dbACP: A Comprehensive Database of Anti-Cancer Peptides

109 result(s) have been found!

Accession Name Sequence Source/Organism Mechanism Assay Type Cell Line Cancer Type Activity
dbacp01971 Brevinin-2R KLKNFAKGVAQSLLNKASCKLSGQC Skin, Marsh frog, Europe Activates the lysosomal-mitochondrial death pathway; Involves autophagy-like cell death MTT-assay L929 Fibrosarcoma LD50 : 10 – 15 μg/ml
dbacp01972 Brevinin-2R KLKNFAKGVAQSLLNKASCKLSGQC Skin, Marsh frog, Europe Activates the lysosomal-mitochondrial death pathway; Involves autophagy-like cell death MTT-assay L929 Fibrosarcoma LD50 : 20 – 25 μg/ml
dbacp01973 Brevinin-2R KLKNFAKGVAQSLLNKASCKLSGQC Skin, Marsh frog, Europe Activates the lysosomal-mitochondrial death pathway; Involves autophagy-like cell death MTT-assay L929 Fibrosarcoma LD50 : 30 – 40 μg/ml
dbacp01982 Brevinin-2R KLKNFAKGVAQSLLNKASCKLSGQC Skin, Marsh frog, Europe Activates the lysosomal-mitochondrial death pathway; Involves autophagy-like cell death MTT-assay L929 Fibrosarcoma LD50 : 20 – 25 µg/ml
dbacp02483 Chrysophsin-1 FFGWLIKGAIHAGKAIHGLI The pyloric caeca and gills; Red sea bream Disruption of cancer cell membranes; Apoptosis MTS assay, Lactate dehydrogenase (LDH) detection assay HT-1080 Human fibrosarcoma MIC : 7 µg/ml
dbacp02842 EP5-1 ACSAG Redworms, brandling worms, "tiger worms" and red wiggler worms Cell membrane disintegration Not specified Not found Fibrosarcoma Not found
dbacp02851 Epinecidin-1 GFIFHIIKGLFHAGKMIHGLV Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 82 % Cytotoxicity at 50 mg/L
dbacp02852 Epinecidin-1 GFIFHIIKGLFHAGKMIHGLV Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 85 % Cytotoxicity at 25 mg/L
dbacp02853 Epinecidin-1 GFIFHIIKGLFHAGKMIHGLV Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 42 % Cytotoxicity at 12.5 mg/L
dbacp02854 Epinecidin-1 GFIFHIIKGLFHAGKMIHGLV Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 41 % Cytotoxicity at 6.25 mg/L
dbacp02855 Epinecidin-1 GFIFHIIKGLFHAGKMIHGLV Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 39 % Cytotoxicity at 3.125 mg/L
dbacp02856 Epinecidin-1 GFIFHIIKGLFHAGKMIHGLV Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 90 % Cytotoxicity at 50 mg/L
dbacp02857 Epinecidin-1 GFIFHIIKGLFHAGKMIHGLV Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 95 % Cytotoxicity at 25 mg/L
dbacp02858 Epinecidin-1 GFIFHIIKGLFHAGKMIHGLV Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 45 % Cytotoxicity at 12.5 mg/L
dbacp02859 Epinecidin-1 GFIFHIIKGLFHAGKMIHGLV Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 25 % Cytotoxicity at 6.25 mg/L
dbacp02860 Epinecidin-1 GFIFHIIKGLFHAGKMIHGLV Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 25 % Cytotoxicity at 3.125 mg/L
dbacp02861 Epinecidin-1 GFIFHIIKGLFHAGKMIHGLV Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 95 % Cytotoxicity at 50 mg/L
dbacp02862 Epinecidin-1 GFIFHIIKGLFHAGKMIHGLV Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 96 % Cytotoxicity at 25 mg/L
dbacp02863 Epinecidin-1 GFIFHIIKGLFHAGKMIHGLV Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 46 % Cytotoxicity at 12.5 mg/L
dbacp02864 Epinecidin-1 GFIFHIIKGLFHAGKMIHGLV Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 30 % Cytotoxicity at 6.25 mg/L
dbacp02865 Epinecidin-1 GFIFHIIKGLFHAGKMIHGLV Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 28 % Cytotoxicity at 3.125 mg/L
dbacp02866 Epinecidin-1 GFIFHIIKGLFHAGKMIHGLV Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 84 % Cytotoxicity at 50 mg/L
dbacp02867 Epinecidin-1 GFIFHIIKGLFHAGKMIHGLV Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 85 % Cytotoxicity at 25 mg/L
dbacp02868 Epinecidin-1 GFIFHIIKGLFHAGKMIHGLV Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 38 % Cytotoxicity at 12.5 mg/L
dbacp02869 Epinecidin-1 GFIFHIIKGLFHAGKMIHGLV Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 30 % Cytotoxicity at 6.25 mg/L
