dbACP: A Comprehensive Database of Anti-Cancer Peptides

187 result(s) have been found!

Accession Name Sequence Source/Organism Mechanism Assay Type Cell Line Cancer Type Activity
dbacp00704 10a NA Synthetic b2,2-amino acid derivatives Induction of apoptosis; Disruption of cell membrane MTT/MTS assay Ramos Lymphoma cancer IC50 : 28 µM
dbacp00705 10b NA Synthetic b2,2-amino acid derivatives Induction of apoptosis; Disruption of cell membrane MTT/MTS assay Ramos Lymphoma cancer IC50 : 11.4 µM
dbacp00706 10c NA Synthetic b2,2-amino acid derivatives Induction of apoptosis; Disruption of cell membrane MTT/MTS assay Ramos Lymphoma cancer IC50 : 6.6 µM
dbacp00707 11a NA Synthetic b2,2-amino acid derivatives Induction of apoptosis; Disruption of cell membrane MTT/MTS assay Ramos Lymphoma cancer IC50 : 5.2 µM
dbacp00708 11b NA Synthetic b2,2-amino acid derivatives Induction of apoptosis; Disruption of cell membrane MTT/MTS assay Ramos Lymphoma cancer IC50 : 19 µM
dbacp00709 11c NA Synthetic b2,2-amino acid derivatives Induction of apoptosis; Disruption of cell membrane MTT/MTS assay Ramos Lymphoma cancer IC50 : 7.2 µM
dbacp00710 12a NA Synthetic b2,2-amino acid derivatives Induction of apoptosis; Disruption of cell membrane MTT/MTS assay Ramos Lymphoma cancer IC50 : 6.1 µM
dbacp00711 12b NA Synthetic b2,2-amino acid derivatives Induction of apoptosis; Disruption of cell membrane MTT/MTS assay Ramos Lymphoma cancer IC50 : 27 µM
dbacp00712 12c NA Synthetic b2,2-amino acid derivatives Induction of apoptosis; Disruption of cell membrane MTT/MTS assay Ramos Lymphoma cancer IC50 : 14 µM
dbacp00722 5a NA Not found Induction of apoptosis; Disruption of cell membrane MTT/MTS assay Ramos Lymphoma cancer IC50 : 10.6 µM
dbacp00723 5b NA Not found Induction of apoptosis; Disruption of cell membrane MTT/MTS assay Ramos Lymphoma cancer IC50 : 7.1 µM
dbacp00724 5c NA Not found Induction of apoptosis; Disruption of cell membrane MTT/MTS assay Ramos Lymphoma cancer IC50 : 4.1 µM
dbacp00727 6a NA Not found Induction of apoptosis; Disruption of cell membrane MTT/MTS assay Ramos Lymphoma cancer IC50 : 14.4 µM
dbacp00728 6b NA Not found Induction of apoptosis; Disruption of cell membrane MTT/MTS assay Ramos Lymphoma cancer IC50 : 11.0 µM
dbacp00729 6c NA Not found Induction of apoptosis; Disruption of cell membrane MTT/MTS assay Ramos Lymphoma cancer IC50 : 4.3 µM
dbacp00730 7a NA Not found Induction of apoptosis; Disruption of cell membrane MTT/MTS assay Ramos Lymphoma cancer IC50 : >63 µM
dbacp00731 7b NA Not found Induction of apoptosis; Disruption of cell membrane MTT/MTS assay Ramos Lymphoma cancer IC50 : >78 µM
dbacp00732 7c NA Not found Induction of apoptosis; Disruption of cell membrane MTT/MTS assay Ramos Lymphoma cancer IC50 : 79 µM
dbacp00733 8a NA Not found Induction of apoptosis; Disruption of cell membrane MTT/MTS assay Ramos Lymphoma cancer IC50 : 136 µM
dbacp00734 8b NA Not found Induction of apoptosis; Disruption of cell membrane MTT/MTS assay Ramos Lymphoma cancer IC50 : >254 µM
dbacp00735 8c NA Not found Induction of apoptosis; Disruption of cell membrane MTT/MTS assay Ramos Lymphoma cancer IC50 : 107 µM
dbacp00736 9a NA Not found Induction of apoptosis; Disruption of cell membrane MTT/MTS assay Ramos Lymphoma cancer IC50 : 31 µM
dbacp00737 9b NA Not found Induction of apoptosis; Disruption of cell membrane MTT/MTS assay Ramos Lymphoma cancer IC50 : 2.3 µM
dbacp00738 9c NA Not found Induction of apoptosis; Disruption of cell membrane MTT/MTS assay Ramos Lymphoma cancer IC50 : 3.1 µM
dbacp01933 Brevinin-1BW FLPLLAGLAASFLPTIFCKISRKC Skin, Black-spotted Frog, East Asia Disruption of cell membrane Not specified Not found Not found Not found
dbacp02375 CecropinXJ RWKIFKKIEKMGRNIRDGIVKAGPAIEVLGSAKAIGK Larvae, Domestic silk moth Disruption of cell membrane Not specified Not found Not found Not found
dbacp02627 D-SVS-1 kvkvkvkvPptkvkvkvk Synthetic peptide Disruption of cell membranes MTT/MTS assay A-549 Lung cancer IC50 : 3.2 ± 0.6 µM
dbacp02628 D-SVS-1 kvkvkvkvPptkvkvkvk Synthetic peptide Disruption of cell membranes MTT/MTS assay KB Oral cancer IC50 : 4.5 ± 0.5 µM
