109 result(s) have been found!
| Accession | Name | Sequence | Source/Organism | Mechanism | Assay Type | Cell Line | Cancer Type | Activity |
|---|---|---|---|---|---|---|---|---|
| dbacp01971 | Brevinin-2R | KLKNFAKGVAQSLLNKASCKLSGQC | Skin, Marsh frog, Europe | Activates the lysosomal-mitochondrial death pathway; Involves autophagy-like cell death | MTT-assay | L929 | Fibrosarcoma | LD50 : 10 – 15 μg/ml |
| dbacp01972 | Brevinin-2R | KLKNFAKGVAQSLLNKASCKLSGQC | Skin, Marsh frog, Europe | Activates the lysosomal-mitochondrial death pathway; Involves autophagy-like cell death | MTT-assay | L929 | Fibrosarcoma | LD50 : 20 – 25 μg/ml |
| dbacp01973 | Brevinin-2R | KLKNFAKGVAQSLLNKASCKLSGQC | Skin, Marsh frog, Europe | Activates the lysosomal-mitochondrial death pathway; Involves autophagy-like cell death | MTT-assay | L929 | Fibrosarcoma | LD50 : 30 – 40 μg/ml |
| dbacp01982 | Brevinin-2R | KLKNFAKGVAQSLLNKASCKLSGQC | Skin, Marsh frog, Europe | Activates the lysosomal-mitochondrial death pathway; Involves autophagy-like cell death | MTT-assay | L929 | Fibrosarcoma | LD50 : 20 – 25 µg/ml |
| dbacp02483 | Chrysophsin-1 | FFGWLIKGAIHAGKAIHGLI | The pyloric caeca and gills; Red sea bream | Disruption of cancer cell membranes; Apoptosis | MTS assay, Lactate dehydrogenase (LDH) detection assay | HT-1080 | Human fibrosarcoma | MIC : 7 µg/ml |
| dbacp02842 | EP5-1 | ACSAG | Redworms, brandling worms, "tiger worms" and red wiggler worms | Cell membrane disintegration | Not specified | Not found | Fibrosarcoma | Not found |
| dbacp02851 | Epinecidin-1 | GFIFHIIKGLFHAGKMIHGLV | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HT-1080 | Fibrosarcoma | 82 % Cytotoxicity at 50 mg/L |
| dbacp02852 | Epinecidin-1 | GFIFHIIKGLFHAGKMIHGLV | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HT-1080 | Fibrosarcoma | 85 % Cytotoxicity at 25 mg/L |
| dbacp02853 | Epinecidin-1 | GFIFHIIKGLFHAGKMIHGLV | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HT-1080 | Fibrosarcoma | 42 % Cytotoxicity at 12.5 mg/L |
| dbacp02854 | Epinecidin-1 | GFIFHIIKGLFHAGKMIHGLV | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HT-1080 | Fibrosarcoma | 41 % Cytotoxicity at 6.25 mg/L |
| dbacp02855 | Epinecidin-1 | GFIFHIIKGLFHAGKMIHGLV | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HT-1080 | Fibrosarcoma | 39 % Cytotoxicity at 3.125 mg/L |
| dbacp02856 | Epinecidin-1 | GFIFHIIKGLFHAGKMIHGLV | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HT-1080 | Fibrosarcoma | 90 % Cytotoxicity at 50 mg/L |
| dbacp02857 | Epinecidin-1 | GFIFHIIKGLFHAGKMIHGLV | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HT-1080 | Fibrosarcoma | 95 % Cytotoxicity at 25 mg/L |
| dbacp02858 | Epinecidin-1 | GFIFHIIKGLFHAGKMIHGLV | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HT-1080 | Fibrosarcoma | 45 % Cytotoxicity at 12.5 mg/L |
| dbacp02859 | Epinecidin-1 | GFIFHIIKGLFHAGKMIHGLV | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HT-1080 | Fibrosarcoma | 25 % Cytotoxicity at 6.25 mg/L |
| dbacp02860 | Epinecidin-1 | GFIFHIIKGLFHAGKMIHGLV | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HT-1080 | Fibrosarcoma | 25 % Cytotoxicity at 3.125 mg/L |
