dbACP: A Comprehensive Database of Anti-Cancer Peptides

51 result(s) have been found!

Accession Name Sequence Source/Organism Mechanism Assay Type Cell Line Cancer Type Activity
dbacp01912 BpirLAAO-I ADDKNPLEEFRETNYEVFLEIAKNGLKATSNPKRVVIVGAGMAGLSAAY Venom base Inducing apoptosis MTT assay SKBR-3 Breast cancer Not found
dbacp02481 ChMAP-28 GRFKRFRKKLKRLWHKVGPFVGPILHY Domestic goat Cause cell membrane permeability; Induce necrotic death Cytotoxic Activity assay, Lactate dehydrogenase (LDH)-Releaseassay, MTT assay SKBR-3 Human breast adenocarcinoma IC50 : 5.63 ± 1.05μM
dbacp02628 D-SVS-1 kvkvkvkvPptkvkvkvk Synthetic peptide Disruption of cell membranes MTT/MTS assay KB Oral cancer IC50 : 4.5 ± 0.5 µM
dbacp02783 dLL-37(17-32)c FKRiVQRiKDFlRNLV LL-37, a series of peptide fragments Cell membrane disintegration MTT/MTS assay KBv Tumor Not found
dbacp02784 dLL-37(17-32)c FKRIVQRIKDFLRNLV LL-37, a series of peptide fragments Cell membrane disintegration MTT/MTS assay KBv Oral cancer Not found
dbacp03105 GM15 GGTCVIRGCVPKKLM Not found Inducing apoptosis MTT assay KB Oral cancer Not found
dbacp03375 IL-4Rα-lytic hybrid peptide KQLIRFLKRLDRNGGGKLlLKlLkkLLKlLKKK Bovine lactoferrin (Lf-B) Induction of apoptosis WST-1 assay KB Oral cancer IC50 : 13.2 µMol/L
dbacp04155 LL-37(1-12) LLGDFFRKSKEK LL-37,a series of peptide fragments Cell membrane disintegration MTT/MTS assay KBv Tumor Not found
dbacp04156 LL-37(1-12) LLGDFFRKSKEK LL-37,a series of peptide fragments Cell membrane disintegration MTT/MTS assay KBv Oral cancer Not found
dbacp04158 LL-37(1-4,17-27) LLGDFKRIVQRIKDF LL-37,a series of peptide fragments Cell membrane disintegration MTT/MTS assay KBv Tumor Not found
dbacp04159 LL-37(1-4,17-27) LLGDFKRIVQRIKDF LL-37,a series of peptide fragments Cell membrane disintegration MTT/MTS assay KBv Oral cancer Not found
dbacp04161 LL-37(13-37) IGKEFKRIVQRIKDFLRNLVPRTES LL-37,a series of peptide fragments Cell membrane disintegration MTT/MTS assay KBv Tumor LC50 : 39 µM
dbacp04162 LL-37(13-37) IGKEFKRIVQRIKDFLRNLVPRTES LL-37,a series of peptide fragments Cell membrane disintegration MTT/MTS assay KBv Oral cancer LC50 : 40 µM
dbacp04164 LL-37(13-37)(C-terminal fragment of LL-37; Human, mammals, animals) IGKEFKRIVQRIKDFLRNLVPRTES Human Not specified MTT assay KBv Tumor LC50 : 39 ± 0 μM
dbacp04165 LL-37(13-37)(C-terminal fragment of LL-37; Human, mammals, animals) IGKEFKRIVQRIKDFLRNLVPRTES Human Not specified MTT assay KB Oral cancer LC50 : 40 ± 0 μM
dbacp04167 LL-37(17-29) FKRIVQRIKDFLR LL-37,a series of peptide fragments Cell membrane disintegration MTT/MTS assay KBv Tumor LC50 : 60 µM
dbacp04168 LL-37(17-29) FKRIVQRIKDFLR LL-37,a series of peptide fragments Cell membrane disintegration MTT/MTS assay KBv Oral cancer LC50 : 57 µM
dbacp04171 LL-37(17-29)(C-terminal fragment of LL-37; Human, mammals, animals) FKRIVQRIKDFLRNLV Human Not specified MTT assay KBv Tumor LC50 : 60 ± 0 μM
