51 result(s) have been found!
| Accession | Name | Sequence | Source/Organism | Mechanism | Assay Type | Cell Line | Cancer Type | Activity |
|---|---|---|---|---|---|---|---|---|
| dbacp01912 | BpirLAAO-I | ADDKNPLEEFRETNYEVFLEIAKNGLKATSNPKRVVIVGAGMAGLSAAY | Venom base | Inducing apoptosis | MTT assay | SKBR-3 | Breast cancer | Not found |
| dbacp02481 | ChMAP-28 | GRFKRFRKKLKRLWHKVGPFVGPILHY | Domestic goat | Cause cell membrane permeability; Induce necrotic death | Cytotoxic Activity assay, Lactate dehydrogenase (LDH)-Releaseassay, MTT assay | SKBR-3 | Human breast adenocarcinoma | IC50 : 5.63 ± 1.05μM |
| dbacp02628 | D-SVS-1 | kvkvkvkvPptkvkvkvk | Synthetic peptide | Disruption of cell membranes | MTT/MTS assay | KB | Oral cancer | IC50 : 4.5 ± 0.5 µM |
| dbacp02783 | dLL-37(17-32)c | FKRiVQRiKDFlRNLV | LL-37, a series of peptide fragments | Cell membrane disintegration | MTT/MTS assay | KBv | Tumor | Not found |
| dbacp02784 | dLL-37(17-32)c | FKRIVQRIKDFLRNLV | LL-37, a series of peptide fragments | Cell membrane disintegration | MTT/MTS assay | KBv | Oral cancer | Not found |
| dbacp03105 | GM15 | GGTCVIRGCVPKKLM | Not found | Inducing apoptosis | MTT assay | KB | Oral cancer | Not found |
| dbacp03375 | IL-4Rα-lytic hybrid peptide | KQLIRFLKRLDRNGGGKLlLKlLkkLLKlLKKK | Bovine lactoferrin (Lf-B) | Induction of apoptosis | WST-1 assay | KB | Oral cancer | IC50 : 13.2 µMol/L |
| dbacp04155 | LL-37(1-12) | LLGDFFRKSKEK | LL-37,a series of peptide fragments | Cell membrane disintegration | MTT/MTS assay | KBv | Tumor | Not found |
| dbacp04156 | LL-37(1-12) | LLGDFFRKSKEK | LL-37,a series of peptide fragments | Cell membrane disintegration | MTT/MTS assay | KBv | Oral cancer | Not found |
| dbacp04158 | LL-37(1-4,17-27) | LLGDFKRIVQRIKDF | LL-37,a series of peptide fragments | Cell membrane disintegration | MTT/MTS assay | KBv | Tumor | Not found |
| dbacp04159 | LL-37(1-4,17-27) | LLGDFKRIVQRIKDF | LL-37,a series of peptide fragments | Cell membrane disintegration | MTT/MTS assay | KBv | Oral cancer | Not found |
| dbacp04161 | LL-37(13-37) | IGKEFKRIVQRIKDFLRNLVPRTES | LL-37,a series of peptide fragments | Cell membrane disintegration | MTT/MTS assay | KBv | Tumor | LC50 : 39 µM |
| dbacp04162 | LL-37(13-37) | IGKEFKRIVQRIKDFLRNLVPRTES | LL-37,a series of peptide fragments | Cell membrane disintegration | MTT/MTS assay | KBv | Oral cancer | LC50 : 40 µM |
| dbacp04164 | LL-37(13-37)(C-terminal fragment of LL-37; Human, mammals, animals) | IGKEFKRIVQRIKDFLRNLVPRTES | Human | Not specified | MTT assay | KBv | Tumor | LC50 : 39 ± 0 μM |
| dbacp04165 | LL-37(13-37)(C-terminal fragment of LL-37; Human, mammals, animals) | IGKEFKRIVQRIKDFLRNLVPRTES | Human | Not specified | MTT assay | KB | Oral cancer | LC50 : 40 ± 0 μM |
| dbacp04167 | LL-37(17-29) | FKRIVQRIKDFLR | LL-37,a series of peptide fragments | Cell membrane disintegration | MTT/MTS assay | KBv | Tumor | LC50 : 60 µM |
| dbacp04168 | LL-37(17-29) | FKRIVQRIKDFLR | LL-37,a series of peptide fragments | Cell membrane disintegration | MTT/MTS assay | KBv | Oral cancer | LC50 : 57 µM |
| dbacp04171 | LL-37(17-29)(C-terminal fragment of LL-37; Human, mammals, animals) | FKRIVQRIKDFLRNLV | Human | Not specified | MTT assay | KBv | Tumor | LC50 : 60 ± 0 μM |
