dbACP: A Comprehensive Database of Anti-Cancer Peptides

50 result(s) have been found!

Accession Name Sequence Source/Organism Mechanism Assay Type Cell Line Cancer Type Activity
dbacp00833 AAP-H YVPGP Marine invertebrates Apoptosis inducing MTT assay DU-145 Prostate cancer IC50 : 9.605 mM
dbacp00981 Adenoregulin GLWSKIKEVGKEAAKAAAKAAGKAALGAVSEAV South American frog, Giant leaf frog Cell membrane disintegration LDH leakage assay DU-145 Liver cancer GI50 : 0.91 ± 0.04 µM
dbacp01157 Anthopleura anjunae anti-tumor peptide YVPGP Sea anemone anti-tumor peptide Apoptosis inducing MTT Cell Proliferation and Cytotoxicity assay DU-145 Prostate cancer IC50 : 9.605 μM
dbacp01193 ATAP-iRGD peptide-Parental KFEPKSGWMTFLEVTGKIAEMLSLLKQYCRGDKGPDC Anti apoptotic (MCL-1, BFL1) Inducing apoptosis MTT assay DU-145 Prostate cancer IC50 : 1.6 μM
dbacp01194 ATAP-iRGD-M1 AFEPKSGWMTFLEVTGKIAEMLSLLKQYCRGDKGPDC Anti apoptotic (MCL-1, BFL1) Inducing apoptosis MTT assay DU-145 Prostate cancer IC50 : 36 μM
dbacp01195 ATAP-iRGD-M2 LFEPKSGWMTFLEVTGKIAEMLSLLKQYCRGDKGPDC Anti apoptotic (MCL-1, BFL1) Inducing apoptosis MTT assay DU-145 Prostate cancer IC50 : 68 μM
dbacp01196 ATAP-iRGD-M3 KFEPLSGWMTFLEVTGKIAEMLSLLKQYCRGDKGPDC Anti apoptotic (MCL-1, BFL1) Inducing apoptosis MTT assay DU-145 Prostate cancer IC50 : 25 μM
dbacp01197 ATAP-iRGD-M5 KFEPKSGWETFLEVTGKIAEMLSLLKQYCRGDKGPDC Anti apoptotic (MCL-1, BFL1) Inducing apoptosis MTT assay DU-145 Prostate cancer IC50 : 6 μM
dbacp01198 ATAP-iRGD-M6 KKFEPKSGWMTFLEVTGKIAEMLSLLKQYCRGDKGPDC Anti apoptotic (MCL-1, BFL1) Inducing apoptosis MTT assay DU-145 Prostate cancer IC50 : 3.1 μM
dbacp01199 ATAP-iRGD-M7 KFEPKSGWMTFLEVTGKIAEMLSLLKQYCRGDKGPDC Anti apoptotic (MCL-1, BFL1) Inducing apoptosis MTT assay DU-145 Prostate cancer IC50 : 2.1 μM
dbacp01200 ATAP-iRGD-M8 KKFEPKSGWMTFLEVTGKIAEMLSLLKQYCRGDKGPDC Anti apoptotic (MCL-1, BFL1) Inducing apoptosis MTT assay DU-145 Prostate cancer IC50 : 2.1 μM
dbacp01354 Aurein-2.7 GLFDIAKKVIGVIGSL Southern bell frog Cell membrane disintegration One-dose and five-dose assay DU-145 Prostate cancer IC50 : 5 μM
dbacp01590 BCP-A WPP Marine invertebrates Inducing apoptosis Not specified DU-145 Not specified IC50 : 2.80 mg/ml
dbacp02046 Buforin IIb RAGLQFPVGRLLRRLLRRLLR Histone H2A Inducing mitochondria-dependent apoptosis MTT/MTS assay DU-145 Prostate cancer IC50 : 15.3 µg/ml
dbacp02104 Buforin Iib RAGLQFPVGRLLRRLLRRLLR Not found Inducing apoptosis MTT/MTS assay DU-145 Not specified IC50 : 15.3 µg/ml
dbacp02801 Dolastatin 10 2-[[2-(dimethylamino)-3-methylbutanoyl]amino]-N-[3-methoxy-1-[2-[1-methoxy-2-methyl-3-oxo-3-[[2-phenyl-1-(1,3-thiazol-2-yl)ethyl]amino]propyl]pyrrolidin-1-yl]-5-methyl-1-oxoheptan-4-yl]-N,3-dimethylbutaNAmide Wedge sea hare Apoptosis inducing TUNEL assay DU-145 Prostate cancer IC50 : 0.5 nM
