dbACP: A Comprehensive Database of Anti-Cancer Peptides

20 result(s) have been found!

Accession Name Sequence Source/Organism Mechanism Assay Type Cell Line Cancer Type Activity
dbacp00817 AaeAP1 FLFSLIPSVIAGLVSAIRN Aeneas fattailed scorpion Not specified MTT assay H460 Prostate cancer Not found
dbacp00821 AaeAP1 FLFSLIPSVIAGLVSAIRN Venom, Aeneas fattailed scorpion, Africa Membrane lysis MTT assay NCI-H460 Human lung adenocarcinoma MIC : 10−4 to 10−9 M
dbacp00825 AaeAP2 FLFSLIPSAIAGLVSAIRN Aeneas fattailed scorpion Not specified MTT assay H460 Prostate cancer Not found
dbacp00829 AaeAP2 FLFSLIPSAIAGLVSAIRN Venom, Aeneas fattailed scorpion, Africa Membrane lysis MTT assay NCI-H460 Human lung adenocarcinoma MIC : 10−4 to 10−9 M
dbacp02010 Buforin IIb RAGLQFPVGRLLRRLLRRLLR Histone H2A Inducing mitochondria-dependent apoptosis MTT/MTS assay NCI-H460 Lung cancer IC50 : 12.1 µg/ml
dbacp02068 Buforin Iib RAGLQFPVGRLLRRLLRRLLR Not found Inducing apoptosis MTT/MTS assay NCI-H460 Not specified IC50 : 12.1 µg/ml
dbacp02309 Catfish PACAP38 HSDGIFTDSYSRYRKQMAVKKYLAAVLGRRYRQRFRNK Sharptooth catfish, North Africa Cell membrane penetration In vitro cell proliferation assay H460 Lung cancer IC50 :13.17 μM
dbacp03358 Hymenochirin-1B IKLSPETKDNLKKVLKGAIKGAIAVAKMV-NH4 Zaire dwarf clawed frog Induce apoptosis and cell cycle arrest LDH release assay, MTT assay H460 Lung cancer MIC : 0 - 50 μM
dbacp03518 Kassiniatuerin-3 FIQHLIPLIPHAIQGIKDIF Senegal running frog, Africa Membranolytic mechanism MTT assay NCI-H460 Non-small cell Lung cancer IC50 : 1.67 µM
dbacp03721 LFB GLFSVVKGVLKGVGKNVSGSLLDQLKCKISGGC The Fujian Large Headed Frog Cell Apoptosis MTT assay H460 Colon cancer IC50 : 3.47 μM
dbacp03725 LFB GLFSVVKGVLKGVGKNVSGSLLDQLKCKISGGC The Fujian Large Headed Frog, China, Asia Cell Apoptosis MTT assay H460 Colon cancer IC50 : 3.47 μM
dbacp04340 LVTX-9 ASIGALIQKAIALIKAKAA-NH2 True tarantula Promote apoptosis; Inhibits the proliferation and migration of lung cancer cells both in vitro and in vivo CCK-8 assay, Flow cytometry, Colony formation assay, Transwell invasion and migration assay H460 Lung cancer IC50 : approx. 8 µM
dbacp05400 Peptide from Lentinus Squarrosulus RYGFTEVAGNFQQHNFGRG Plant sources Inducing apoptosis MTT assay H460 Breast cancer Not found
dbacp05529 Phylloseptin-PBa1 FLSLIPHIASGIASLVKNF Burmeister's leaf frog, Brazil, South America Disruption of cell membranes MTT cell viability assay H460 Lung cancer IC50 : approx. 0.29 µM
dbacp05540 Phylloseptin-PBa2 FLSLLPHIASGIASLVSKF Burmeister's leaf frog, Brazil, South America Disruption of cell membranes MTT cell viability assay H460 Lung cancer IC50 : approx. 0.50 µM
dbacp06129 SmacN7(R)8 AVPIAQKGGGRRRRRRRRGC SMAC Inducing apoptosis Not specified H460 Lung cancer Not found
dbacp08352 Seq ID No. 15 from patent ID US202000079827A1 LKKWWKKVKGLLGGLLGKVTSVIK Synthetic Not Available Tetrazolium-based assay NCI-H460 Lung Cancer Cell viability < 25% at 20 μM
dbacp08355 Seq ID No. 16 from patent ID US202000079827A1 LKKWWKKVKGLLGGLLGKVKSVIK Synthetic Not Available Tetrazolium-based assay NCI-H460 Lung Cancer Cell viability > 50% at 20 μM
dbacp08358 Seq ID No. 17 from patent ID US202000079827A1 LKKWWKKVKGLLGGLLGKVKKVIK Synthetic Not Available Tetrazolium-based assay NCI-H460 Lung Cancer Cell viability > 50% at 20 μM
dbacp08362 Seq ID No. 34 from patent ID US202000079827A1 RRWvRRvRRvWRRvvRvvRRWvRR Synthetic Not Available Tetrazolium-based assay NCI-H460 Lung Cancer Cell viability < 25% at 20 μM