50 result(s) have been found!
| Accession | Name | Sequence | Source/Organism | Mechanism | Assay Type | Cell Line | Cancer Type | Activity |
|---|---|---|---|---|---|---|---|---|
| dbacp00833 | AAP-H | YVPGP | Marine invertebrates | Apoptosis inducing | MTT assay | DU-145 | Prostate cancer | IC50 : 9.605 mM |
| dbacp00981 | Adenoregulin | GLWSKIKEVGKEAAKAAAKAAGKAALGAVSEAV | South American frog, Giant leaf frog | Cell membrane disintegration | LDH leakage assay | DU-145 | Liver cancer | GI50 : 0.91 ± 0.04 µM |
| dbacp01157 | Anthopleura anjunae anti-tumor peptide | YVPGP | Sea anemone anti-tumor peptide | Apoptosis inducing | MTT Cell Proliferation and Cytotoxicity assay | DU-145 | Prostate cancer | IC50 : 9.605 μM |
| dbacp01193 | ATAP-iRGD peptide-Parental | KFEPKSGWMTFLEVTGKIAEMLSLLKQYCRGDKGPDC | Anti apoptotic (MCL-1, BFL1) | Inducing apoptosis | MTT assay | DU-145 | Prostate cancer | IC50 : 1.6 μM |
| dbacp01194 | ATAP-iRGD-M1 | AFEPKSGWMTFLEVTGKIAEMLSLLKQYCRGDKGPDC | Anti apoptotic (MCL-1, BFL1) | Inducing apoptosis | MTT assay | DU-145 | Prostate cancer | IC50 : 36 μM |
| dbacp01195 | ATAP-iRGD-M2 | LFEPKSGWMTFLEVTGKIAEMLSLLKQYCRGDKGPDC | Anti apoptotic (MCL-1, BFL1) | Inducing apoptosis | MTT assay | DU-145 | Prostate cancer | IC50 : 68 μM |
| dbacp01196 | ATAP-iRGD-M3 | KFEPLSGWMTFLEVTGKIAEMLSLLKQYCRGDKGPDC | Anti apoptotic (MCL-1, BFL1) | Inducing apoptosis | MTT assay | DU-145 | Prostate cancer | IC50 : 25 μM |
| dbacp01197 | ATAP-iRGD-M5 | KFEPKSGWETFLEVTGKIAEMLSLLKQYCRGDKGPDC | Anti apoptotic (MCL-1, BFL1) | Inducing apoptosis | MTT assay | DU-145 | Prostate cancer | IC50 : 6 μM |
| dbacp01198 | ATAP-iRGD-M6 | KKFEPKSGWMTFLEVTGKIAEMLSLLKQYCRGDKGPDC | Anti apoptotic (MCL-1, BFL1) | Inducing apoptosis | MTT assay | DU-145 | Prostate cancer | IC50 : 3.1 μM |
| dbacp01199 | ATAP-iRGD-M7 | KFEPKSGWMTFLEVTGKIAEMLSLLKQYCRGDKGPDC | Anti apoptotic (MCL-1, BFL1) | Inducing apoptosis | MTT assay | DU-145 | Prostate cancer | IC50 : 2.1 μM |
| dbacp01200 | ATAP-iRGD-M8 | KKFEPKSGWMTFLEVTGKIAEMLSLLKQYCRGDKGPDC | Anti apoptotic (MCL-1, BFL1) | Inducing apoptosis | MTT assay | DU-145 | Prostate cancer | IC50 : 2.1 μM |
| dbacp01354 | Aurein-2.7 | GLFDIAKKVIGVIGSL | Southern bell frog | Cell membrane disintegration | One-dose and five-dose assay | DU-145 | Prostate cancer | IC50 : 5 μM |
| dbacp01590 | BCP-A | WPP | Marine invertebrates | Inducing apoptosis | Not specified | DU-145 | Not specified | IC50 : 2.80 mg/ml |
| dbacp02046 | Buforin IIb | RAGLQFPVGRLLRRLLRRLLR | Histone H2A | Inducing mitochondria-dependent apoptosis | MTT/MTS assay | DU-145 | Prostate cancer | IC50 : 15.3 µg/ml |
| dbacp02104 | Buforin Iib | RAGLQFPVGRLLRRLLRRLLR | Not found | Inducing apoptosis | MTT/MTS assay | DU-145 | Not specified | IC50 : 15.3 µg/ml |
| dbacp02801 | Dolastatin 10 | 2-[[2-(dimethylamino)-3-methylbutanoyl]amino]-N-[3-methoxy-1-[2-[1-methoxy-2-methyl-3-oxo-3-[[2-phenyl-1-(1,3-thiazol-2-yl)ethyl]amino]propyl]pyrrolidin-1-yl]-5-methyl-1-oxoheptan-4-yl]-N,3-dimethylbutaNAmide | Wedge sea hare | Apoptosis inducing | TUNEL assay | DU-145 | Prostate cancer | IC50 : 0.5 nM |