| dbacp02861 | Epinecidin-1 | GFIFHIIKGLFHAGKMIHGLV | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HT-1080 | Fibrosarcoma | 95 % Cytotoxicity at 50 mg/L |
| dbacp02862 | Epinecidin-1 | GFIFHIIKGLFHAGKMIHGLV | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HT-1080 | Fibrosarcoma | 96 % Cytotoxicity at 25 mg/L |
| dbacp02863 | Epinecidin-1 | GFIFHIIKGLFHAGKMIHGLV | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HT-1080 | Fibrosarcoma | 46 % Cytotoxicity at 12.5 mg/L |
| dbacp02864 | Epinecidin-1 | GFIFHIIKGLFHAGKMIHGLV | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HT-1080 | Fibrosarcoma | 30 % Cytotoxicity at 6.25 mg/L |
| dbacp02865 | Epinecidin-1 | GFIFHIIKGLFHAGKMIHGLV | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HT-1080 | Fibrosarcoma | 28 % Cytotoxicity at 3.125 mg/L |
| dbacp02866 | Epinecidin-1 | GFIFHIIKGLFHAGKMIHGLV | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HT-1080 | Fibrosarcoma | 84 % Cytotoxicity at 50 mg/L |
| dbacp02867 | Epinecidin-1 | GFIFHIIKGLFHAGKMIHGLV | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HT-1080 | Fibrosarcoma | 85 % Cytotoxicity at 25 mg/L |
| dbacp02868 | Epinecidin-1 | GFIFHIIKGLFHAGKMIHGLV | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HT-1080 | Fibrosarcoma | 38 % Cytotoxicity at 12.5 mg/L |
| dbacp02869 | Epinecidin-1 | GFIFHIIKGLFHAGKMIHGLV | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HT-1080 | Fibrosarcoma | 30 % Cytotoxicity at 6.25 mg/L |
| dbacp02870 | Epinecidin-1 | GFIFHIIKGLFHAGKMIHGLV | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HT-1080 | Fibrosarcoma | 28 % Cytotoxicity at 3.125 mg/L |
| dbacp02894 | Epinecidin-8 | FIFHIIKGLFHAGKMI | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HT-1080 | Fibrosarcoma | 60 % Cytotoxicity at 50 mg/L |
| dbacp02895 | Epinecidin-8 | FIFHIIKGLFHAGKMI | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HT-1080 | Fibrosarcoma | 50 % Cytotoxicity at 25 mg/L |
| dbacp02896 | Epinecidin-8 | FIFHIIKGLFHAGKMI | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HT-1080 | Fibrosarcoma | 8 % Cytotoxicity at 12.5 mg/L |
| dbacp02897 | Epinecidin-8 | FIFHIIKGLFHAGKMI | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HT-1080 | Fibrosarcoma | 10 % Cytotoxicity at 6.25 mg/L |
| dbacp02898 | Epinecidin-8 | FIFHIIKGLFHAGKMI | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HT-1080 | Fibrosarcoma | 5 % Cytotoxicity at 3.125 mg/L |
| dbacp02899 | Epinecidin-8 | FIFHIIKGLFHAGKMI | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HT-1080 | Fibrosarcoma | 75 % Cytotoxicity at 50 mg/L |
| dbacp02900 | Epinecidin-8 | FIFHIIKGLFHAGKMI | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HT-1080 | Fibrosarcoma | 70 % Cytotoxicity at 25 mg/L |
| dbacp02901 | Epinecidin-8 | FIFHIIKGLFHAGKMI | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HT-1080 | Fibrosarcoma | 5 %Cytotoxicity at 12.5 mg/L |
| dbacp02902 | Epinecidin-8 | FIFHIIKGLFHAGKMI | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HT-1080 | Fibrosarcoma | 7 % Cytotoxicity at 6.25 mg/L |
