dbACP: A Comprehensive Database of Anti-Cancer Peptides

218 result(s) have been found!

Accession Name Sequence Source/Organism Mechanism Assay Type Cell Line Cancer Type Activity
dbacp01596 BF-30 KFFRKLKKSVKKRAKEFFKKPRVIGVSIPF Banded krait Cytoplasmic membrane permeabilization and DNAspecified-binding Lactate dehydrogenase release assay, DNA retardation assay, Real-time PCR, Western blot, wound healing assay, and chick embryo chorioallantoic membrane assay B16F10 Human Colon cancer IC50 : 7.3 μM
dbacp01597 BF-30 KFFRKLKKSVKKRAKEFFKKPRVIGVSIPF Banded krait Cytoplasmic membrane permeabilization and DNAspecified-binding Lactate dehydrogenase release assay, DNA retardation assay, Real-time PCR, Western blot, wound healing assay, and chick embryo chorioallantoic membrane assay B16 Human Cervical cancer IC50 : 13.9 μM
dbacp01843 BLP-7 GIGGALLSAGKSALKGLAKGLAEHFAN Oriental Fire-bellied Toad Cell membrane Permeabilization MTT assay Hep G2 Human hepatoma IC50 : 2.83 μM
dbacp01844 BLP-7 GIGGALLSAGKSALKGLAKGLAEHFAN Oriental Fire-bellied Toad Cell membrane Permeabilization MTT assay SK-HEP-1 Human hepatoma IC50 : 0.61μM
dbacp01845 BLP-7 GIGGALLSAGKSALKGLAKGLAEHFAN Oriental Fire-bellied Toad Cell membrane Permeabilization MTT assay Huh7 Human hepatoma IC50 : 3.87 μM
dbacp01857 Bombinin H-BO IIGPVLGLIGKALGGLL Oriental Fire-bellied Toad Cell Membrane Permeabilization MTT assay Hep G2 Human hepatoma IC50 : 3.87μM
dbacp01858 Bombinin H-BO IIGPVLGLIGKALGGLL Oriental Fire-bellied Toad Cell Membrane Permeabilization MTT assay SK-HEP-1 Human hepatoma IC50 : 1.81 μM
dbacp01859 Bombinin H-BO IIGPVLGLIGKALGGLL Oriental Fire-bellied Toad Cell Membrane Permeabilization MTT assay Huh8 Human hepatoma IC50 : 1.81 μM
dbacp02678 Dermaseptin-PH ALWKEVLKNAGKAALNEINNLVQ Northern orange-legged leaf frog Cell membrane permeabilization Bioactivity assessment assay, MTT cell proliferation assay MCF-7 Not specified IC50 : 0.69 μM
dbacp02679 Dermaseptin-PH ALWKEVLKNAGKAALNEINNLVQ Northern orange-legged leaf frog Cell membrane permeabilization Bioactivity assessment assay, MTT cell proliferation assay H157 Not specified IC50 : 2.01 μM
dbacp02680 Dermaseptin-PH ALWKEVLKNAGKAALNEINNLVQ Northern orange-legged leaf frog Cell membrane permeabilization Bioactivity assessment assay, MTT cell proliferation assay U251MG Not specified IC50 : 2.36 μM
dbacp02681 Dermaseptin-PH ALWKEVLKNAGKAALNEINNLVQ Northern orange-legged leaf frog Cell membrane permeabilization Bioactivity assessment assay, MTT cell proliferation assay MDA-MB-435S Not specified IC50 : 9.94 μM
dbacp02682 Dermaseptin-PH ALWKEVLKNAGKAALNEINNLVQ Northern orange-legged leaf frog Cell membrane permeabilization Bioactivity assessment assay, MTT cell proliferation assay PC-3 Not specified IC50 : 11.8 μM
dbacp02683 Dermaseptin-PH ALWKEVLKNAGKAALNEINNLV Orange-legged leaf frog, Northern orange-legged leaf frog, South America Cell membrane permeabilization MTT cell proliferation assay MCF-7 Lung cancer IC50 : 0.69 μM
dbacp02684 Dermaseptin-PH ALWKEVLKNAGKAALNEINNLV Orange-legged leaf frog, Northern orange-legged leaf frog, South America Cell membrane permeabilization MTT cell proliferation assay H157 Glioma IC50 : 2.01 μM
dbacp02685 Dermaseptin-PH ALWKEVLKNAGKAALNEINNLV Orange-legged leaf frog, Northern orange-legged leaf frog, South America Cell membrane permeabilization MTT cell proliferation assay U251MG Prostate cancer IC50 : 2.36 μM
dbacp02686 Dermaseptin-PH ALWKEVLKNAGKAALNEINNLV Orange-legged leaf frog, Northern orange-legged leaf frog, South America Cell membrane permeabilization MTT cell proliferation assay MDA-MB-435S Breast cancer IC50 : 9.94 μM
dbacp02687 Dermaseptin-PH ALWKEVLKNAGKAALNEINNLV Orange-legged leaf frog, Northern orange-legged leaf frog, South America Cell membrane permeabilization MTT cell proliferation assay PC-3 Human prostate carcinoma IC50 : 11.8 μM