| dbacp04341 | Lycosin-1 | Ac-KGWFKAMKSIAKFIAKEKLKEHL-amide | Tarantula wolf spider | Inhibit the migration of prostate cancer cell; Induce apoptosis | MTT assay | DU-145 | Prostate cancer | MIC : 10 μM |
| dbacp04598 | Mauriporin (Non-disulfide-bridged peptide 2.8) (NDBP-2.8) | MNKKTLLVIFFITMLIVDEVNSFKIGGFIKKLWRSKLAKKLRAKGRELLKDYANRVINGGPEEEAAVPAERRR | Fat-tailed scorpion | Anti-proliferative action | Not specified | DU-145 | Prostate cancer | IC50 : 4.4 μM |
| dbacp05244 | Pentapeptide (ILYMP) | ILYMP | Marine invertebrates | Inducing apoptosis | MTT assay | DU-145 | Prostate cancer | IC50 :11.25 mM |
| dbacp06027 | SCH-P10 | DYVP | Marine invertebrates | Inducing apoptosis | MTT assay | DU-145 | Prostate cancer | IC50 : 1.21 mg/mL |
| dbacp06029 | SCH-P9 | LPGP | Marine invertebrates | Inducing apoptosis | MTT assay | DU-145 | Prostate cancer | IC50 : 1.21 mg/mL |
| dbacp06058 | Sepia ink oligopeptide (SIO) | QPK | Not found | Inducing apoptosis | CCK-8 assay | DU-145 | Prostate cancer | IC50 : < 5 mg/mL |
| dbacp06618 | LA3IK | LAIAVK | Migration and invasion enhancer 1 (MIEN1) | Targeting the MIEN1 signaling pathway | MTT assay | DU-145 | Prostate Cancer | IC50 = 335.7 ± 3.09 µM |
| dbacp06622 | D-LA3IK | laiavk | Migration and invasion enhancer 1 (MIEN1) | Targeting the MIEN1 signaling pathway | MTT assay | DU-145 | Prostate Cancer | IC50 = 89.11 ± 8.12 µM |
| dbacp06626 | LA3IK-SCR | LAKAVI | Migration and invasion enhancer 1 (MIEN1) | Targeting the MIEN1 signaling pathway | MTT assay | DU-145 | Prostate Cancer | IC50 = 351.76 ± 7.18 µM |
| dbacp06630 | RP-7 | RPPCVIL | Migration and invasion enhancer 1 (MIEN1) | Targeting the MIEN1 signaling pathway | MTT assay | DU-145 | Prostate Cancer | IC50 = 120.72 ± 7.08 µM |
| dbacp06634 | D-RP-7 | rppcvil | Migration and invasion enhancer 1 (MIEN1) | Targeting the MIEN1 signaling pathway | MTT assay | DU-145 | Prostate Cancer | IC50 = 121.59 ± 6.56 µM |
| dbacp06638 | RP7 SCR | RPPLVIC | Migration and invasion enhancer 1 (MIEN1) | Targeting the MIEN1 signaling pathway | MTT assay | DU-145 | Prostate Cancer | IC50 = 137 ± 5.98 µM |
| dbacp06658 | LfcinB (21-25)Pal | RWQWRWQWR | LfcinB | Apoptosis inducing | MTT assay | DU-145 | Prostrate Cancer | IC50 = 40 μM |
| dbacp06663 | 9[Orn] [Pal] | RWQWRWQWO | Synthetic | Apoptosis inducing | MTT assay | DU-145 | Prostrate Cancer | IC50 = 62 μM |
| dbacp06866 | Pep-1-Phor21 | CGEMGWVRCKFAKFAKKFAKFAKKFAKFAK | Hybrid peptide PEP1 and Phor 21 | Not available | AlamarBlue assay | DU-145 | Prostrate Cancer | IC50 = 2.57 ± 2.02 µM |
| dbacp06924 | #2(D33-N52) | RRRRRRRRGGDRDYKKFWAGLQGLTIYFYN | STAP-2 PH domain–derived peptide | Inhibition of cell signalling | CellTiter-Glo assay | DU-145 | Liver Cancer | Graph figure 1-B |
| dbacp06926 | #5(D93-F112) | RRRRRRRRGGDQEIKFKVETLECREMWKGF | STAP-2 PH domain–derived peptide | Inhibition of cell signalling | CellTiter-Glo assay | DU-145 | Liver Cancer | Graph figure 1-B |
| dbacp06927 | #6(M108-L127) | RRRRRRRRGGMWKGFILTVVELRVPTDLTL | STAP-2 PH domain–derived peptide | Inhibition of cell signalling | CellTiter-Glo assay | DU-145 | Liver Cancer | Graph figure 1-B |