dbacp04172 LL-37(17-29)(C-terminal fragment of LL-37; Human, mammals, animals) FKRIVQRIKDFLRNLV Human Not specified MTT assay KB Oral cancer LC50 : 57 ± 3 μM
dbacp04174 LL-37(17-32)(C-terminal fragment of LL-37; Human, mammals, animals) FKRIVQRIKDFLRNLV Human Not specified MTT assay KBv Tumor LC50 : 30 ± 0 μM
dbacp04175 LL-37(17-32)(C-terminal fragment of LL-37; Human, mammals, animals) FKRIVQRIKDFLRNLV Human Not specified MTT assay KB Oral cancer LC50 : 30 ± 1 μM
dbacp04177 LL-37(17-32)b FKRIVQRIKDFLRNLV LL-37,a series of peptide fragments Cell membrane disintegration MTT/MTS assay KBv Tumor LC50 : 30 µM
dbacp04178 LL-37(17-32)b FKRIVQRIKDFLRNLV LL-37,a series of peptide fragments Cell membrane disintegration MTT/MTS assay KBv Oral cancer LC50 : 30 µM
dbacp04349 Lytic KLlLKlLkkLLKlLKKK Bovine lactoferrin (Lf-B) Induction of apoptosis WST-1 assay KB Oral cancer IC50 : 37.4 µMol/L
dbacp04917 NRC-03 GRRKRKWLRRIGKGVKIIGGAALDHL Skin mucous secretion of winter flounder Cell membrane damage MTT/MTS assay SKBR-3 Breast cancer 30% Cytotoxic at 5 µM
dbacp04918 NRC-03 GRRKRKWLRRIGKGVKIIGGAALDHL Skin mucous secretion of winter flounder Cell membrane damage MTT/MTS assay SKBR-3 Breast cancer 50% Cytotoxic at 10 µM
dbacp04919 NRC-03 GRRKRKWLRRIGKGVKIIGGAALDHL Skin mucous secretion of winter flounder Cell membrane damage MTT/MTS assay SKBR-3 Breast cancer 70% Cytotoxic at 25 µM
dbacp04920 NRC-03 GRRKRKWLRRIGKGVKIIGGAALDHL Skin mucous secretion of winter flounder Cell membrane damage MTT/MTS assay SKBR-3 Breast cancer 80-85% Cytotoxic at 50 µM
dbacp04940 NRC-03 GRRKRKWLRRIGKGVKIIGGAALDHL Skin mucous secretion of winter flounder Cell membrane damage MTT/MTS assay SKBR-3 Breast cancer 30% Cytotoxic at 5 µM
dbacp04941 NRC-03 GRRKRKWLRRIGKGVKIIGGAALDHL Skin mucous secretion of winter flounder Cell membrane damage MTT/MTS assay SKBR-3 Breast cancer 50% Cytotoxic at 10 µM
dbacp04942 NRC-03 GRRKRKWLRRIGKGVKIIGGAALDHL Skin mucous secretion of winter flounder Cell membrane damage MTT/MTS assay SKBR-3 Breast cancer 70% Cytotoxic at 25 µM
dbacp04943 NRC-03 GRRKRKWLRRIGKGVKIIGGAALDHL Skin mucous secretion of winter flounder Cell membrane damage MTT/MTS assay SKBR-3 Breast cancer 80-85% Cytotoxic at 50 µM
dbacp04962 NRC-07 RWGKWFKKATHVGKHVGKAALTAYL Skin mucous secretion of winter flounder Cell membrane damage MTT/MTS assay SKBR-3 Breast cancer ~0% Cytotoxic at 5 µM
dbacp04963 NRC-07 RWGKWFKKATHVGKHVGKAALTAYL Skin mucous secretion of winter flounder Cell membrane damage MTT/MTS assay SKBR-3 Breast cancer 20% Cytotoxic at 10 µM
dbacp04964 NRC-07 RWGKWFKKATHVGKHVGKAALTAYL Skin mucous secretion of winter flounder Cell membrane damage MTT/MTS assay SKBR-3 Breast cancer 70-80% Cytotoxic at 25 µM
dbacp04965 NRC-07 RWGKWFKKATHVGKHVGKAALTAYL Skin mucous secretion of winter flounder Cell membrane damage MTT/MTS assay SKBR-3 Breast cancer 80-85% Cytotoxic at 50 µM
