLHK | Fruit fly | Destroying the cell membranes | Cell proliferation assay | HepG2 | Liver cancer | MIC : 4 – 8 mM |
| dbacp06125 | SK84 | SQLGDLGSGAGQGGGGGGSIRAAGGAFGKLEAAREEEFFYKKQKEQLERLKNDQIHQAEFHHQQIKEHEEAIQRHKDFLNNLHK | Fruit fly | Destroying the cell membranes | Cell proliferation assay | MCF-7 | Breast cancer | MIC : 4 – 8 mM |
| dbacp06126 | SK84 | SQLGDLGSGAGQGGGGGGSIRAAGGAFGKLEAAREEEFFYKKQKEQLERLKNDQIHQAEFHHQQIKEHEEAIQRHKDFLNNLHK | Fruit fly | Destroying the cell membranes | Cell proliferation assay | CHO | Ovary cancer | MIC : 4 – 8 mM |
| dbacp06127 | SK84 | SQLGDLGSGAGQGGGGGGSIRAAGGAFGKLEAAREEEFFYKKQKEQLERLKNDQIHQAEFHHQQIKEHEEAIQRHKDFLNNLHK | Fruit fly | Destroying the cell membranes | Cell proliferation assay | HEK29 | Kidney cancer | MIC : 4 – 8 mM |
| dbacp08313 | P1C | YKSIEFC | Synthetic | Not Available | Cell Proliferation assay | BXPC-3 | Pancreatic Cancer | ~40% reduction in cell growth at 20 μM |
| dbacp08314 | P1A | YKSIEFC | Synthetic | Not Available | Cell Proliferation assay | BXPC-4 | Pancreatic Cancer | ~50% reduction in cell growth at 20 μM |
| dbacp08315 | P1B | YKSVEFC | Synthetic | Not Available | Cell Proliferation assay | BXPC-5 | Pancreatic Cancer | ~50% reduction in cell growth at 20 μM |
| dbacp08429 | hBD3-3 M1 | GKCSTRGRKCMRRKK | Synthetic | Not Available | Cell Proliferation assay | MDA-MB-231 | Breast Cancer | Concentration dependent reduction in colony formation between 100 μM and 200 μM. |
| dbacp08431 | hBD3-3 M2 | GKCSTRGRKMCRRKK | Synthetic | Not Available | Cell Proliferation assay | MDA-MB-231 | Breast Cancer | Concentration dependent reduction in colony formation between 100 μM and 200 μM. |