dbacp02629 D-SVS-1 kvkvkvkvPptkvkvkvk Synthetic peptide Disruption of cell membranes MTT/MTS assay MCF-7 Breast cancer IC50 : 4.7 ± 0.4 µM
dbacp02630 D-SVS-1 kvkvkvkvPptkvkvkvk Synthetic peptide Disruption of cell membranes MTT/MTS assay MDA-MB-436 Breast cancer IC50 : 3.2 ± 0.4 µM
dbacp02688 Dermaseptin-PH MDILKKSLFLILFLGVVSLSICEEEKRENEEEMEQDDEQSEMKRALWKEVLKNAGKAALNEINNLVQGGQ Northern orange-legged leaf frog Disruption of cell membranes MTT assay, Lactate dehydrogenase (LDH) assay U251MG Neuronal glioblastoma IC50 : 17.44 - 49.51 μM
dbacp02689 Dermaseptin-PH MDILKKSLFLILFLGVVSLSICEEEKRENEEEMEQDDEQSEMKRALWKEVLKNAGKAALNEINNLVQGGQ Northern orange-legged leaf frog Disruption of cell membranes MTT assay, Lactate dehydrogenase (LDH) assay MCF-7 Breast cancer IC50 : 17.44 - 49.51 μM
dbacp02690 Dermaseptin-PH MDILKKSLFLILFLGVVSLSICEEEKRENEEEMEQDDEQSEMKRALWKEVLKNAGKAALNEINNLVQGGQ Northern orange-legged leaf frog Disruption of cell membranes MTT assay, Lactate dehydrogenase (LDH) assay PANC-1 Pancreatic cancer IC50 : 17.44 - 49.51 μM
dbacp02691 Dermaseptin-PH MDILKKSLFLILFLGVVSLSICEEEKRENEEEMEQDDEQSEMKRALWKEVLKNAGKAALNEINNLVQGGQ Northern orange-legged leaf frog Disruption of cell membranes MTT assay, Lactate dehydrogenase (LDH) assay NCl-H157 Lung cancer IC50 : 17.44 - 49.51 μM
dbacp02692 Dermaseptin-PH MDILKKSLFLILFLGVVSLSICEEEKRENEEEMEQDDEQSEMKRALWKEVLKNAGKAALNEINNLVQGGQ Northern orange-legged leaf frog Disruption of cell membranes MTT assay, Lactate dehydrogenase (LDH) assay PC-3 Prostate carcinoma IC50 : 17.44 - 49.51 μM
dbacp02693 Dermaseptin-PH (DRS-PH) MDILKKSLFLILFLGVVSLSICEEEKRENEEEMEQDDEQSEMKRALWKEVLKNAGKAALNEINNLVQGGQ Northern orange-legged leaf frog Disruption of cell membranes MTT assay MCF-7 Brain tumor IC50 : 7.44 μM
dbacp02694 Dermaseptin-PH (DRS-PH) MDILKKSLFLILFLGVVSLSICEEEKRENEEEMEQDDEQSEMKRALWKEVLKNAGKAALNEINNLVQGGQ Northern orange-legged leaf frog Disruption of cell membranes MTT assay MCF-7 Breast cancer IC50 : 7.44 μM
dbacp02695 Dermaseptin-PH (DRS-PH) MDILKKSLFLILFLGVVSLSICEEEKRENEEEMEQDDEQSEMKRALWKEVLKNAGKAALNEINNLVQGGQ Northern orange-legged leaf frog Disruption of cell membranes MTT assay MCF-7 pancreatic cancer IC50 : 7.44 μM
dbacp02696 Dermaseptin-PH (DRS-PH) MDILKKSLFLILFLGVVSLSICEEEKRENEEEMEQDDEQSEMKRALWKEVLKNAGKAALNEINNLVQGGQ Northern orange-legged leaf frog Disruption of cell membranes MTT assay MCF-7 Lung cancer IC50 : 7.44 μM
dbacp02697 Dermaseptin-PH (DRS-PH) MDILKKSLFLILFLGVVSLSICEEEKRENEEEMEQDDEQSEMKRALWKEVLKNAGKAALNEINNLVQGGQ Northern orange-legged leaf frog Disruption of cell membranes MTT assay MCF-7 Prostate cancer IC50 : 7.44 μM
dbacp02698 Dermaseptin-PH (DRS-PH) MDILKKSLFLILFLGVVSLSICEEEKRENEEEMEQDDEQSEMKRALWKEVLKNAGKAALNEINNLVQGGQ Northern orange-legged leaf frog Disruption of cell membranes MTT assay U251MG Brain tumor IC50 : 49.51 μM
dbacp02699 Dermaseptin-PH (DRS-PH) MDILKKSLFLILFLGVVSLSICEEEKRENEEEMEQDDEQSEMKRALWKEVLKNAGKAALNEINNLVQGGQ Northern orange-legged leaf frog Disruption of cell membranes MTT assay U251MG Breast cancer IC50 : 49.51 μM
dbacp02700 Dermaseptin-PH (DRS-PH) MDILKKSLFLILFLGVVSLSICEEEKRENEEEMEQDDEQSEMKRALWKEVLKNAGKAALNEINNLVQGGQ Northern orange-legged leaf frog Disruption of cell membranes MTT assay U251MG Pancreatic cancer IC50 : 49.51 μM
dbacp02701 Dermaseptin-PH (DRS-PH) MDILKKSLFLILFLGVVSLSICEEEKRENEEEMEQDDEQSEMKRALWKEVLKNAGKAALNEINNLVQGGQ Northern orange-legged leaf frog Disruption of cell membranes MTT assay U251MG Lung cancer IC50 : 49.51 μM
dbacp02702 Dermaseptin-PH (DRS-PH) MDILKKSLFLILFLGVVSLSICEEEKRENEEEMEQDDEQSEMKRALWKEVLKNAGKAALNEINNLVQGGQ Northern orange-legged leaf frog Disruption of cell membranes MTT assay U251MG Prostate cancer IC50 : 49.51 μM
dbacp02703 Dermaseptin-PH (DRS-PH) MDILKKSLFLILFLGVVSLSICEEEKRENEEEMEQDDEQSEMKRALWKEVLKNAGKAALNEINNLVQGGQ Northern orange-legged leaf frog Disruption of cell membranes MTT assay H157 Brain tumor IC50 : 25.51 μM
dbacp02704 Dermaseptin-PH (DRS-PH) MDILKKSLFLILFLGVVSLSICEEEKRENEEEMEQDDEQSEMKRALWKEVLKNAGKAALNEINNLVQGGQ Northern orange-legged leaf frog Disruption of cell membranes MTT assay H157 Breast cancer IC50 : 25.51 μM