dbacp02870 Epinecidin-1 GFIFHIIKGLFHAGKMIHGLV Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 28 % Cytotoxicity at 3.125 mg/L
dbacp02894 Epinecidin-8 FIFHIIKGLFHAGKMI Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 60 % Cytotoxicity at 50 mg/L
dbacp02895 Epinecidin-8 FIFHIIKGLFHAGKMI Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 50 % Cytotoxicity at 25 mg/L
dbacp02896 Epinecidin-8 FIFHIIKGLFHAGKMI Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 8 % Cytotoxicity at 12.5 mg/L
dbacp02897 Epinecidin-8 FIFHIIKGLFHAGKMI Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 10 % Cytotoxicity at 6.25 mg/L
dbacp02898 Epinecidin-8 FIFHIIKGLFHAGKMI Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 5 % Cytotoxicity at 3.125 mg/L
dbacp02899 Epinecidin-8 FIFHIIKGLFHAGKMI Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 75 % Cytotoxicity at 50 mg/L
dbacp02900 Epinecidin-8 FIFHIIKGLFHAGKMI Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 70 % Cytotoxicity at 25 mg/L
dbacp02901 Epinecidin-8 FIFHIIKGLFHAGKMI Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 5 %Cytotoxicity at 12.5 mg/L
dbacp02902 Epinecidin-8 FIFHIIKGLFHAGKMI Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 7 % Cytotoxicity at 6.25 mg/L
dbacp02903 Epinecidin-8 FIFHIIKGLFHAGKMI Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 10 % Cytotoxicity at 3.125 mg/L
dbacp02904 Epinecidin-8 FIFHIIKGLFHAGKMI Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 76 % Cytotoxicity at 50 mg/L
dbacp02905 Epinecidin-8 FIFHIIKGLFHAGKMI Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 70 % Cytotoxicity at 25 mg/L
dbacp02906 Epinecidin-8 FIFHIIKGLFHAGKMI Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 12 % Cytotoxicity at 12.5 mg/L
dbacp02907 Epinecidin-8 FIFHIIKGLFHAGKMI Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 4 % Cytotoxicity at 6.25 mg/L
dbacp02908 Epinecidin-8 FIFHIIKGLFHAGKMI Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 4 % Cytotoxicity at 3.125 mg/L
dbacp02909 Epinecidin-8 FIFHIIKGLFHAGKMI Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 90 % Cytotoxicity at 50 mg/L
dbacp02910 Epinecidin-8 FIFHIIKGLFHAGKMI Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 75 % Cytotoxicity at 25 mg/L
dbacp02911 Epinecidin-8 FIFHIIKGLFHAGKMI Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 8 % Cytotoxicity at 12.5 mg/L
dbacp02912 Epinecidin-8 FIFHIIKGLFHAGKMI Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 3 % Cytotoxicity at 6.25 mg/L
dbacp02913 Epinecidin-8 FIFHIIKGLFHAGKMI Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 3 % Cytotoxicity at 3.125 mg/L
dbacp03281 hBD-1 DHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK Keratinocytes; skin; platelets; Human Cell membrane disintegration Not specified Not found Fibrosarcoma Not found
dbacp03282 hBD-1 DHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK Airway, hemofiltrates, urine, kidney; keratinocytes; skin; platelets; oral saliva; milk, mammary gland epithelium, colonic mucosa, Human Cell membrane disintegration Not specified Not found Fibrosarcoma Not found
dbacp03316 HNP-1 ACYCRIPACIAGERRYGTCIYQGRLWAFCC Human Cell membrane disintegration Not specified Not found Fibrosarcoma Not found
dbacp03317 HNP-2 CYCRIPACIAGERRYGTCIYQGRLWAFCC Human Cell membrane disintegration Not specified Not found Fibrosarcoma Not found
dbacp03318 HNP-3 DCYCRIPACIAGERRYGTCIYQGRLWAFCC Human Cell membrane disintegration Not specified Not found Fibrosarcoma Not found
dbacp03336 Human neutrophil peptide-1 ACYCRIPACIAGERRYGTCIYQGRLWAFCC Neutrophils; natural killer cells, monocytes; airway, saliva; Human Cell membrane disintegration Not specified Not found Fibrosarcoma Not found
dbacp03337 Human neutrophil peptide-2 CYCRIPACIAGERRYGTCIYQGRLWAFCC Neutrophils; natural killer cells, monocytes; airway, saliva; Human Cell membrane disintegration Not specified Not found Fibrosarcoma Not found