| dbacp06929 | 2A(F39-Q58) | RRRRRRRRGGFWAGLQGLTIYFYNSNRDFQ | STAP-2 PH domain–derived peptide | Inhibition of cell signalling | CellTiter-Glo assay | DU-145 | Liver Cancer | Graph figure 1-C |
| dbacp06930 | 2C(Q44-Q58) | RRRRRRRRGGQGLTIYFYNSNRDFQ | STAP-2 PH domain–derived peptide | Inhibition of cell signalling | CellTiter-Glo assay | DU-145 | Liver Cancer | Graph figure 1-C |
| dbacp06931 | 2D(Q44-R55) | RRRRRRRRGGQGLTIYFYNSNR | STAP-2 PH domain–derived peptide | Inhibition of cell signalling | CellTiter-Glo assay | DU-145 | Liver Cancer | Graph figure 1-C |
| dbacp06932 | 2D2(Q44-Y51) | RRRRRRRRGGQGLTIYFY | STAP-2 PH domain–derived peptide | Inhibition of cell signalling | CellTiter-Glo assay | DU-145 | Liver Cancer | Graph figure 1-C |
| dbacp06933 | 2D3(G45-N52) | RRRRRRRRGGGLTIYFYN | STAP-2 PH domain–derived peptide | Inhibition of cell signalling | CellTiter-Glo assay | DU-145 | Liver Cancer | Graph figure 1-C |
| dbacp06934 | 2D5(G45-Y51) | RRRRRRRRGGGLTIYFY | STAP-2 PH domain–derived peptide | Inhibition of cell signalling | CellTiter-Glo assay | DU-145 | Liver Cancer | IC50 = 19.4 μM |
| dbacp06935 | 6E(V116-M135) | RRRRRRRRGGVVELRVPTDLTLLPGHLYMM | STAP-2 PH domain–derived peptide | Inhibition of cell signalling | CellTiter-Glo assay | DU-145 | Liver Cancer | Graph figure 1-D |
| dbacp06936 | 6F (I113-P122) | RRRRRRRRGGILTVVELRVP | STAP-2 PH domain–derived peptide | Inhibition of cell signalling | CellTiter-Glo assay | DU-145 | Liver Cancer | Graph figure 1-D |
| dbacp06937 | TAT-2D5 | GRKKRRQRRRPPQGGLTIYFY | STAP-2 PH domain–derived peptide | Inhibition of cell signalling | CellTiter-Glo assay | DU-145 | Liver Cancer | Graph figure 1-G |
| dbacp06938 | HTLV-II-Rex-2D5 | TRRQRTRRARRNRGGLTIYFY | STAP-2 PH domain–derived peptide | Inhibition of cell signalling | CellTiter-Glo assay | DU-145 | Liver Cancer | Graph figure 1-G |
| dbacp06939 | FHV-2D5 | RRRRNRTRRNRRRVRGGLTIYFY | STAP-2 PH domain–derived peptide | Inhibition of cell signalling | CellTiter-Glo assay | DU-145 | Liver Cancer | Graph figure 1-G |
| dbacp07009 | ST101 | vaeareelerlearlgqargelkkwkmrrnqfwlklqr | Synthetic | Prevents C/EBPβ dimerization, induces degradation | Annexin V/ PI staining assay | DU-145 | Prostate Cancer | mean EC50 value of 2.1 ± 0.4 μmol/L |
| dbacp07105 | rScyreprocin | MKEDSNILDKTAKMTKQNKALLFTAGGAAAFMAGYYYYHCNYRNPAPKKSGSTTSQDKTDAQAVQSIPSPSGNKGKESKDPKVKHHHHHH | Recombinant product of Scyreprocin | Membrane disruption triggers ROS-mediated apoptosis | MTS assay | DU-145 | Prostate cancer | IC50 = 1158.30 µM |
| dbacp07938 | Pantinin-1 | GILGKLWEGFKSIV | Synthetic | Selective binding, membrane disruption, apoptosis | MTS assay | DU-145 | Prostate Cancer | IC50 = 47.5 ± 2.0 µM |
| dbacp07940 | Pantinin-2 | IFGAIWKGISSLL | Synthetic | Selective binding, membrane disruption, apoptosis | MTS assay | DU-145 | Prostate Cancer | IC50 = 16.5 ± 1.0 µM |
| dbacp07942 | Pantinin-3 | FLSTIWNGIKSLL | Synthetic | Selective binding, membrane disruption, apoptosis | MTS assay | DU-145 | Prostate Cancer | IC50 = 17.3 ± 1.0 µM |