dbacp02705 Dermaseptin-PH (DRS-PH) MDILKKSLFLILFLGVVSLSICEEEKRENEEEMEQDDEQSEMKRALWKEVLKNAGKAALNEINNLVQGGQ Northern orange-legged leaf frog Disruption of cell membranes MTT assay H157 Pancreatic cancer IC50 : 25.51 μM
dbacp02706 Dermaseptin-PH (DRS-PH) MDILKKSLFLILFLGVVSLSICEEEKRENEEEMEQDDEQSEMKRALWKEVLKNAGKAALNEINNLVQGGQ Northern orange-legged leaf frog Disruption of cell membranes MTT assay H157 Lung cancer IC50 : 25.51 μM
dbacp02707 Dermaseptin-PH (DRS-PH) MDILKKSLFLILFLGVVSLSICEEEKRENEEEMEQDDEQSEMKRALWKEVLKNAGKAALNEINNLVQGGQ Northern orange-legged leaf frog Disruption of cell membranes MTT assay H157 Prostate cancer IC50 : 25.51 μM
dbacp02708 Dermaseptin-PH (DRS-PH) MDILKKSLFLILFLGVVSLSICEEEKRENEEEMEQDDEQSEMKRALWKEVLKNAGKAALNEINNLVQGGQ Northern orange-legged leaf frog Disruption of cell membranes MTT assay PC-3 Brain tumor IC50 : 21.78 μM
dbacp02709 Dermaseptin-PH (DRS-PH) MDILKKSLFLILFLGVVSLSICEEEKRENEEEMEQDDEQSEMKRALWKEVLKNAGKAALNEINNLVQGGQ Northern orange-legged leaf frog Disruption of cell membranes MTT assay PC-3 Breast cancer IC50 : 21.78 μM
dbacp02710 Dermaseptin-PH (DRS-PH) MDILKKSLFLILFLGVVSLSICEEEKRENEEEMEQDDEQSEMKRALWKEVLKNAGKAALNEINNLVQGGQ Northern orange-legged leaf frog Disruption of cell membranes MTT assay PC-3 Pancreatic cancer IC50 : 21.78 μM
dbacp02711 Dermaseptin-PH (DRS-PH) MDILKKSLFLILFLGVVSLSICEEEKRENEEEMEQDDEQSEMKRALWKEVLKNAGKAALNEINNLVQGGQ Northern orange-legged leaf frog Disruption of cell membranes MTT assay PC-3 Lung cancer IC50 : 21.78 μM
dbacp02712 Dermaseptin-PH (DRS-PH) MDILKKSLFLILFLGVVSLSICEEEKRENEEEMEQDDEQSEMKRALWKEVLKNAGKAALNEINNLVQGGQ Northern orange-legged leaf frog Disruption of cell membranes MTT assay PC-3 Prostate cancer IC50 : 21.78 μM
dbacp02713 Dermaseptin-PH (DRS-PH) MDILKKSLFLILFLGVVSLSICEEEKRENEEEMEQDDEQSEMKRALWKEVLKNAGKAALNEINNLVQGGQ Northern orange-legged leaf frog Disruption of cell membranes MTT assay PANC-1 Brain tumor IC50 : 28.95 μM
dbacp02714 Dermaseptin-PH (DRS-PH) MDILKKSLFLILFLGVVSLSICEEEKRENEEEMEQDDEQSEMKRALWKEVLKNAGKAALNEINNLVQGGQ Northern orange-legged leaf frog Disruption of cell membranes MTT assay PANC-1 Breast cancer IC50 : 28.95 μM
dbacp02715 Dermaseptin-PH (DRS-PH) MDILKKSLFLILFLGVVSLSICEEEKRENEEEMEQDDEQSEMKRALWKEVLKNAGKAALNEINNLVQGGQ Northern orange-legged leaf frog Disruption of cell membranes MTT assay PANC-1 Pancreatic cancer IC50 : 28.95 μM
dbacp02716 Dermaseptin-PH (DRS-PH) MDILKKSLFLILFLGVVSLSICEEEKRENEEEMEQDDEQSEMKRALWKEVLKNAGKAALNEINNLVQGGQ Northern orange-legged leaf frog Disruption of cell membranes MTT assay PANC-1 Lung cancer IC50 : 28.95 μM
dbacp02717 Dermaseptin-PH (DRS-PH) MDILKKSLFLILFLGVVSLSICEEEKRENEEEMEQDDEQSEMKRALWKEVLKNAGKAALNEINNLVQGGQ Northern orange-legged leaf frog Disruption of cell membranes MTT assay PANC-1 Prostate cancer IC50 : 28.95 μM
dbacp02718 Dermaseptin-PH (DRS-PH) MDILKKSLFLILFLGVVSLSICEEEKRENEEEMEQDDEQSEMKRALWKEVLKNAGKAALNEINNLVQGGQ Northern orange-legged leaf frog Disruption of cell membranes MTT assay HMEC-1 Brain tumor IC50 : 51.04 μM
dbacp02719 Dermaseptin-PH (DRS-PH) MDILKKSLFLILFLGVVSLSICEEEKRENEEEMEQDDEQSEMKRALWKEVLKNAGKAALNEINNLVQGGQ Northern orange-legged leaf frog Disruption of cell membranes MTT assay HMEC-1 Breast cancer IC50 : 51.04 μM
dbacp02720 Dermaseptin-PH (DRS-PH) MDILKKSLFLILFLGVVSLSICEEEKRENEEEMEQDDEQSEMKRALWKEVLKNAGKAALNEINNLVQGGQ Northern orange-legged leaf frog Disruption of cell membranes MTT assay HMEC-1 Pancreatic cancer IC50 : 51.04 μM
dbacp02721 Dermaseptin-PH (DRS-PH) MDILKKSLFLILFLGVVSLSICEEEKRENEEEMEQDDEQSEMKRALWKEVLKNAGKAALNEINNLVQGGQ Northern orange-legged leaf frog Disruption of cell membranes MTT assay HMEC-1 Lung cancer IC50 : 51.04 μM
dbacp02722 Dermaseptin-PH (DRS-PH) MDILKKSLFLILFLGVVSLSICEEEKRENEEEMEQDDEQSEMKRALWKEVLKNAGKAALNEINNLVQGGQ Northern orange-legged leaf frog Disruption of cell membranes MTT assay HMEC-1 Prostate cancer IC50 : 51.04 μM
dbacp02731 Dermaseptin-PT9 GLWSKIKDAAKTAGKAALGFVNEMV Brownbelly leaf frog Disruption of cell membranes MTT assay, Lactate dehydrogenase (LDH) assay U251MG Neuronal glioblastoma IC50 : 8.64 - 18.51 μM
dbacp02732 Dermaseptin-PT9 GLWSKIKDAAKTAGKAALGFVNEMV Brownbelly leaf frog Disruption of cell membranes MTT assay, Lactate dehydrogenase (LDH) assay MCF-7 Breast cancer IC50 : 8.64 - 18.51 μM