dbacp04341 Lycosin-1 Ac-KGWFKAMKSIAKFIAKEKLKEHL-amide Tarantula wolf spider Inhibit the migration of prostate cancer cell; Induce apoptosis MTT assay DU-145 Prostate cancer MIC : 10 μM
dbacp04598 Mauriporin (Non-disulfide-bridged peptide 2.8) (NDBP-2.8) MNKKTLLVIFFITMLIVDEVNSFKIGGFIKKLWRSKLAKKLRAKGRELLKDYANRVINGGPEEEAAVPAERRR Fat-tailed scorpion Anti-proliferative action Not specified DU-145 Prostate cancer IC50 : 4.4 μM
dbacp05244 Pentapeptide (ILYMP) ILYMP Marine invertebrates Inducing apoptosis MTT assay DU-145 Prostate cancer IC50 :11.25 mM
dbacp06027 SCH-P10 DYVP Marine invertebrates Inducing apoptosis MTT assay DU-145 Prostate cancer IC50 : 1.21 mg/mL
dbacp06029 SCH-P9 LPGP Marine invertebrates Inducing apoptosis MTT assay DU-145 Prostate cancer IC50 : 1.21 mg/mL
dbacp06058 Sepia ink oligopeptide (SIO) QPK Not found Inducing apoptosis CCK-8 assay DU-145 Prostate cancer IC50 : < 5 mg/mL
dbacp06618 LA3IK LAIAVK Migration and invasion enhancer 1 (MIEN1) Targeting the MIEN1 signaling pathway MTT assay DU-145 Prostate Cancer IC50 = 335.7 ± 3.09 µM
dbacp06622 D-LA3IK laiavk Migration and invasion enhancer 1 (MIEN1) Targeting the MIEN1 signaling pathway MTT assay DU-145 Prostate Cancer IC50 = 89.11 ± 8.12 µM
dbacp06626 LA3IK-SCR LAKAVI Migration and invasion enhancer 1 (MIEN1) Targeting the MIEN1 signaling pathway MTT assay DU-145 Prostate Cancer IC50 = 351.76 ± 7.18 µM
dbacp06630 RP-7 RPPCVIL Migration and invasion enhancer 1 (MIEN1) Targeting the MIEN1 signaling pathway MTT assay DU-145 Prostate Cancer IC50 = 120.72 ± 7.08 µM
dbacp06634 D-RP-7 rppcvil Migration and invasion enhancer 1 (MIEN1) Targeting the MIEN1 signaling pathway MTT assay DU-145 Prostate Cancer IC50 = 121.59 ± 6.56 µM
dbacp06638 RP7 SCR RPPLVIC Migration and invasion enhancer 1 (MIEN1) Targeting the MIEN1 signaling pathway MTT assay DU-145 Prostate Cancer IC50 = 137 ± 5.98 µM
dbacp06658 LfcinB (21-25)Pal RWQWRWQWR LfcinB Apoptosis inducing MTT assay DU-145 Prostrate Cancer IC50 = 40 μM
dbacp06663 9[Orn] [Pal] RWQWRWQWO Synthetic Apoptosis inducing MTT assay DU-145 Prostrate Cancer IC50 = 62 μM
dbacp06866 Pep-1-Phor21 CGEMGWVRCKFAKFAKKFAKFAKKFAKFAK Hybrid peptide PEP1 and Phor 21 Not available AlamarBlue assay DU-145 Prostrate Cancer IC50 = 2.57 ± 2.02 µM
dbacp06924 #2(D33-N52) RRRRRRRRGGDRDYKKFWAGLQGLTIYFYN STAP-2 PH domain–derived peptide Inhibition of cell signalling CellTiter-Glo assay DU-145 Liver Cancer Graph figure 1-B
dbacp06926 #5(D93-F112) RRRRRRRRGGDQEIKFKVETLECREMWKGF STAP-2 PH domain–derived peptide Inhibition of cell signalling CellTiter-Glo assay DU-145 Liver Cancer Graph figure 1-B
dbacp06927 #6(M108-L127) RRRRRRRRGGMWKGFILTVVELRVPTDLTL STAP-2 PH domain–derived peptide Inhibition of cell signalling CellTiter-Glo assay DU-145 Liver Cancer Graph figure 1-B