| dbacp04172 | LL-37(17-29)(C-terminal fragment of LL-37; Human, mammals, animals) | FKRIVQRIKDFLRNLV | Human | Not specified | MTT assay | KB | Oral cancer | LC50 : 57 ± 3 μM |
| dbacp04174 | LL-37(17-32)(C-terminal fragment of LL-37; Human, mammals, animals) | FKRIVQRIKDFLRNLV | Human | Not specified | MTT assay | KBv | Tumor | LC50 : 30 ± 0 μM |
| dbacp04175 | LL-37(17-32)(C-terminal fragment of LL-37; Human, mammals, animals) | FKRIVQRIKDFLRNLV | Human | Not specified | MTT assay | KB | Oral cancer | LC50 : 30 ± 1 μM |
| dbacp04177 | LL-37(17-32)b | FKRIVQRIKDFLRNLV | LL-37,a series of peptide fragments | Cell membrane disintegration | MTT/MTS assay | KBv | Tumor | LC50 : 30 µM |
| dbacp04178 | LL-37(17-32)b | FKRIVQRIKDFLRNLV | LL-37,a series of peptide fragments | Cell membrane disintegration | MTT/MTS assay | KBv | Oral cancer | LC50 : 30 µM |
| dbacp04349 | Lytic | KLlLKlLkkLLKlLKKK | Bovine lactoferrin (Lf-B) | Induction of apoptosis | WST-1 assay | KB | Oral cancer | IC50 : 37.4 µMol/L |
| dbacp04917 | NRC-03 | GRRKRKWLRRIGKGVKIIGGAALDHL | Skin mucous secretion of winter flounder | Cell membrane damage | MTT/MTS assay | SKBR-3 | Breast cancer | 30% Cytotoxic at 5 µM |
| dbacp04918 | NRC-03 | GRRKRKWLRRIGKGVKIIGGAALDHL | Skin mucous secretion of winter flounder | Cell membrane damage | MTT/MTS assay | SKBR-3 | Breast cancer | 50% Cytotoxic at 10 µM |
| dbacp04919 | NRC-03 | GRRKRKWLRRIGKGVKIIGGAALDHL | Skin mucous secretion of winter flounder | Cell membrane damage | MTT/MTS assay | SKBR-3 | Breast cancer | 70% Cytotoxic at 25 µM |
| dbacp04920 | NRC-03 | GRRKRKWLRRIGKGVKIIGGAALDHL | Skin mucous secretion of winter flounder | Cell membrane damage | MTT/MTS assay | SKBR-3 | Breast cancer | 80-85% Cytotoxic at 50 µM |
| dbacp04940 | NRC-03 | GRRKRKWLRRIGKGVKIIGGAALDHL | Skin mucous secretion of winter flounder | Cell membrane damage | MTT/MTS assay | SKBR-3 | Breast cancer | 30% Cytotoxic at 5 µM |
| dbacp04941 | NRC-03 | GRRKRKWLRRIGKGVKIIGGAALDHL | Skin mucous secretion of winter flounder | Cell membrane damage | MTT/MTS assay | SKBR-3 | Breast cancer | 50% Cytotoxic at 10 µM |
| dbacp04942 | NRC-03 | GRRKRKWLRRIGKGVKIIGGAALDHL | Skin mucous secretion of winter flounder | Cell membrane damage | MTT/MTS assay | SKBR-3 | Breast cancer | 70% Cytotoxic at 25 µM |
| dbacp04943 | NRC-03 | GRRKRKWLRRIGKGVKIIGGAALDHL | Skin mucous secretion of winter flounder | Cell membrane damage | MTT/MTS assay | SKBR-3 | Breast cancer | 80-85% Cytotoxic at 50 µM |
| dbacp04962 | NRC-07 | RWGKWFKKATHVGKHVGKAALTAYL | Skin mucous secretion of winter flounder | Cell membrane damage | MTT/MTS assay | SKBR-3 | Breast cancer | ~0% Cytotoxic at 5 µM |
| dbacp04963 | NRC-07 | RWGKWFKKATHVGKHVGKAALTAYL | Skin mucous secretion of winter flounder | Cell membrane damage | MTT/MTS assay | SKBR-3 | Breast cancer | 20% Cytotoxic at 10 µM |
| dbacp04964 | NRC-07 | RWGKWFKKATHVGKHVGKAALTAYL | Skin mucous secretion of winter flounder | Cell membrane damage | MTT/MTS assay | SKBR-3 | Breast cancer | 70-80% Cytotoxic at 25 µM |
| dbacp04965 | NRC-07 | RWGKWFKKATHVGKHVGKAALTAYL | Skin mucous secretion of winter flounder | Cell membrane damage | MTT/MTS assay | SKBR-3 | Breast cancer | 80-85% Cytotoxic at 50 µM |