dbacp02733 Dermaseptin-PT9 GLWSKIKDAAKTAGKAALGFVNEMV Brownbelly leaf frog Disruption of cell membranes MTT assay, Lactate dehydrogenase (LDH) assay PANC-1 Pancreatic cancer IC50 : 8.64 - 18.51 μM
dbacp02734 Dermaseptin-PT9 GLWSKIKDAAKTAGKAALGFVNEMV Brownbelly leaf frog Disruption of cell membranes MTT assay, Lactate dehydrogenase (LDH) assay NCl-H157 Lung cancer IC50 : 8.64 - 18.51 μM
dbacp02735 Dermaseptin-PT9 GLWSKIKDAAKTAGKAALGFVNEMV Brownbelly leaf frog Disruption of cell membranes MTT assay, Lactate dehydrogenase (LDH) assay PC-3 Prostate carcinoma IC50 : 8.64 - 18.51 μM
dbacp02736 Dermaseptin-PT9 GLWSKIKDAAKTAGKAALGFVNEMV Skin secretion, Brownbelly leaf frog, Purchased in Peru, South America Disruption of cell membranes MTT assay, Lactate dehydrogenase (LDH) assay U251MG Neuronal glioblastoma IC50 : 8.64 - 18.51 μM
dbacp02737 Dermaseptin-PT9 GLWSKIKDAAKTAGKAALGFVNEMV Skin secretion, Brownbelly leaf frog, Purchased in Peru, South America Disruption of cell membranes MTT assay, Lactate dehydrogenase (LDH) assay MCF-7 Breast cancer IC50 : 8.64 - 18.51 μM
dbacp02738 Dermaseptin-PT9 GLWSKIKDAAKTAGKAALGFVNEMV Skin secretion, Brownbelly leaf frog, Purchased in Peru, South America Disruption of cell membranes MTT assay, Lactate dehydrogenase (LDH) assay PANC-1 Pancreatic cancer IC50 : 8.64 - 18.51 μM
dbacp02739 Dermaseptin-PT9 GLWSKIKDAAKTAGKAALGFVNEMV Skin secretion, Brownbelly leaf frog, Purchased in Peru, South America Disruption of cell membranes MTT assay, Lactate dehydrogenase (LDH) assay NCl-H157 Lung cancer IC50 : 8.64 - 18.51 μM
dbacp02740 Dermaseptin-PT9 GLWSKIKDAAKTAGKAALGFVNEMV Skin secretion, Brownbelly leaf frog, Purchased in Peru, South America Disruption of cell membranes MTT assay, Lactate dehydrogenase (LDH) assay PC-3 Prostate carcinoma IC50 : 8.64 - 18.51 μM
dbacp03485 K8, 23-DPT9 MDILKKSKFLILFLGVVSLSICKEEKRENEEEMEQDDEQSEMKRALWKEVLKNAGKAALNEINNLVQGGQ Northern orange-legged leaf frog Disruption of cell membranes MTT assay MCF-7 Brain tumor IC50 : 8.64μM
dbacp03486 K8, 23-DPT9 MDILKKSKFLILFLGVVSLSICKEEKRENEEEMEQDDEQSEMKRALWKEVLKNAGKAALNEINNLVQGGQ Northern orange-legged leaf frog Disruption of cell membranes MTT assay MCF-7 Breast cancer IC50 : 8.64μM
dbacp03487 K8, 23-DPT9 MDILKKSKFLILFLGVVSLSICKEEKRENEEEMEQDDEQSEMKRALWKEVLKNAGKAALNEINNLVQGGQ Northern orange-legged leaf frog Disruption of cell membranes MTT assay MCF-7 Pancreatic cancer IC50 : 8.64μM
dbacp03488 K8, 23-DPT9 MDILKKSKFLILFLGVVSLSICKEEKRENEEEMEQDDEQSEMKRALWKEVLKNAGKAALNEINNLVQGGQ Northern orange-legged leaf frog Disruption of cell membranes MTT assay MCF-7 Lung cancer IC50 : 8.64μM
dbacp03489 K8, 23-DPT9 MDILKKSKFLILFLGVVSLSICKEEKRENEEEMEQDDEQSEMKRALWKEVLKNAGKAALNEINNLVQGGQ Northern orange-legged leaf frog Disruption of cell membranes MTT assay MCF-7 Prostate cancer IC50 : 8.64μM
dbacp03490 K8, 23-DPT9 MDILKKSKFLILFLGVVSLSICKEEKRENEEEMEQDDEQSEMKRALWKEVLKNAGKAALNEINNLVQGGQ Northern orange-legged leaf frog Disruption of cell membranes MTT assay U251MG Brain tumor IC50 : 18.51μM
dbacp03491 K8, 23-DPT9 MDILKKSKFLILFLGVVSLSICKEEKRENEEEMEQDDEQSEMKRALWKEVLKNAGKAALNEINNLVQGGQ Northern orange-legged leaf frog Disruption of cell membranes MTT assay U251MG Breast cancer IC50 : 18.51μM
dbacp03492 K8, 23-DPT9 MDILKKSKFLILFLGVVSLSICKEEKRENEEEMEQDDEQSEMKRALWKEVLKNAGKAALNEINNLVQGGQ Northern orange-legged leaf frog Disruption of cell membranes MTT assay U251MG Pancreatic cancer IC50 : 18.51μM
dbacp03493 K8, 23-DPT9 MDILKKSKFLILFLGVVSLSICKEEKRENEEEMEQDDEQSEMKRALWKEVLKNAGKAALNEINNLVQGGQ Northern orange-legged leaf frog Disruption of cell membranes MTT assay U251MG Lung cancer IC50 : 18.51μM
dbacp03494 K8, 23-DPT9 MDILKKSKFLILFLGVVSLSICKEEKRENEEEMEQDDEQSEMKRALWKEVLKNAGKAALNEINNLVQGGQ Northern orange-legged leaf frog Disruption of cell membranes MTT assay U251MG Prostate cancer IC50 : 18.51μM
dbacp03495 K8, 23-DPT9 MDILKKSKFLILFLGVVSLSICKEEKRENEEEMEQDDEQSEMKRALWKEVLKNAGKAALNEINNLVQGGQ Northern orange-legged leaf frog Disruption of cell membranes MTT assay H157 Brain tumor IC50 : 9.88μM
