dbACP: A Comprehensive Database of Anti-Cancer Peptides

26 result(s) have been found!

Accession Name Sequence Source/Organism Mechanism Assay Type Cell Line Cancer Type Activity
dbacp01158 Anticancer bioactive peptide NA Goat spleen Apoptosis inducing Cell proliferation assay HCT116 Human Colorectal cancer IC50 : 35 μg/mL
dbacp01167 Antimicrobial peptide TsAP-2 MQIKHLITIFFLVLIVADHCHAFLGMIPGLIGGLISAFKGRRKREITSQIEQYRNLQKREAELENLLANLPVY Brazilian scorpion Not specified Cell proliferation assay HepG2 Human hepatocellular carcinoma MIC : 40 µM
dbacp02106 Buthus Occitanus RK1 IDCSKVNLTAECSS Common yellow scorpion RK1 Reduce cell proliferation and migration MTT assay, Cell proliferation assay U87 EpCAM-expressing cells MIC 50 : approx. 2 µM
dbacp02107 Buthus Occitanus RK1 IDCSKVNLTAECSS Common yellow scorpion RK1 Reduce cell proliferation and migration MTT assay, Cell proliferation assay IGR39 EpCAM-expressing cells MIC 50 : approx. 2 µM
dbacp02309 Catfish PACAP38 HSDGIFTDSYSRYRKQMAVKKYLAAVLGRRYRQRFRNK Sharptooth catfish, North Africa Cell membrane penetration In vitro cell proliferation assay H460 Lung cancer IC50 :13.17 μM
dbacp02678 Dermaseptin-PH ALWKEVLKNAGKAALNEINNLVQ Northern orange-legged leaf frog Cell membrane permeabilization Bioactivity assessment assay, MTT cell proliferation assay MCF-7 Not specified IC50 : 0.69 μM
dbacp02679 Dermaseptin-PH ALWKEVLKNAGKAALNEINNLVQ Northern orange-legged leaf frog Cell membrane permeabilization Bioactivity assessment assay, MTT cell proliferation assay H157 Not specified IC50 : 2.01 μM
dbacp02680 Dermaseptin-PH ALWKEVLKNAGKAALNEINNLVQ Northern orange-legged leaf frog Cell membrane permeabilization Bioactivity assessment assay, MTT cell proliferation assay U251MG Not specified IC50 : 2.36 μM
dbacp02681 Dermaseptin-PH ALWKEVLKNAGKAALNEINNLVQ Northern orange-legged leaf frog Cell membrane permeabilization Bioactivity assessment assay, MTT cell proliferation assay MDA-MB-435S Not specified IC50 : 9.94 μM
dbacp02682 Dermaseptin-PH ALWKEVLKNAGKAALNEINNLVQ Northern orange-legged leaf frog Cell membrane permeabilization Bioactivity assessment assay, MTT cell proliferation assay PC-3 Not specified IC50 : 11.8 μM
dbacp02683 Dermaseptin-PH ALWKEVLKNAGKAALNEINNLV Orange-legged leaf frog, Northern orange-legged leaf frog, South America Cell membrane permeabilization MTT cell proliferation assay MCF-7 Lung cancer IC50 : 0.69 μM
dbacp02684 Dermaseptin-PH ALWKEVLKNAGKAALNEINNLV Orange-legged leaf frog, Northern orange-legged leaf frog, South America Cell membrane permeabilization MTT cell proliferation assay H157 Glioma IC50 : 2.01 μM
dbacp02685 Dermaseptin-PH ALWKEVLKNAGKAALNEINNLV Orange-legged leaf frog, Northern orange-legged leaf frog, South America Cell membrane permeabilization MTT cell proliferation assay U251MG Prostate cancer IC50 : 2.36 μM
dbacp02686 Dermaseptin-PH ALWKEVLKNAGKAALNEINNLV Orange-legged leaf frog, Northern orange-legged leaf frog, South America Cell membrane permeabilization MTT cell proliferation assay MDA-MB-435S Breast cancer IC50 : 9.94 μM
dbacp02687 Dermaseptin-PH ALWKEVLKNAGKAALNEINNLV Orange-legged leaf frog, Northern orange-legged leaf frog, South America Cell membrane permeabilization MTT cell proliferation assay PC-3 Human prostate carcinoma IC50 : 11.8 μM
dbacp02723 Dermaseptin-PS1 ALWKTMLKKLGTVALHAGKAALGAVADTISQ Rock Kribensis Cichlid Disrupting cell membranes; Apoptosis Lactate dehydrogenase (LDH) assay, MTT cell proliferation assay U251MG Human glioblastoma MIC : 10−5 M and above
dbacp06123 SK84 SQLGDLGSGAGQGGGGGGSIRAAGGAFGKLEAAREEEFFYKKQKEQLERLKNDQIHQAEFHHQQIKEHEEAIQRHKDFLNNLHK Fruit fly Destroying the cell membranes Cell proliferation assay THP-1 Human Leukemia MIC : 4 – 8 mM
dbacp06124 SK84 SQLGDLGSGAGQGGGGGGSIRAAGGAFGKLEAAREEEFFYKKQKEQLERLKNDQIHQAEFHHQQIKEHEEAIQRHKDFLNNLHK Fruit fly Destroying the cell membranes Cell proliferation assay HepG2 Liver cancer MIC : 4 – 8 mM
dbacp06125 SK84 SQLGDLGSGAGQGGGGGGSIRAAGGAFGKLEAAREEEFFYKKQKEQLERLKNDQIHQAEFHHQQIKEHEEAIQRHKDFLNNLHK Fruit fly Destroying the cell membranes Cell proliferation assay MCF-7 Breast cancer MIC : 4 – 8 mM
dbacp06126 SK84 SQLGDLGSGAGQGGGGGGSIRAAGGAFGKLEAAREEEFFYKKQKEQLERLKNDQIHQAEFHHQQIKEHEEAIQRHKDFLNNLHK Fruit fly Destroying the cell membranes Cell proliferation assay CHO Ovary cancer MIC : 4 – 8 mM
dbacp06127 SK84 SQLGDLGSGAGQGGGGGGSIRAAGGAFGKLEAAREEEFFYKKQKEQLERLKNDQIHQAEFHHQQIKEHEEAIQRHKDFLNNLHK Fruit fly Destroying the cell membranes Cell proliferation assay HEK29 Kidney cancer MIC : 4 – 8 mM
dbacp08313 P1C YKSIEFC Synthetic Not Available Cell Proliferation assay BXPC-3 Pancreatic Cancer ~40% reduction in cell growth at 20 μM
dbacp08314 P1A YKSIEFC Synthetic Not Available Cell Proliferation assay BXPC-4 Pancreatic Cancer ~50% reduction in cell growth at 20 μM
dbacp08315 P1B YKSVEFC Synthetic Not Available Cell Proliferation assay BXPC-5 Pancreatic Cancer ~50% reduction in cell growth at 20 μM
dbacp08429 hBD3-3 M1 GKCSTRGRKCMRRKK Synthetic Not Available Cell Proliferation assay MDA-MB-231 Breast Cancer Concentration dependent reduction in colony formation between 100 μM and 200 μM.
dbacp08431 hBD3-3 M2 GKCSTRGRKMCRRKK Synthetic Not Available Cell Proliferation assay MDA-MB-231 Breast Cancer Concentration dependent reduction in colony formation between 100 μM and 200 μM.