| dbacp04984 | NRC-13 | GWRTLLKKAEVKTVGKLALKHYL | Skin mucous secretion of winter flounder | Cell membrane damage | MTT/MTS assay | SKBR-3 | Breast cancer | 10% Cytotoxic at 5 µM |
| dbacp04985 | NRC-13 | GWRTLLKKAEVKTVGKLALKHYL | Skin mucous secretion of winter flounder | Cell membrane damage | MTT/MTS assay | SKBR-3 | Breast cancer | 10% Cytotoxic at 10 µM |
| dbacp04986 | NRC-13 | GWRTLLKKAEVKTVGKLALKHYL | Skin mucous secretion of winter flounder | Cell membrane damage | MTT/MTS assay | SKBR-3 | Breast cancer | 10-15% Cytotoxic at 25 µM |
| dbacp04987 | NRC-13 | GWRTLLKKAEVKTVGKLALKHYL | Skin mucous secretion of winter flounder | Cell membrane damage | MTT/MTS assay | SKBR-3 | Breast cancer | 15-20% Cytotoxic at 50 µM |
| dbacp05307 | Peptide 5 | fCYwO-CyLeu-Pen-TKKrPKPfQwFwL-CyLeu-KKLMYPTYLKKfQWAV-Aib-HL | Synthetic peptide of four designed analogs of vasoactive intestinal peptide, bombesin | Not specified | MTT/MTS assay | KB | Oral cancer | 10.6 % inhibition of cell proliferation at 1 nM |
| dbacp05308 | Peptide 5 | fCYwO-CyLeu-Pen-TKKrPKPfQwFwL-CyLeu-KKLMYPTYLKKfQWAV-Aib-HL | Synthetic peptide of four designed analogs of vasoactive intestinal peptide, bombesin | Not specified | MTT/MTS assay | KB | Oral cancer | 18.2 % inhibition of cell proliferation at 10 nM |
| dbacp05309 | Peptide 5 | fCYwO-CyLeu-Pen-TKKrPKPfQwFwL-CyLeu-KKLMYPTYLKKfQWAV-Aib-HL | Synthetic peptide of four designed analogs of vasoactive intestinal peptide, bombesin | Not specified | MTT/MTS assay | KB | Oral cancer | 30.7 % inhibition of cell proliferation at 100 nM |
| dbacp05310 | Peptide 5 | fCYwO-CyLeu-Pen-TKKrPKPfQwFwL-CyLeu-KKLMYPTYLKKfQWAV-Aib-HL | Synthetic peptide of four designed analogs of vasoactive intestinal peptide, bombesin | Not specified | MTT/MTS assay | KB | Oral cancer | 43.1 % inhibition of cell proliferation at 1 µM |
| dbacp05311 | Peptide 5 | fCYwO-CyLeu-Pen-TKKrPKPfQwFwL-CyLeu-KKLMYPTYLKKfQWAV-Aib-HL | Synthetic peptide of four designed analogs of vasoactive intestinal peptide, bombesin | Not specified | MTT/MTS assay | KB | Oral cancer | 98.3 % inhibition of cell proliferation at 10 µM |
| dbacp05327 | Peptide 5 | fCYwO-CyLeu-Pen-TKKrPKPfQwFwL-CyLeu-KKLMYPTYLKKfQWAV-Aib-HL | Synthetic peptide of four designed analogs of vasoactive intestinal peptide, bombesin | Not specified | MTT/MTS assay | KB | Oral cancer | ED50 : 2.1 µM |
| dbacp06170 | SVS-1 | KVKVKVKVpPTKVKVKVK | Bovine lactoferrin (Lf-B) | Disruption of cell membranes | MTT/MTS assay | KB | Oral cancer | Not found |
| dbacp06174 | SVS-2 | KVKVKVKVPPTKVKVKVK | Synthetic peptide | Disruption of cell membranes | MTT/MTS assay | KB | Oral cancer | IC50 : >100 µM |
| dbacp07497 | HX-12A | FFRKVLKLIRKI | Synthetic derivative of Temporin-Pta | ABCB1 inhibition, MDR reversal, sensitization | MTT assay | KB-C2 | Cervical Cancer | IC50 = 6.45 μM |
| dbacp07498 | HX-12B | FFRKVLKLIRKIF | Synthetic derivative of Temporin-Pta | ABCB1 inhibition, MDR reversal, sensitization | MTT assay | KB-C2 | Cervical Cancer | IC50 = 7.61 μM |
| dbacp07499 | HX-12C | FFRKVLKLIRKIWR | Synthetic derivative of Temporin-Pta | ABCB1 inhibition, MDR reversal, sensitization | MTT assay | KB-C2 | Cervical Cancer | IC50 = 6.06 μM |