dbacp03496 K8, 23-DPT9 MDILKKSKFLILFLGVVSLSICKEEKRENEEEMEQDDEQSEMKRALWKEVLKNAGKAALNEINNLVQGGQ Northern orange-legged leaf frog Disruption of cell membranes MTT assay H157 Breast cancer IC50 : 9.88μM
dbacp03497 K8, 23-DPT9 MDILKKSKFLILFLGVVSLSICKEEKRENEEEMEQDDEQSEMKRALWKEVLKNAGKAALNEINNLVQGGQ Northern orange-legged leaf frog Disruption of cell membranes MTT assay H157 Pancreatic cancer IC50 : 9.88μM
dbacp03498 K8, 23-DPT9 MDILKKSKFLILFLGVVSLSICKEEKRENEEEMEQDDEQSEMKRALWKEVLKNAGKAALNEINNLVQGGQ Northern orange-legged leaf frog Disruption of cell membranes MTT assay H157 Lung cancer IC50 : 9.88μM
dbacp03499 K8, 23-DPT9 MDILKKSKFLILFLGVVSLSICKEEKRENEEEMEQDDEQSEMKRALWKEVLKNAGKAALNEINNLVQGGQ Northern orange-legged leaf frog Disruption of cell membranes MTT assay H157 Prostate cancer IC50 : 9.88μM
dbacp03500 K8, 23-DPT9 MDILKKSKFLILFLGVVSLSICKEEKRENEEEMEQDDEQSEMKRALWKEVLKNAGKAALNEINNLVQGGQ Northern orange-legged leaf frog Disruption of cell membranes MTT assay PC-3 Brain tumor IC50 : 9.97μM
dbacp03501 K8, 23-DPT9 MDILKKSKFLILFLGVVSLSICKEEKRENEEEMEQDDEQSEMKRALWKEVLKNAGKAALNEINNLVQGGQ Northern orange-legged leaf frog Disruption of cell membranes MTT assay PC-3 Breast cancer IC50 : 9.97μM
dbacp03502 K8, 23-DPT9 MDILKKSKFLILFLGVVSLSICKEEKRENEEEMEQDDEQSEMKRALWKEVLKNAGKAALNEINNLVQGGQ Northern orange-legged leaf frog Disruption of cell membranes MTT assay PC-3 Pancreatic cancer IC50 : 9.97μM
dbacp03503 K8, 23-DPT9 MDILKKSKFLILFLGVVSLSICKEEKRENEEEMEQDDEQSEMKRALWKEVLKNAGKAALNEINNLVQGGQ Northern orange-legged leaf frog Disruption of cell membranes MTT assay PC-3 Lung cancer IC50 : 9.97μM
dbacp03504 K8, 23-DPT9 MDILKKSKFLILFLGVVSLSICKEEKRENEEEMEQDDEQSEMKRALWKEVLKNAGKAALNEINNLVQGGQ Northern orange-legged leaf frog Disruption of cell membranes MTT assay PC-3 Prostate cancer IC50 : 9.97μM
dbacp03505 K8, 23-DPT9 MDILKKSKFLILFLGVVSLSICKEEKRENEEEMEQDDEQSEMKRALWKEVLKNAGKAALNEINNLVQGGQ Northern orange-legged leaf frog Disruption of cell membranes MTT assay PANC-1 Brain tumor IC50 : 11.17μM
dbacp03506 K8, 23-DPT9 MDILKKSKFLILFLGVVSLSICKEEKRENEEEMEQDDEQSEMKRALWKEVLKNAGKAALNEINNLVQGGQ Northern orange-legged leaf frog Disruption of cell membranes MTT assay PANC-1 Breast cancer IC50 : 11.17μM
dbacp03507 K8, 23-DPT9 MDILKKSKFLILFLGVVSLSICKEEKRENEEEMEQDDEQSEMKRALWKEVLKNAGKAALNEINNLVQGGQ Northern orange-legged leaf frog Disruption of cell membranes MTT assay PANC-1 Pancreatic cancer IC50 : 11.17μM
dbacp03508 K8, 23-DPT9 MDILKKSKFLILFLGVVSLSICKEEKRENEEEMEQDDEQSEMKRALWKEVLKNAGKAALNEINNLVQGGQ Northern orange-legged leaf frog Disruption of cell membranes MTT assay PANC-1 Lung cancer IC50 : 11.17μM
dbacp03509 K8, 23-DPT9 MDILKKSKFLILFLGVVSLSICKEEKRENEEEMEQDDEQSEMKRALWKEVLKNAGKAALNEINNLVQGGQ Northern orange-legged leaf frog Disruption of cell membranes MTT assay PANC-1 Prostate cancer IC50 : 11.17μM
dbacp03510 K8, 23-DPT9 MDILKKSKFLILFLGVVSLSICKEEKRENEEEMEQDDEQSEMKRALWKEVLKNAGKAALNEINNLVQGGQ Northern orange-legged leaf frog Disruption of cell membranes MTT assay HMEC-1 Brain tumor IC50 : 48.80μM
dbacp03511 K8, 23-DPT9 MDILKKSKFLILFLGVVSLSICKEEKRENEEEMEQDDEQSEMKRALWKEVLKNAGKAALNEINNLVQGGQ Northern orange-legged leaf frog Disruption of cell membranes MTT assay HMEC-1 Breast cancer IC50 : 48.80μM
dbacp03512 K8, 23-DPT9 MDILKKSKFLILFLGVVSLSICKEEKRENEEEMEQDDEQSEMKRALWKEVLKNAGKAALNEINNLVQGGQ Northern orange-legged leaf frog Disruption of cell membranes MTT assay HMEC-1 Pancreatic cancer IC50 : 48.80μM
dbacp03513 K8, 23-DPT9 MDILKKSKFLILFLGVVSLSICKEEKRENEEEMEQDDEQSEMKRALWKEVLKNAGKAALNEINNLVQGGQ Northern orange-legged leaf frog Disruption of cell membranes MTT assay HMEC-1 Lung cancer IC50 : 48.80μM
dbacp03514 K8, 23-DPT9 MDILKKSKFLILFLGVVSLSICKEEKRENEEEMEQDDEQSEMKRALWKEVLKNAGKAALNEINNLVQGGQ Northern orange-legged leaf frog Disruption of cell membranes MTT assay HMEC-1 Prostate cancer IC50 : 48.80μM
dbacp03676 Lasioglossin LL-I VNWKKVLGKIIKVAK The Eusocial Bee, Broad-faced Furrow Bee Disruption of cell membrane Not specified Not found Not specified LC50 : > 200 µM
dbacp03677 Lasioglossin LL-I VNWKKVLGKIIKVAK The Eusocial Bee, Broad-faced Furrow Bee Disruption of cell membrane Not specified Not found Not specified Not found