| dbacp02903 | Epinecidin-8 | FIFHIIKGLFHAGKMI | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HT-1080 | Fibrosarcoma | 10 % Cytotoxicity at 3.125 mg/L |
| dbacp02904 | Epinecidin-8 | FIFHIIKGLFHAGKMI | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HT-1080 | Fibrosarcoma | 76 % Cytotoxicity at 50 mg/L |
| dbacp02905 | Epinecidin-8 | FIFHIIKGLFHAGKMI | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HT-1080 | Fibrosarcoma | 70 % Cytotoxicity at 25 mg/L |
| dbacp02906 | Epinecidin-8 | FIFHIIKGLFHAGKMI | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HT-1080 | Fibrosarcoma | 12 % Cytotoxicity at 12.5 mg/L |
| dbacp02907 | Epinecidin-8 | FIFHIIKGLFHAGKMI | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HT-1080 | Fibrosarcoma | 4 % Cytotoxicity at 6.25 mg/L |
| dbacp02908 | Epinecidin-8 | FIFHIIKGLFHAGKMI | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HT-1080 | Fibrosarcoma | 4 % Cytotoxicity at 3.125 mg/L |
| dbacp02909 | Epinecidin-8 | FIFHIIKGLFHAGKMI | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HT-1080 | Fibrosarcoma | 90 % Cytotoxicity at 50 mg/L |
| dbacp02910 | Epinecidin-8 | FIFHIIKGLFHAGKMI | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HT-1080 | Fibrosarcoma | 75 % Cytotoxicity at 25 mg/L |
| dbacp02911 | Epinecidin-8 | FIFHIIKGLFHAGKMI | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HT-1080 | Fibrosarcoma | 8 % Cytotoxicity at 12.5 mg/L |
| dbacp02912 | Epinecidin-8 | FIFHIIKGLFHAGKMI | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HT-1080 | Fibrosarcoma | 3 % Cytotoxicity at 6.25 mg/L |
| dbacp02913 | Epinecidin-8 | FIFHIIKGLFHAGKMI | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HT-1080 | Fibrosarcoma | 3 % Cytotoxicity at 3.125 mg/L |
| dbacp03281 | hBD-1 | DHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK | Keratinocytes; skin; platelets; Human | Cell membrane disintegration | Not specified | Not found | Fibrosarcoma | Not found |
| dbacp03282 | hBD-1 | DHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK | Airway, hemofiltrates, urine, kidney; keratinocytes; skin; platelets; oral saliva; milk, mammary gland epithelium, colonic mucosa, Human | Cell membrane disintegration | Not specified | Not found | Fibrosarcoma | Not found |
| dbacp03316 | HNP-1 | ACYCRIPACIAGERRYGTCIYQGRLWAFCC | Human | Cell membrane disintegration | Not specified | Not found | Fibrosarcoma | Not found |
| dbacp03317 | HNP-2 | CYCRIPACIAGERRYGTCIYQGRLWAFCC | Human | Cell membrane disintegration | Not specified | Not found | Fibrosarcoma | Not found |
| dbacp03318 | HNP-3 | DCYCRIPACIAGERRYGTCIYQGRLWAFCC | Human | Cell membrane disintegration | Not specified | Not found | Fibrosarcoma | Not found |
| dbacp03336 | Human neutrophil peptide-1 | ACYCRIPACIAGERRYGTCIYQGRLWAFCC | Neutrophils; natural killer cells, monocytes; airway, saliva; Human | Cell membrane disintegration | Not specified | Not found | Fibrosarcoma | Not found |
| dbacp03337 | Human neutrophil peptide-2 | CYCRIPACIAGERRYGTCIYQGRLWAFCC | Neutrophils; natural killer cells, monocytes; airway, saliva; Human | Cell membrane disintegration | Not specified | Not found | Fibrosarcoma | Not found |