dbacp02843 Epinecidin-1 GFIFHIIKGLFHAGKMIHGLV Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HeLa Cervical cancer 45% Cytotoxicity at 50 mg/L
dbacp02844 Epinecidin-1 GFIFHIIKGLFHAGKMIHGLV Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HeLa Cervical cancer 38% Cytotoxicity at 25 mg/L
dbacp02845 Epinecidin-1 GFIFHIIKGLFHAGKMIHGLV Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HeLa Cervical cancer 75% Cytotoxicity at 50 mg/L
dbacp02846 Epinecidin-1 GFIFHIIKGLFHAGKMIHGLV Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HeLa Cervical cancer 65% Cytotoxicity at 25 mg/L
dbacp02847 Epinecidin-1 GFIFHIIKGLFHAGKMIHGLV Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HeLa Cervical cancer 75 % Cytotoxicity at 50 mg/L
dbacp02848 Epinecidin-1 GFIFHIIKGLFHAGKMIHGLV Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HeLa Cervical cancer 65% Cytotoxicity at 25 mg/L
dbacp02849 Epinecidin-1 GFIFHIIKGLFHAGKMIHGLV Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HeLa Cervical cancer 83% Cytotoxicity at 50 mg/L
dbacp02850 Epinecidin-1 GFIFHIIKGLFHAGKMIHGLV Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HeLa Cervical cancer 77 % Cytotoxicity at 25 mg/L
dbacp02851 Epinecidin-1 GFIFHIIKGLFHAGKMIHGLV Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 82 % Cytotoxicity at 50 mg/L
dbacp02852 Epinecidin-1 GFIFHIIKGLFHAGKMIHGLV Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 85 % Cytotoxicity at 25 mg/L
dbacp02853 Epinecidin-1 GFIFHIIKGLFHAGKMIHGLV Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 42 % Cytotoxicity at 12.5 mg/L
dbacp02854 Epinecidin-1 GFIFHIIKGLFHAGKMIHGLV Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 41 % Cytotoxicity at 6.25 mg/L
dbacp02855 Epinecidin-1 GFIFHIIKGLFHAGKMIHGLV Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 39 % Cytotoxicity at 3.125 mg/L
dbacp02856 Epinecidin-1 GFIFHIIKGLFHAGKMIHGLV Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 90 % Cytotoxicity at 50 mg/L
dbacp02857 Epinecidin-1 GFIFHIIKGLFHAGKMIHGLV Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 95 % Cytotoxicity at 25 mg/L
dbacp02858 Epinecidin-1 GFIFHIIKGLFHAGKMIHGLV Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 45 % Cytotoxicity at 12.5 mg/L
dbacp02859 Epinecidin-1 GFIFHIIKGLFHAGKMIHGLV Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 25 % Cytotoxicity at 6.25 mg/L
dbacp02860 Epinecidin-1 GFIFHIIKGLFHAGKMIHGLV Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 25 % Cytotoxicity at 3.125 mg/L
dbacp02861 Epinecidin-1 GFIFHIIKGLFHAGKMIHGLV Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 95 % Cytotoxicity at 50 mg/L
dbacp02862 Epinecidin-1 GFIFHIIKGLFHAGKMIHGLV Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 96 % Cytotoxicity at 25 mg/L
dbacp02863 Epinecidin-1 GFIFHIIKGLFHAGKMIHGLV Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 46 % Cytotoxicity at 12.5 mg/L
dbacp02864 Epinecidin-1 GFIFHIIKGLFHAGKMIHGLV Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 30 % Cytotoxicity at 6.25 mg/L
dbacp02865 Epinecidin-1 GFIFHIIKGLFHAGKMIHGLV Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 28 % Cytotoxicity at 3.125 mg/L
dbacp02866 Epinecidin-1 GFIFHIIKGLFHAGKMIHGLV Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 84 % Cytotoxicity at 50 mg/L
dbacp02867 Epinecidin-1 GFIFHIIKGLFHAGKMIHGLV Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 85 % Cytotoxicity at 25 mg/L
dbacp02868 Epinecidin-1 GFIFHIIKGLFHAGKMIHGLV Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 38 % Cytotoxicity at 12.5 mg/L
dbacp02869 Epinecidin-1 GFIFHIIKGLFHAGKMIHGLV Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 30 % Cytotoxicity at 6.25 mg/L
dbacp02870 Epinecidin-1 GFIFHIIKGLFHAGKMIHGLV Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 28 % Cytotoxicity at 3.125 mg/L