dbacp03338 Human neutrophil peptide-3 DCYCRIPACIAGERRYGTCIYQGRLWAFCC Neutrophils; natural killer cells, monocytes; airway, saliva; Human Cell membrane disintegration Not specified Not found Fibrosarcoma Not found
dbacp04831 Neurotoxin BmK AGAP-SYPU2 VKDGYIVDDKNCAYFCGRNAYCDDECEKNGAESGYCQWAGVYGNACWCYKLPDKVPIRVPGRCNG Manchurian scorpion Blocker of chloride channels and can inhibit the migration of glioma cells Antitumor activity assays S-180 Fibrosarcoma ED50 : 4.0 mg/kg
dbacp05134 Pardaxin GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE Red sea moses sole Inducing apoptosis MTT/MTS assay HT-1080 Fibrosarcoma IC50 : 15.74 µg/ml
dbacp05135 Pardaxin GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE Red sea moses sole Inducing apoptosis MTT/MTS assay HT-1080 Fibrosarcoma IC50 : 15.40 µg/ml
dbacp05136 Pardaxin GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE Red sea moses sole Inducing apoptosis MTT/MTS assay HT-1080 Fibrosarcoma IC50 : 14.51 µg/ml
dbacp05137 Pardaxin GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE Red sea moses sole Inducing apoptosis MTT/MTS assay HT-1080 Fibrosarcoma IC50 : 14.52 µg/ml
dbacp05155 Pardaxin-1 GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 88 % Cytotoxicity at 50 mg/L
dbacp05156 Pardaxin-1 GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 82 % Cytotoxicity at 25 mg/L
dbacp05157 Pardaxin-1 GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 40 % Cytotoxicity at 12.5 mg/L
dbacp05158 Pardaxin-1 GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 35 % Cytotoxicity at 6.25 mg/L
dbacp05159 Pardaxin-1 GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 35 % Cytotoxicity at 3.125 mg/L
dbacp05160 Pardaxin-1 GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 90 % Cytotoxicity at 50 mg/L
dbacp05161 Pardaxin-1 GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 90 % Cytotoxicity at 25 mg/L
dbacp05162 Pardaxin-1 GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 30 % Cytotoxicity at 12.5 mg/L
dbacp05163 Pardaxin-1 GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 30 % Cytotoxicity at 6.25 mg/L
dbacp05164 Pardaxin-1 GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 30 % Cytotoxicity at 3.125 mg/L
dbacp05165 Pardaxin-1 GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 97 % Cytotoxicity at 50 mg/L
dbacp05166 Pardaxin-1 GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 95 % Cytotoxicity at 25 mg/L
dbacp05167 Pardaxin-1 GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 39 % Cytotoxicity at 12.5 mg/L
dbacp05168 Pardaxin-1 GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 28 % Cytotoxicity at 6.25 mg/L
dbacp05169 Pardaxin-1 GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 38 % Cytotoxicity at 3.125 mg/L
dbacp05170 Pardaxin-1 GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 90 % Cytotoxicity at 50 mg/L
dbacp05171 Pardaxin-1 GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 90 % Cytotoxicity at 25 mg/L
dbacp05172 Pardaxin-1 GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 15 % Cytotoxicity at 12.5 mg/L
dbacp05173 Pardaxin-1 GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 5 % Cytotoxicity at 6.25 mg/L
dbacp05174 Pardaxin-1 GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 10 % Cytotoxicity at 3.125 mg/L
dbacp05195 Pardaxin-6 GFFALIPKIISSPLFKTLLSAVGSALS Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 80 % Cytotoxicity at 50 mg/L
dbacp05196 Pardaxin-6 GFFALIPKIISSPLFKTLLSAVGSALS Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 85 % Cytotoxicity at 25 mg/L
dbacp05197 Pardaxin-6 GFFALIPKIISSPLFKTLLSAVGSALS Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 45 % Cytotoxicity at 12.5 mg/L
dbacp05198 Pardaxin-6 GFFALIPKIISSPLFKTLLSAVGSALS Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 30 % Cytotoxicity at 6.25 mg/L
dbacp05199 Pardaxin-6 GFFALIPKIISSPLFKTLLSAVGSALS Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 25 % Cytotoxicity at 3.125 mg/L
