20 result(s) have been found!
| Accession | Name | Sequence | Source/Organism | Mechanism | Assay Type | Cell Line | Cancer Type | Activity |
|---|---|---|---|---|---|---|---|---|
| dbacp00817 | AaeAP1 | FLFSLIPSVIAGLVSAIRN | Aeneas fattailed scorpion | Not specified | MTT assay | H460 | Prostate cancer | Not found |
| dbacp00821 | AaeAP1 | FLFSLIPSVIAGLVSAIRN | Venom, Aeneas fattailed scorpion, Africa | Membrane lysis | MTT assay | NCI-H460 | Human lung adenocarcinoma | MIC : 10−4 to 10−9 M |
| dbacp00825 | AaeAP2 | FLFSLIPSAIAGLVSAIRN | Aeneas fattailed scorpion | Not specified | MTT assay | H460 | Prostate cancer | Not found |
| dbacp00829 | AaeAP2 | FLFSLIPSAIAGLVSAIRN | Venom, Aeneas fattailed scorpion, Africa | Membrane lysis | MTT assay | NCI-H460 | Human lung adenocarcinoma | MIC : 10−4 to 10−9 M |
| dbacp02010 | Buforin IIb | RAGLQFPVGRLLRRLLRRLLR | Histone H2A | Inducing mitochondria-dependent apoptosis | MTT/MTS assay | NCI-H460 | Lung cancer | IC50 : 12.1 µg/ml |
| dbacp02068 | Buforin Iib | RAGLQFPVGRLLRRLLRRLLR | Not found | Inducing apoptosis | MTT/MTS assay | NCI-H460 | Not specified | IC50 : 12.1 µg/ml |
| dbacp02309 | Catfish PACAP38 | HSDGIFTDSYSRYRKQMAVKKYLAAVLGRRYRQRFRNK | Sharptooth catfish, North Africa | Cell membrane penetration | In vitro cell proliferation assay | H460 | Lung cancer | IC50 :13.17 μM |
| dbacp03358 | Hymenochirin-1B | IKLSPETKDNLKKVLKGAIKGAIAVAKMV-NH4 | Zaire dwarf clawed frog | Induce apoptosis and cell cycle arrest | LDH release assay, MTT assay | H460 | Lung cancer | MIC : 0 - 50 μM |
| dbacp03518 | Kassiniatuerin-3 | FIQHLIPLIPHAIQGIKDIF | Senegal running frog, Africa | Membranolytic mechanism | MTT assay | NCI-H460 | Non-small cell Lung cancer | IC50 : 1.67 µM |
| dbacp03721 | LFB | GLFSVVKGVLKGVGKNVSGSLLDQLKCKISGGC | The Fujian Large Headed Frog | Cell Apoptosis | MTT assay | H460 | Colon cancer | IC50 : 3.47 μM |
| dbacp03725 | LFB | GLFSVVKGVLKGVGKNVSGSLLDQLKCKISGGC | The Fujian Large Headed Frog, China, Asia | Cell Apoptosis | MTT assay | H460 | Colon cancer | IC50 : 3.47 μM |
| dbacp04340 | LVTX-9 | ASIGALIQKAIALIKAKAA-NH2 | True tarantula | Promote apoptosis; Inhibits the proliferation and migration of lung cancer cells both in vitro and in vivo | CCK-8 assay, Flow cytometry, Colony formation assay, Transwell invasion and migration assay | H460 | Lung cancer | IC50 : approx. 8 µM |
| dbacp05400 | Peptide from Lentinus Squarrosulus | RYGFTEVAGNFQQHNFGRG | Plant sources | Inducing apoptosis | MTT assay | H460 | Breast cancer | Not found |
| dbacp05529 | Phylloseptin-PBa1 | FLSLIPHIASGIASLVKNF | Burmeister's leaf frog, Brazil, South America | Disruption of cell membranes | MTT cell viability assay | H460 | Lung cancer | IC50 : approx. 0.29 µM |
| dbacp05540 | Phylloseptin-PBa2 | FLSLLPHIASGIASLVSKF | Burmeister's leaf frog, Brazil, South America | Disruption of cell membranes | MTT cell viability assay | H460 | Lung cancer | IC50 : approx. 0.50 µM |
| dbacp06129 | SmacN7(R)8 | AVPIAQKGGGRRRRRRRRGC | SMAC | Inducing apoptosis | Not specified | H460 | Lung cancer | Not found |
| dbacp08352 | Seq ID No. 15 from patent ID US202000079827A1 | LKKWWKKVKGLLGGLLGKVTSVIK | Synthetic | Not Available | Tetrazolium-based assay | NCI-H460 | Lung Cancer | Cell viability < 25% at 20 μM |
| dbacp08355 | Seq ID No. 16 from patent ID US202000079827A1 | LKKWWKKVKGLLGGLLGKVKSVIK | Synthetic | Not Available | Tetrazolium-based assay | NCI-H460 | Lung Cancer | Cell viability > 50% at 20 μM |
| dbacp08358 | Seq ID No. 17 from patent ID US202000079827A1 | LKKWWKKVKGLLGGLLGKVKKVIK | Synthetic | Not Available | Tetrazolium-based assay | NCI-H460 | Lung Cancer | Cell viability > 50% at 20 μM |
| dbacp08362 | Seq ID No. 34 from patent ID US202000079827A1 | RRWvRRvRRvWRRvvRvvRRWvRR | Synthetic | Not Available | Tetrazolium-based assay | NCI-H460 | Lung Cancer | Cell viability < 25% at 20 μM |