| dbacp03338 | Human neutrophil peptide-3 | DCYCRIPACIAGERRYGTCIYQGRLWAFCC | Neutrophils; natural killer cells, monocytes; airway, saliva; Human | Cell membrane disintegration | Not specified | Not found | Fibrosarcoma | Not found |
| dbacp04831 | Neurotoxin BmK AGAP-SYPU2 | VKDGYIVDDKNCAYFCGRNAYCDDECEKNGAESGYCQWAGVYGNACWCYKLPDKVPIRVPGRCNG | Manchurian scorpion | Blocker of chloride channels and can inhibit the migration of glioma cells | Antitumor activity assays | S-180 | Fibrosarcoma | ED50 : 4.0 mg/kg |
| dbacp05134 | Pardaxin | GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE | Red sea moses sole | Inducing apoptosis | MTT/MTS assay | HT-1080 | Fibrosarcoma | IC50 : 15.74 µg/ml |
| dbacp05135 | Pardaxin | GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE | Red sea moses sole | Inducing apoptosis | MTT/MTS assay | HT-1080 | Fibrosarcoma | IC50 : 15.40 µg/ml |
| dbacp05136 | Pardaxin | GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE | Red sea moses sole | Inducing apoptosis | MTT/MTS assay | HT-1080 | Fibrosarcoma | IC50 : 14.51 µg/ml |
| dbacp05137 | Pardaxin | GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE | Red sea moses sole | Inducing apoptosis | MTT/MTS assay | HT-1080 | Fibrosarcoma | IC50 : 14.52 µg/ml |
| dbacp05155 | Pardaxin-1 | GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HT-1080 | Fibrosarcoma | 88 % Cytotoxicity at 50 mg/L |
| dbacp05156 | Pardaxin-1 | GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HT-1080 | Fibrosarcoma | 82 % Cytotoxicity at 25 mg/L |
| dbacp05157 | Pardaxin-1 | GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HT-1080 | Fibrosarcoma | 40 % Cytotoxicity at 12.5 mg/L |
| dbacp05158 | Pardaxin-1 | GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HT-1080 | Fibrosarcoma | 35 % Cytotoxicity at 6.25 mg/L |
| dbacp05159 | Pardaxin-1 | GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HT-1080 | Fibrosarcoma | 35 % Cytotoxicity at 3.125 mg/L |
| dbacp05160 | Pardaxin-1 | GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HT-1080 | Fibrosarcoma | 90 % Cytotoxicity at 50 mg/L |
| dbacp05161 | Pardaxin-1 | GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HT-1080 | Fibrosarcoma | 90 % Cytotoxicity at 25 mg/L |
| dbacp05162 | Pardaxin-1 | GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HT-1080 | Fibrosarcoma | 30 % Cytotoxicity at 12.5 mg/L |
| dbacp05163 | Pardaxin-1 | GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HT-1080 | Fibrosarcoma | 30 % Cytotoxicity at 6.25 mg/L |
| dbacp05164 | Pardaxin-1 | GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HT-1080 | Fibrosarcoma | 30 % Cytotoxicity at 3.125 mg/L |
| dbacp05165 | Pardaxin-1 | GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HT-1080 | Fibrosarcoma | 97 % Cytotoxicity at 50 mg/L |
| dbacp05166 | Pardaxin-1 | GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HT-1080 | Fibrosarcoma | 95 % Cytotoxicity at 25 mg/L |
| dbacp05167 | Pardaxin-1 | GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HT-1080 | Fibrosarcoma | 39 % Cytotoxicity at 12.5 mg/L |
| dbacp05168 | Pardaxin-1 | GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HT-1080 | Fibrosarcoma | 28 % Cytotoxicity at 6.25 mg/L |