dbacp02874 Epinecidin-8 FIFHIIKGLFHAGKMI Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HeLa Cervical cancer 60 % Cytotoxicity at 50 mg/L
dbacp02875 Epinecidin-8 FIFHIIKGLFHAGKMI Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HeLa Cervical cancer 50 % Cytotoxicity at 25 mg/L
dbacp02876 Epinecidin-8 FIFHIIKGLFHAGKMI Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HeLa Cervical cancer 8 % Cytotoxicity at 12.5 mg/L
dbacp02877 Epinecidin-8 FIFHIIKGLFHAGKMI Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HeLa Cervical cancer 10 % Cytotoxicity at 6.25 mg/L
dbacp02878 Epinecidin-8 FIFHIIKGLFHAGKMI Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HeLa Cervical cancer 5 % Cytotoxicity at 3.125 mg/L
dbacp02879 Epinecidin-8 FIFHIIKGLFHAGKMI Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HeLa Cervical cancer 75 % Cytotoxicity at 50 mg/L
dbacp02880 Epinecidin-8 FIFHIIKGLFHAGKMI Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HeLa Cervical cancer 70 % Cytotoxicity at 25 mg/L
dbacp02881 Epinecidin-8 FIFHIIKGLFHAGKMI Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HeLa Cervical cancer 5 % Cytotoxicity at 12.5 mg/L
dbacp02882 Epinecidin-8 FIFHIIKGLFHAGKMI Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HeLa Cervical cancer 7 % Cytotoxicity at 6.25 mg/L
dbacp02883 Epinecidin-8 FIFHIIKGLFHAGKMI Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HeLa Cervical cancer 10 % Cytotoxicity at 3.125 mg/L
dbacp02884 Epinecidin-8 FIFHIIKGLFHAGKMI Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HeLa Cervical cancer 76 % Cytotoxicity at 50 mg/L
dbacp02885 Epinecidin-8 FIFHIIKGLFHAGKMI Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HeLa Cervical cancer 70 % Cytotoxicity at 25 mg/L
dbacp02886 Epinecidin-8 FIFHIIKGLFHAGKMI Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HeLa Cervical cancer 12 % Cytotoxicity at 12.5 mg/L
dbacp02887 Epinecidin-8 FIFHIIKGLFHAGKMI Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HeLa Cervical cancer 4 % Cytotoxicity at 6.25 mg/L
dbacp02888 Epinecidin-8 FIFHIIKGLFHAGKMI Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HeLa Cervical cancer 4 % Cytotoxicity at 3.125 mg/L
dbacp02889 Epinecidin-8 FIFHIIKGLFHAGKMI Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HeLa Cervical cancer 90 % Cytotoxicity at 50 mg/L
dbacp02890 Epinecidin-8 FIFHIIKGLFHAGKMI Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HeLa Cervical cancer 75 % Cytotoxicity at 25 mg/L
dbacp02891 Epinecidin-8 FIFHIIKGLFHAGKMI Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HeLa Cervical cancer 8 % Cytotoxicity at 12.5 mg/L
dbacp02892 Epinecidin-8 FIFHIIKGLFHAGKMI Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HeLa Cervical cancer 3 % Cytotoxicity at 6.25 mg/L
dbacp02893 Epinecidin-8 FIFHIIKGLFHAGKMI Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HeLa Cervical cancer 3 % Cytotoxicity at 3.125 mg/L
dbacp02894 Epinecidin-8 FIFHIIKGLFHAGKMI Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 60 % Cytotoxicity at 50 mg/L
dbacp02895 Epinecidin-8 FIFHIIKGLFHAGKMI Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 50 % Cytotoxicity at 25 mg/L
dbacp02896 Epinecidin-8 FIFHIIKGLFHAGKMI Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 8 % Cytotoxicity at 12.5 mg/L
dbacp02897 Epinecidin-8 FIFHIIKGLFHAGKMI Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 10 % Cytotoxicity at 6.25 mg/L
dbacp02898 Epinecidin-8 FIFHIIKGLFHAGKMI Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 5 % Cytotoxicity at 3.125 mg/L
dbacp02899 Epinecidin-8 FIFHIIKGLFHAGKMI Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 75 % Cytotoxicity at 50 mg/L
dbacp02900 Epinecidin-8 FIFHIIKGLFHAGKMI Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 70 % Cytotoxicity at 25 mg/L
dbacp02901 Epinecidin-8 FIFHIIKGLFHAGKMI Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 5 %Cytotoxicity at 12.5 mg/L