dbacp03679 Lasioglossin LL-II VNWKKILGKIIKVAK The Eusocial Bee, Broad-faced Furrow Bee Disruption of cell membrane Not specified Not found Not specified LC50 : > 200 µM
dbacp03680 Lasioglossin LL-II VNWKKILGKIIKVAK The Eusocial Bee, Broad-faced Furrow Bee Disruption of cell membrane Not specified Not found Not specified Not found
dbacp03688 Lasioglossin LL-III VNWKKILGKIIKVVK The Eusocial Bee, Broad-faced Furrow Bee Disruption of cell membrane Not specified Not found Not specified LC50 : > 200 µM
dbacp03689 Lasioglossin LL-III VNWKKILGKIIKVVK The Eusocial Bee, Broad-faced Furrow Bee Disruption of cell membrane Not specified Not found Not specified Not found
dbacp05525 Phylloseptin-PBa1 FLSLIPHIASGIASLVKNF Burmeister's leaf frog, Brazil, South America Disruption of cell membranes MTT cell viability assay U145 Prostate cancer IC50 : approx. 0.29 µM
dbacp05526 Phylloseptin-PBa1 FLSLIPHIASGIASLVKNF Burmeister's leaf frog, Brazil, South America Disruption of cell membranes MTT cell viability assay PC3 Prostate cancer IC50 : approx. 0.29 µM
dbacp05527 Phylloseptin-PBa1 FLSLIPHIASGIASLVKNF Burmeister's leaf frog, Brazil, South America Disruption of cell membranes MTT cell viability assay LNCaP Prostate cancer IC50 : approx. 0.29 µM
dbacp05528 Phylloseptin-PBa1 FLSLIPHIASGIASLVKNF Burmeister's leaf frog, Brazil, South America Disruption of cell membranes MTT cell viability assay H838 Lung cancer IC50 : approx. 0.29 µM
dbacp05529 Phylloseptin-PBa1 FLSLIPHIASGIASLVKNF Burmeister's leaf frog, Brazil, South America Disruption of cell membranes MTT cell viability assay H460 Lung cancer IC50 : approx. 0.29 µM
dbacp05530 Phylloseptin-PBa1 FLSLIPHIASGIASLVKNF Burmeister's leaf frog, Brazil, South America Disruption of cell membranes MTT cell viability assay H23 Lung cancer IC50 : approx. 0.29 µM
dbacp05531 Phylloseptin-PBa1 FLSLIPHIASGIASLVKNF Burmeister's leaf frog, Brazil, South America Disruption of cell membranes MTT cell viability assay H157 Lung cancer IC50 : approx. 0.29 µM
dbacp05532 Phylloseptin-PBa1 FLSLIPHIASGIASLVKNF Burmeister's leaf frog, Brazil, South America Disruption of cell membranes MTT cell viability assay MB231 Breast cancer IC50 : approx. 0.29 µM
dbacp05533 Phylloseptin-PBa1 FLSLIPHIASGIASLVKNF Burmeister's leaf frog, Brazil, South America Disruption of cell membranes MTT cell viability assay MB435s Breast cancer IC50 : approx. 0.29 µM
dbacp05534 Phylloseptin-PBa1 FLSLIPHIASGIASLVKNF Burmeister's leaf frog, Brazil, South America Disruption of cell membranes MTT cell viability assay MCF-7 Breast cancer IC50 : approx. 0.29 µM
dbacp05535 Phylloseptin-PBa1 FLSLIPHIASGIASLVKNF Burmeister's leaf frog, Brazil, South America Disruption of cell membranes MTT cell viability assay U251MG Neurospongioma IC50 : approx. 0.29 µM
dbacp05536 Phylloseptin-PBa2 FLSLLPHIASGIASLVSKF Burmeister's leaf frog, Brazil, South America Disruption of cell membranes MTT cell viability assay U145 Prostate cancer IC50 : approx. 0.50 µM
dbacp05537 Phylloseptin-PBa2 FLSLLPHIASGIASLVSKF Burmeister's leaf frog, Brazil, South America Disruption of cell membranes MTT cell viability assay PC3 Prostate cancer IC50 : approx. 0.50 µM
dbacp05538 Phylloseptin-PBa2 FLSLLPHIASGIASLVSKF Burmeister's leaf frog, Brazil, South America Disruption of cell membranes MTT cell viability assay LNCaP Prostate cancer IC50 : approx. 0.50 µM
dbacp05539 Phylloseptin-PBa2 FLSLLPHIASGIASLVSKF Burmeister's leaf frog, Brazil, South America Disruption of cell membranes MTT cell viability assay H838 Lung cancer IC50 : approx. 0.50 µM
dbacp05540 Phylloseptin-PBa2 FLSLLPHIASGIASLVSKF Burmeister's leaf frog, Brazil, South America Disruption of cell membranes MTT cell viability assay H460 Lung cancer IC50 : approx. 0.50 µM
dbacp05541 Phylloseptin-PBa2 FLSLLPHIASGIASLVSKF Burmeister's leaf frog, Brazil, South America Disruption of cell membranes MTT cell viability assay H23 Lung cancer IC50 : approx. 0.50 µM
dbacp05542 Phylloseptin-PBa2 FLSLLPHIASGIASLVSKF Burmeister's leaf frog, Brazil, South America Disruption of cell membranes MTT cell viability assay H157 Lung cancer IC50 : approx. 0.50 µM