| dbacp05169 | Pardaxin-1 | GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HT-1080 | Fibrosarcoma | 38 % Cytotoxicity at 3.125 mg/L |
| dbacp05170 | Pardaxin-1 | GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HT-1080 | Fibrosarcoma | 90 % Cytotoxicity at 50 mg/L |
| dbacp05171 | Pardaxin-1 | GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HT-1080 | Fibrosarcoma | 90 % Cytotoxicity at 25 mg/L |
| dbacp05172 | Pardaxin-1 | GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HT-1080 | Fibrosarcoma | 15 % Cytotoxicity at 12.5 mg/L |
| dbacp05173 | Pardaxin-1 | GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HT-1080 | Fibrosarcoma | 5 % Cytotoxicity at 6.25 mg/L |
| dbacp05174 | Pardaxin-1 | GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HT-1080 | Fibrosarcoma | 10 % Cytotoxicity at 3.125 mg/L |
| dbacp05195 | Pardaxin-6 | GFFALIPKIISSPLFKTLLSAVGSALS | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HT-1080 | Fibrosarcoma | 80 % Cytotoxicity at 50 mg/L |
| dbacp05196 | Pardaxin-6 | GFFALIPKIISSPLFKTLLSAVGSALS | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HT-1080 | Fibrosarcoma | 85 % Cytotoxicity at 25 mg/L |
| dbacp05197 | Pardaxin-6 | GFFALIPKIISSPLFKTLLSAVGSALS | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HT-1080 | Fibrosarcoma | 45 % Cytotoxicity at 12.5 mg/L |
| dbacp05198 | Pardaxin-6 | GFFALIPKIISSPLFKTLLSAVGSALS | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HT-1080 | Fibrosarcoma | 30 % Cytotoxicity at 6.25 mg/L |
| dbacp05199 | Pardaxin-6 | GFFALIPKIISSPLFKTLLSAVGSALS | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HT-1080 | Fibrosarcoma | 25 % Cytotoxicity at 3.125 mg/L |
| dbacp05200 | Pardaxin-6 | GFFALIPKIISSPLFKTLLSAVGSALS | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HT-1080 | Fibrosarcoma | 84 % Cytotoxicity at 50 mg/L |
| dbacp05201 | Pardaxin-6 | GFFALIPKIISSPLFKTLLSAVGSALS | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HT-1080 | Fibrosarcoma | 84% Cytotoxicity at 25 mg/L |
| dbacp05202 | Pardaxin-6 | GFFALIPKIISSPLFKTLLSAVGSALS | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HT-1080 | Fibrosarcoma | 48 % Cytotoxicity at 12.5 mg/L |
| dbacp05203 | Pardaxin-6 | GFFALIPKIISSPLFKTLLSAVGSALS | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HT-1080 | Fibrosarcoma | 30 % Cytotoxicity at 6.25 mg/L |
| dbacp05204 | Pardaxin-6 | GFFALIPKIISSPLFKTLLSAVGSALS | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HT-1080 | Fibrosarcoma | 35 % Cytotoxicity at 3.125 mg/L |
| dbacp05205 | Pardaxin-6 | GFFALIPKIISSPLFKTLLSAVGSALS | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HT-1080 | Fibrosarcoma | 90 % Cytotoxicity at 50 mg/L |
| dbacp05206 | Pardaxin-6 | GFFALIPKIISSPLFKTLLSAVGSALS | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HT-1080 | Fibrosarcoma | 85 % Cytotoxicity at 25 mg/L |
| dbacp05207 | Pardaxin-6 | GFFALIPKIISSPLFKTLLSAVGSALS | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HT-1080 | Fibrosarcoma | 30 % Cytotoxicity at 12.5 mg/L |