dbacp04984 NRC-13 GWRTLLKKAEVKTVGKLALKHYL Skin mucous secretion of winter flounder Cell membrane damage MTT/MTS assay SKBR-3 Breast cancer 10% Cytotoxic at 5 µM
dbacp04985 NRC-13 GWRTLLKKAEVKTVGKLALKHYL Skin mucous secretion of winter flounder Cell membrane damage MTT/MTS assay SKBR-3 Breast cancer 10% Cytotoxic at 10 µM
dbacp04986 NRC-13 GWRTLLKKAEVKTVGKLALKHYL Skin mucous secretion of winter flounder Cell membrane damage MTT/MTS assay SKBR-3 Breast cancer 10-15% Cytotoxic at 25 µM
dbacp04987 NRC-13 GWRTLLKKAEVKTVGKLALKHYL Skin mucous secretion of winter flounder Cell membrane damage MTT/MTS assay SKBR-3 Breast cancer 15-20% Cytotoxic at 50 µM
dbacp05307 Peptide 5 fCYwO-CyLeu-Pen-TKKrPKPfQwFwL-CyLeu-KKLMYPTYLKKfQWAV-Aib-HL Synthetic peptide of four designed analogs of vasoactive intestinal peptide, bombesin Not specified MTT/MTS assay KB Oral cancer 10.6 % inhibition of cell proliferation at 1 nM
dbacp05308 Peptide 5 fCYwO-CyLeu-Pen-TKKrPKPfQwFwL-CyLeu-KKLMYPTYLKKfQWAV-Aib-HL Synthetic peptide of four designed analogs of vasoactive intestinal peptide, bombesin Not specified MTT/MTS assay KB Oral cancer 18.2 % inhibition of cell proliferation at 10 nM
dbacp05309 Peptide 5 fCYwO-CyLeu-Pen-TKKrPKPfQwFwL-CyLeu-KKLMYPTYLKKfQWAV-Aib-HL Synthetic peptide of four designed analogs of vasoactive intestinal peptide, bombesin Not specified MTT/MTS assay KB Oral cancer 30.7 % inhibition of cell proliferation at 100 nM
dbacp05310 Peptide 5 fCYwO-CyLeu-Pen-TKKrPKPfQwFwL-CyLeu-KKLMYPTYLKKfQWAV-Aib-HL Synthetic peptide of four designed analogs of vasoactive intestinal peptide, bombesin Not specified MTT/MTS assay KB Oral cancer 43.1 % inhibition of cell proliferation at 1 µM
dbacp05311 Peptide 5 fCYwO-CyLeu-Pen-TKKrPKPfQwFwL-CyLeu-KKLMYPTYLKKfQWAV-Aib-HL Synthetic peptide of four designed analogs of vasoactive intestinal peptide, bombesin Not specified MTT/MTS assay KB Oral cancer 98.3 % inhibition of cell proliferation at 10 µM
dbacp05327 Peptide 5 fCYwO-CyLeu-Pen-TKKrPKPfQwFwL-CyLeu-KKLMYPTYLKKfQWAV-Aib-HL Synthetic peptide of four designed analogs of vasoactive intestinal peptide, bombesin Not specified MTT/MTS assay KB Oral cancer ED50 : 2.1 µM
dbacp06170 SVS-1 KVKVKVKVpPTKVKVKVK Bovine lactoferrin (Lf-B) Disruption of cell membranes MTT/MTS assay KB Oral cancer Not found
dbacp06174 SVS-2 KVKVKVKVPPTKVKVKVK Synthetic peptide Disruption of cell membranes MTT/MTS assay KB Oral cancer IC50 : >100 µM
dbacp07497 HX-12A FFRKVLKLIRKI Synthetic derivative of Temporin-Pta ABCB1 inhibition, MDR reversal, sensitization MTT assay KB-C2 Cervical Cancer IC50 = 6.45 μM
dbacp07498 HX-12B FFRKVLKLIRKIF Synthetic derivative of Temporin-Pta ABCB1 inhibition, MDR reversal, sensitization MTT assay KB-C2 Cervical Cancer IC50 = 7.61 μM
dbacp07499 HX-12C FFRKVLKLIRKIWR Synthetic derivative of Temporin-Pta ABCB1 inhibition, MDR reversal, sensitization MTT assay KB-C2 Cervical Cancer IC50 = 6.06 μM