dbacp05543 Phylloseptin-PBa2 FLSLLPHIASGIASLVSKF Burmeister's leaf frog, Brazil, South America Disruption of cell membranes MTT cell viability assay MB231 Breast cancer IC50 : approx. 0.50 µM
dbacp05544 Phylloseptin-PBa2 FLSLLPHIASGIASLVSKF Burmeister's leaf frog, Brazil, South America Disruption of cell membranes MTT cell viability assay MB435s Breast cancer IC50 : approx. 0.50 µM
dbacp05545 Phylloseptin-PBa2 FLSLLPHIASGIASLVSKF Burmeister's leaf frog, Brazil, South America Disruption of cell membranes MTT cell viability assay MCF-7 Breast cancer IC50 : approx. 0.50 µM
dbacp05546 Phylloseptin-PBa2 FLSLLPHIASGIASLVSKF Burmeister's leaf frog, Brazil, South America Disruption of cell membranes MTT cell viability assay U251MG neurospongioma IC50 : approx. 0.50 µM
dbacp06154 StigA16 FFKLIPKLVKGLISAF Amino acid substitution, amino acid truncation, animal-derived, natural derivative Disruption of cell membrane MTT assay 3T3 Renal cell adenocarcinoma IC 50 : 13.01 μM
dbacp06155 StigA16 FFKLIPKLVKGLISAF Amino acid substitution, amino acid truncation, animal-derived, natural derivative Disruption of cell membrane MTT assay HeLa Mouse melanoma IC 50 : 13.01 μM
dbacp06156 StigA16 FFKLIPKLVKGLISAF Amino acid substitution, amino acid truncation, animal-derived, natural derivative Disruption of cell membrane MTT assay 786-0 Human cervix adenocarcinoma IC 50 : 13.01 μM
dbacp06157 StigA16 FFKLIPKLVKGLISAF Amino acid substitution, amino acid truncation, animal-derived, natural derivative Disruption of cell membrane MTT assay B16 Human pancreas adenocarcinoma IC 50 : 13.01 μM
dbacp06158 StigA16 FFKLIPKLVKGLISAF Amino acid substitution, amino acid truncation, animal-derived, natural derivative Disruption of cell membrane MTT assay Panc Mouse fibroblast IC 50 : 13.01 μM
dbacp06159 StigA6 FFSLIPKLVKGLISAFK Amino acid substitution, animal-derived, natural derivative Disruption of cell membrane MTT assay 3T3 Renal cell adenocarcinoma IC 50 : 14.01 μM
dbacp06160 StigA6 FFSLIPKLVKGLISAFK Amino acid substitution, animal-derived, natural derivative Disruption of cell membrane MTT assay HeLa Mouse melanoma IC 50 : 14.01 μM
dbacp06161 StigA6 FFSLIPKLVKGLISAFK Amino acid substitution, animal-derived, natural derivative Disruption of cell membrane MTT assay 786-0 Human cervix adenocarcinoma IC 50 : 14.01 μM
dbacp06162 StigA6 FFSLIPKLVKGLISAFK Amino acid substitution, animal-derived, natural derivative Disruption of cell membrane MTT assay B16 Human pancreas adenocarcinoma IC 50 : 14.01 μM
dbacp06163 StigA6 FFSLIPKLVKGLISAFK Amino acid substitution, animal-derived, natural derivative Disruption of cell membrane MTT assay Panc Mouse fibroblast IC 50 : 14.01 μM
dbacp06169 SVS-1 KVKVKVKVpPTKVKVKVK Synthetic peptide Disruption of cell membranes MTT/MTS assay A-549 Lung cancer Not found
dbacp06170 SVS-1 KVKVKVKVpPTKVKVKVK Bovine lactoferrin (Lf-B) Disruption of cell membranes MTT/MTS assay KB Oral cancer Not found
dbacp06171 SVS-1 KVKVKVKVpPTKVKVKVK Synthetic peptide Disruption of cell membranes MTT/MTS assay MCF-7 Breast cancer IC50 : 8.1 ± 0.8 µM
dbacp06172 SVS-1 KVKVKVKVpPTKVKVKVK Synthetic peptide Disruption of cell membranes MTT/MTS assay MDA-MB-436 Breast cancer IC50 : 5.6 ± 0.5 µM
dbacp06173 SVS-2 KVKVKVKVPPTKVKVKVK Synthetic peptide Disruption of cell membranes MTT/MTS assay A-549 Lung cancer IC50 : >100 µM
dbacp06174 SVS-2 KVKVKVKVPPTKVKVKVK Synthetic peptide Disruption of cell membranes MTT/MTS assay KB Oral cancer IC50 : >100 µM
dbacp06175 SVS-2 KVKVKVKVPPTKVKVKVK Synthetic peptide Disruption of cell membranes MTT/MTS assay MCF-7 Breast cancer IC50 : >100 µM
dbacp06176 SVS-2 KVKVKVKVPPTKVKVKVK Synthetic peptide Disruption of cell membranes MTT/MTS assay MDA-MB-436 Breast cancer IC50 : >100 µM
dbacp06388 Turgencin B GIKEML_CnMACAQTVC_KKSGGPLCDTCQAACKALG-NH2 Tunicate Disruption of cell membranes Human cell viability assay A2058 Melanoma cancer IC50 : 4.1μM
dbacp06389 Turgencin A GPKTKAACKMACKLATCGKKPGGWKCKLCELGCDAV Tunicate Disruption of cell membranes Human cell viability assay A2058 Melanoma cancer IC50 : 1.4 μM
dbacp06390 Turgencin A GPKTKAACKMACKLATCGKKPGGWKCKLCELGCDAV-NH2 Tunicate Disruption of cell membranes Human cell viability assay A2058 Melanoma cancer IC50 : 1.4 μM