dbacp06929 2A(F39-Q58) RRRRRRRRGGFWAGLQGLTIYFYNSNRDFQ STAP-2 PH domain–derived peptide Inhibition of cell signalling CellTiter-Glo assay DU-145 Liver Cancer Graph figure 1-C
dbacp06930 2C(Q44-Q58) RRRRRRRRGGQGLTIYFYNSNRDFQ STAP-2 PH domain–derived peptide Inhibition of cell signalling CellTiter-Glo assay DU-145 Liver Cancer Graph figure 1-C
dbacp06931 2D(Q44-R55) RRRRRRRRGGQGLTIYFYNSNR STAP-2 PH domain–derived peptide Inhibition of cell signalling CellTiter-Glo assay DU-145 Liver Cancer Graph figure 1-C
dbacp06932 2D2(Q44-Y51) RRRRRRRRGGQGLTIYFY STAP-2 PH domain–derived peptide Inhibition of cell signalling CellTiter-Glo assay DU-145 Liver Cancer Graph figure 1-C
dbacp06933 2D3(G45-N52) RRRRRRRRGGGLTIYFYN STAP-2 PH domain–derived peptide Inhibition of cell signalling CellTiter-Glo assay DU-145 Liver Cancer Graph figure 1-C
dbacp06934 2D5(G45-Y51) RRRRRRRRGGGLTIYFY STAP-2 PH domain–derived peptide Inhibition of cell signalling CellTiter-Glo assay DU-145 Liver Cancer IC50 = 19.4 μM
dbacp06935 6E(V116-M135) RRRRRRRRGGVVELRVPTDLTLLPGHLYMM STAP-2 PH domain–derived peptide Inhibition of cell signalling CellTiter-Glo assay DU-145 Liver Cancer Graph figure 1-D
dbacp06936 6F (I113-P122) RRRRRRRRGGILTVVELRVP STAP-2 PH domain–derived peptide Inhibition of cell signalling CellTiter-Glo assay DU-145 Liver Cancer Graph figure 1-D
dbacp06937 TAT-2D5 GRKKRRQRRRPPQGGLTIYFY STAP-2 PH domain–derived peptide Inhibition of cell signalling CellTiter-Glo assay DU-145 Liver Cancer Graph figure 1-G
dbacp06938 HTLV-II-Rex-2D5 TRRQRTRRARRNRGGLTIYFY STAP-2 PH domain–derived peptide Inhibition of cell signalling CellTiter-Glo assay DU-145 Liver Cancer Graph figure 1-G
dbacp06939 FHV-2D5 RRRRNRTRRNRRRVRGGLTIYFY STAP-2 PH domain–derived peptide Inhibition of cell signalling CellTiter-Glo assay DU-145 Liver Cancer Graph figure 1-G
dbacp07009 ST101 vaeareelerlearlgqargelkkwkmrrnqfwlklqr Synthetic Prevents C/EBPβ dimerization, induces degradation Annexin V/ PI staining assay DU-145 Prostate Cancer mean EC50 value of 2.1 ± 0.4 μmol/L
dbacp07105 rScyreprocin MKEDSNILDKTAKMTKQNKALLFTAGGAAAFMAGYYYYHCNYRNPAPKKSGSTTSQDKTDAQAVQSIPSPSGNKGKESKDPKVKHHHHHH Recombinant product of Scyreprocin Membrane disruption triggers ROS-mediated apoptosis MTS assay DU-145 Prostate cancer IC50 = 1158.30 µM
dbacp07938 Pantinin-1 GILGKLWEGFKSIV Synthetic Selective binding, membrane disruption, apoptosis MTS assay DU-145 Prostate Cancer IC50 = 47.5 ± 2.0 µM
dbacp07940 Pantinin-2 IFGAIWKGISSLL Synthetic Selective binding, membrane disruption, apoptosis MTS assay DU-145 Prostate Cancer IC50 = 16.5 ± 1.0 µM
dbacp07942 Pantinin-3 FLSTIWNGIKSLL Synthetic Selective binding, membrane disruption, apoptosis MTS assay DU-145 Prostate Cancer IC50 = 17.3 ± 1.0 µM