| dbacp05208 | Pardaxin-6 | GFFALIPKIISSPLFKTLLSAVGSALS | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HT-1080 | Fibrosarcoma | 35 % Cytotoxicity at 6.25 mg/L |
| dbacp05209 | Pardaxin-6 | GFFALIPKIISSPLFKTLLSAVGSALS | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HT-1080 | Fibrosarcoma | 15 % Cytotoxicity at 3.125 mg/L |
| dbacp05210 | Pardaxin-6 | GFFALIPKIISSPLFKTLLSAVGSALS | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HT-1080 | Fibrosarcoma | 90 % Cytotoxicity at 50 mg/L |
| dbacp05211 | Pardaxin-6 | GFFALIPKIISSPLFKTLLSAVGSALS | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HT-1080 | Fibrosarcoma | 90 % Cytotoxicity at 25 mg/L |
| dbacp05212 | Pardaxin-6 | GFFALIPKIISSPLFKTLLSAVGSALS | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HT-1080 | Fibrosarcoma | 20 % Cytotoxicity at 12.5 mg/L |
| dbacp05213 | Pardaxin-6 | GFFALIPKIISSPLFKTLLSAVGSALS | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HT-1080 | Fibrosarcoma | 1 % Cytotoxicity at 6.25 mg/L |
| dbacp05214 | Pardaxin-6 | GFFALIPKIISSPLFKTLLSAVGSALS | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HT-1080 | Fibrosarcoma | 10 % Cytotoxicity at 3.125 mg/L |
| dbacp05632 | Prepromelittin-related peptide | AIGSILGALAKGLPTLISWIKNR | Tago frog | By orientating perpendicularly and inserting into the lipid bilayer of the plasma membrane and so inducing transmembrane pores | Not specified | Not found | Fibrosarcoma | Not found |
| dbacp06451 | Vaby A | GLPVCGETCAGGTCNTPGCSCSWPICTRN | African, the Ethiopian highlands | Not specified | Not specified | Not found | Fibrosarcoma | Not found |
| dbacp06452 | Vaby A | GLPVCGETCAGGTCNTPGCSCSWPICTRN | African, the Ethiopian highlands | Not specified | Not specified | Not found | Fibrosarcoma | Not found |
| dbacp06453 | Vaby D | GLPVCGETCFGGTCNTPGCTCDPWPVCTRN | African, the Ethiopian highlands | Not specified | Not specified | Not found | Fibrosarcoma | Not found |
| dbacp06454 | Vaby D | GLPVCGETCFGGTCNTPGCTCDPWPVCTRN | African, the Ethiopian highlands | Not specified | Not specified | Not found | Fibrosarcoma | Not found |
| dbacp06455 | Varv peptide A | GLPVCGETCVGGTCNTPGCSCSWPVCTRN | Field pansy,Sweet violet, Wild pansy, Violets or Pansies, Philippine violet herb, and Alpine yellow-violet | Cell membrane disintegration | Not specified | Not found | Fibrosarcoma | Not found |
| dbacp06456 | Varv peptide A | GLPVCGETCVGGTCNTPGCSCSWPVCTRN | Field pansy,Sweet violet, Wild pansy, Violets or Pansies, Philippine violet herb, and Alpine yellow-violet | Cell membrane disintegration | Not specified | Not found | Fibrosarcoma | Not found |
| dbacp07365 | Piscidin 3 | FIHHIFRGIVHAGRSIGRFLTG | Morone chrysops x Morone saxatilis | Cu²⁺-mediated membrane lipid oxidation | MTT assay | HT-1080 | Fibrosarcoma | IC50 = 26.01 µM |
| dbacp07366 | Piscidin 3 | FIHHIFRGIVHAGRSIGRFLTG | Morone chrysops x Morone saxatilis | Cu²⁺-mediated membrane lipid oxidation | MTT assay | HT-1080 | Fibrosarcoma | IC50 = 5.52 µM |
| dbacp08139 | Laterosporulin10 (LS10) | ACVNQCPDAIDRFIVKDKGCHGVEKKYYKQVYVACMNGQHLYCRTEGGPCQL | Brevibacillus sp. strain SKDU10 | Apoptosis inducing | MTT assay | HT-1080 | Fibrosarcoma | 20% cytotoxicity 5 μM concentration |