dbacp06391 Turgencin A GPKTKAACKMACKLATCGKKPGGWKCKLCELGCDAV Tunicate Disruption of cell membranes Human cell viability assay A2058 Melanoma cancer IC50 : 1.4 μM
dbacp06392 Turgencin B GIKEMLCnMACAQTVCKKSGGPLCDTCQAACKALG Tunicate Disruption of cell membranes Human cell viability assay A2059 Melanoma cancer IC50 : 4.1 μM
dbacp06393 Turgencin B GIKEMLCnMACAQTVCKKSGGPLCDTCQAACKALG Tunicate Disruption of cell membranes Human cell viability assay A2059 Melanoma cancer IC50 : 4.1 μM
dbacp06548 Z1 KAAKKWAKAAKKAAKAWKKAA Synthetic Disruption of cell membrane MTT/MTS assay Meth A Skin cancer EC50 : > 211 µM
dbacp06549 Z1 KAAKKWAKAAKKWAKAWKKAA Synthetic Disruption of cell membrane MTT/MTS assay MT-1 Breast cancer EC50 : 186 µM
dbacp06550 Z1 KAAKKWAKAAKKWAKAWKKAA Synthetic Disruption of cell membrane MTT/MTS assay HT-29 Colon cancer EC50 : > 211 µM
dbacp06551 Z10 AAKKWAKAKWAKAKKWAKAA Synthetic Disruption of cell membrane MTT/MTS assay Meth A Skin cancer EC50 : > 211 µM
dbacp06552 Z10 AAKKWAKAKWAKAKKWAKAA Synthetic Disruption of cell membrane MTT/MTS assay MT-1 Breast cancer EC50 : > 211 µM
dbacp06553 Z10 AAKKWAKAKWAKAKKWAKAA Synthetic Disruption of cell membrane MTT/MTS assay HT-29 Colon cancer EC50 : > 211 µM
dbacp06554 Z2 KAAKKWAKAWKKAAKAWKKAA Synthetic Disruption of cell membrane MTT/MTS assay Meth A Skin cancer EC50 : > 211 µM
dbacp06555 Z2 KAAKKWAKAWKKAAKAWKKAA Synthetic Disruption of cell membrane MTT/MTS assay MT-1 Breast cancer EC50 : 173 µM
dbacp06556 Z2 KAAKKWAKAWKKAAKAWKKAA Synthetic Disruption of cell membrane MTT/MTS assay HT-29 Colon cancer EC50 : > 211 µM
dbacp06567 Z3 KAAKKAWKAWKKAAKAAWKKAA Synthetic Disruption of cell membrane MTT/MTS assay Meth A Skin cancer EC50 : >211 µM
dbacp06568 Z3 KAAKKAWKAWKKAAKAAWKKAA Synthetic Disruption of cell membrane MTT/MTS assay MT-1 Breast cancer EC50 : 128 µM
dbacp06569 Z3 KAAKKAWKAWKKAAKAAWKKAA Synthetic Disruption of cell membrane MTT/MTS assay HT-29 Colon cancer EC50 : >211 µM
dbacp06570 Z4 KAAKKAWKAAKKAAKWWKKAA Synthetic Disruption of cell membrane MTT/MTS assay Meth A Skin cancer EC50 : 155 µM
dbacp06571 Z4 KAAKKAWKAAKKAAKWWKKAA Synthetic Disruption of cell membrane MTT/MTS assay MT-1 Breast cancer EC50 : 68 µM
dbacp06572 Z4 KAAKKAWKAAKKAAKWWKKAA Synthetic Disruption of cell membrane MTT/MTS assay HT-29 Colon cancer EC50 : 173 µM
dbacp06583 Z5 KAAKKAWKWAKKAAKWAKKAA Synthetic Disruption of cell membrane MTT/MTS assay Meth A Skin cancer EC50 : 42 µM
dbacp06584 Z5 KAAKKAWKWAKKAAKWAKKAA Synthetic Disruption of cell membrane MTT/MTS assay MT-1 Breast cancer EC50 : 28 µM
dbacp06585 Z5 KAAKKAWKWAKKAAKWAKKAA Synthetic Disruption of cell membrane MTT/MTS assay HT-29 Colon cancer EC50 : 67 µM
dbacp06586 Z6 KWWKKAAKAAKKAAKAAKKWA Synthetic Disruption of cell membrane MTT/MTS assay Meth A Skin cancer EC50 : 17 µM
dbacp06587 Z6 KWWKKAAKAAKKAAKAAKKWA Synthetic Disruption of cell membrane MTT/MTS assay MT-1 Breast cancer EC50 : 16 µM
dbacp06588 Z6 KWWKKAAKAAKKAAKAAKKWA Synthetic Disruption of cell membrane MTT/MTS assay HT-29 Colon cancer EC50 : 31 µM
dbacp06589 Z7 KAAKKAWKAAKKAWKAAKKAA Synthetic Disruption of cell membrane MTT/MTS assay Meth A Skin cancer EC50 : 15 µM
dbacp06590 Z7 KAAKKAWKAAKKAWKAAKKAA Synthetic Disruption of cell membrane MTT/MTS assay MT-1 Breast cancer EC50 : 15 µM
dbacp06591 Z7 KAAKKAWKAAKKAWKAAKKAA Synthetic Disruption of cell membrane MTT/MTS assay HT-29 Colon cancer EC50 : 21 µM
dbacp06592 Z8 AWKKWAKAWKWAKAKWWAKAA Synthetic Disruption of cell membrane MTT/MTS assay Meth A Skin cancer EC50 : 19 µM
dbacp06593 Z8 AWKKWAKAWKWAKAKWWAKAA Synthetic Disruption of cell membrane MTT/MTS assay MT-1 Breast cancer EC50 : 14 µM
dbacp06594 Z8 AWKKWAKAWKWAKAKWWAKAA Synthetic Disruption of cell membrane MTT/MTS assay HT-29 Colon cancer EC50 : 23 µM
dbacp06595 Z9 AAWKWAWAKKWAKAKKWAKAA Synthetic Disruption of cell membrane MTT/MTS assay Meth A Skin cancer EC50 : 9 µM
dbacp06596 Z9 AAWKWAWAKKWAKAKKWAKAA Synthetic Disruption of cell membrane MTT/MTS assay MT-1 Breast cancer EC50 : 16 µM
dbacp06597 Z9 AAWKWAWAKKWAKAKKWAKAA Synthetic Disruption of cell membrane MTT/MTS assay HT-29 Colon cancer EC50 : 13 µM