dbacp05200 Pardaxin-6 GFFALIPKIISSPLFKTLLSAVGSALS Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 84 % Cytotoxicity at 50 mg/L
dbacp05201 Pardaxin-6 GFFALIPKIISSPLFKTLLSAVGSALS Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 84% Cytotoxicity at 25 mg/L
dbacp05202 Pardaxin-6 GFFALIPKIISSPLFKTLLSAVGSALS Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 48 % Cytotoxicity at 12.5 mg/L
dbacp05203 Pardaxin-6 GFFALIPKIISSPLFKTLLSAVGSALS Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 30 % Cytotoxicity at 6.25 mg/L
dbacp05204 Pardaxin-6 GFFALIPKIISSPLFKTLLSAVGSALS Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 35 % Cytotoxicity at 3.125 mg/L
dbacp05205 Pardaxin-6 GFFALIPKIISSPLFKTLLSAVGSALS Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 90 % Cytotoxicity at 50 mg/L
dbacp05206 Pardaxin-6 GFFALIPKIISSPLFKTLLSAVGSALS Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 85 % Cytotoxicity at 25 mg/L
dbacp05207 Pardaxin-6 GFFALIPKIISSPLFKTLLSAVGSALS Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 30 % Cytotoxicity at 12.5 mg/L
dbacp05208 Pardaxin-6 GFFALIPKIISSPLFKTLLSAVGSALS Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 35 % Cytotoxicity at 6.25 mg/L
dbacp05209 Pardaxin-6 GFFALIPKIISSPLFKTLLSAVGSALS Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 15 % Cytotoxicity at 3.125 mg/L
dbacp05210 Pardaxin-6 GFFALIPKIISSPLFKTLLSAVGSALS Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 90 % Cytotoxicity at 50 mg/L
dbacp05211 Pardaxin-6 GFFALIPKIISSPLFKTLLSAVGSALS Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 90 % Cytotoxicity at 25 mg/L
dbacp05212 Pardaxin-6 GFFALIPKIISSPLFKTLLSAVGSALS Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 20 % Cytotoxicity at 12.5 mg/L
dbacp05213 Pardaxin-6 GFFALIPKIISSPLFKTLLSAVGSALS Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 1 % Cytotoxicity at 6.25 mg/L
dbacp05214 Pardaxin-6 GFFALIPKIISSPLFKTLLSAVGSALS Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 10 % Cytotoxicity at 3.125 mg/L
dbacp05632 Prepromelittin-related peptide AIGSILGALAKGLPTLISWIKNR Tago frog By orientating perpendicularly and inserting into the lipid bilayer of the plasma membrane and so inducing transmembrane pores Not specified Not found Fibrosarcoma Not found
dbacp06451 Vaby A GLPVCGETCAGGTCNTPGCSCSWPICTRN African, the Ethiopian highlands Not specified Not specified Not found Fibrosarcoma Not found
dbacp06452 Vaby A GLPVCGETCAGGTCNTPGCSCSWPICTRN African, the Ethiopian highlands Not specified Not specified Not found Fibrosarcoma Not found
dbacp06453 Vaby D GLPVCGETCFGGTCNTPGCTCDPWPVCTRN African, the Ethiopian highlands Not specified Not specified Not found Fibrosarcoma Not found
dbacp06454 Vaby D GLPVCGETCFGGTCNTPGCTCDPWPVCTRN African, the Ethiopian highlands Not specified Not specified Not found Fibrosarcoma Not found
dbacp06455 Varv peptide A GLPVCGETCVGGTCNTPGCSCSWPVCTRN Field pansy,Sweet violet, Wild pansy, Violets or Pansies, Philippine violet herb, and Alpine yellow-violet Cell membrane disintegration Not specified Not found Fibrosarcoma Not found
dbacp06456 Varv peptide A GLPVCGETCVGGTCNTPGCSCSWPVCTRN Field pansy,Sweet violet, Wild pansy, Violets or Pansies, Philippine violet herb, and Alpine yellow-violet Cell membrane disintegration Not specified Not found Fibrosarcoma Not found
dbacp07365 Piscidin 3 FIHHIFRGIVHAGRSIGRFLTG Morone chrysops x Morone saxatilis Cu²⁺-mediated membrane lipid oxidation MTT assay HT-1080 Fibrosarcoma IC50 = 26.01 µM
dbacp07366 Piscidin 3 FIHHIFRGIVHAGRSIGRFLTG Morone chrysops x Morone saxatilis Cu²⁺-mediated membrane lipid oxidation MTT assay HT-1080 Fibrosarcoma IC50 = 5.52 µM
dbacp08139 Laterosporulin10 (LS10) ACVNQCPDAIDRFIVKDKGCHGVEKKYYKQVYVACMNGQHLYCRTEGGPCQL Brevibacillus sp. strain SKDU10 Apoptosis inducing MTT assay HT-1080 Fibrosarcoma 20% cytotoxicity 5 μM concentration