dbacp02902 Epinecidin-8 FIFHIIKGLFHAGKMI Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 7 % Cytotoxicity at 6.25 mg/L
dbacp02903 Epinecidin-8 FIFHIIKGLFHAGKMI Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 10 % Cytotoxicity at 3.125 mg/L
dbacp02904 Epinecidin-8 FIFHIIKGLFHAGKMI Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 76 % Cytotoxicity at 50 mg/L
dbacp02905 Epinecidin-8 FIFHIIKGLFHAGKMI Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 70 % Cytotoxicity at 25 mg/L
dbacp02906 Epinecidin-8 FIFHIIKGLFHAGKMI Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 12 % Cytotoxicity at 12.5 mg/L
dbacp02907 Epinecidin-8 FIFHIIKGLFHAGKMI Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 4 % Cytotoxicity at 6.25 mg/L
dbacp02908 Epinecidin-8 FIFHIIKGLFHAGKMI Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 4 % Cytotoxicity at 3.125 mg/L
dbacp02909 Epinecidin-8 FIFHIIKGLFHAGKMI Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 90 % Cytotoxicity at 50 mg/L
dbacp02910 Epinecidin-8 FIFHIIKGLFHAGKMI Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 75 % Cytotoxicity at 25 mg/L
dbacp02911 Epinecidin-8 FIFHIIKGLFHAGKMI Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 8 % Cytotoxicity at 12.5 mg/L
dbacp02912 Epinecidin-8 FIFHIIKGLFHAGKMI Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 3 % Cytotoxicity at 6.25 mg/L
dbacp02913 Epinecidin-8 FIFHIIKGLFHAGKMI Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 3 % Cytotoxicity at 3.125 mg/L
dbacp03124 Gomesin GCRRLCYKQRCVTYCRGR Tarantula spider sp. Membrane permeabilization Lactate dehydrogenase (LDH) assay U-87 MG Glioblastoma MIC : 10 mM
dbacp03522 KillerFLIP YGRKKRRQRRRREADFFWSLCTADMS Not found Apoptotic activity and necroptosis; Plasma membrane permeabilization Not specified Jurkat Blood cancer Not found
dbacp05139 Pardaxin-1 GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HeLa Cervical cancer 62 % Cytotoxicity at 50 mg/L
dbacp05140 Pardaxin-1 GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HeLa Cervical cancer 44 % Cytotoxicity at 25 mg/L
dbacp05141 Pardaxin-1 GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HeLa Cervical cancer 4 % Cytotoxicity at 12.5 mg/L
dbacp05142 Pardaxin-1 GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HeLa Cervical cancer 75 % Cytotoxicity at 50 mg/L
dbacp05143 Pardaxin-1 GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HeLa Cervical cancer 70 % Cytotoxicity at 25 mg/L
dbacp05144 Pardaxin-1 GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HeLa Cervical cancer 4 % Cytotoxicity at 3.125 mg/L
dbacp05145 Pardaxin-1 GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HeLa Cervical cancer 78 % Cytotoxicity at 50 mg/L
dbacp05146 Pardaxin-1 GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HeLa Cervical cancer 68 % Cytotoxicity at 25 mg/L
dbacp05147 Pardaxin-1 GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HeLa Cervical cancer 4 % Cytotoxicity at 12.5 mg/L
dbacp05148 Pardaxin-1 GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HeLa Cervical cancer 5 % Cytotoxicity at 6.25 mg/L
dbacp05149 Pardaxin-1 GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HeLa Cervical cancer 10 % Cytotoxicity at 3.125 mg/L
dbacp05150 Pardaxin-1 GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HeLa Cervical cancer 90 % Cytotoxicity at 50 mg/L
dbacp05151 Pardaxin-1 GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HeLa Cervical cancer 80 % Cytotoxicity at 25 mg/L
dbacp05152 Pardaxin-1 GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HeLa Cervical cancer 15 % Cytotoxicity at 12.5 mg/L
dbacp05153 Pardaxin-1 GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HeLa Cervical cancer 12 % Cytotoxicity at 6.25 mg/L
dbacp05154 Pardaxin-1 GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HeLa Cervical cancer 5 % Cytotoxicity at 3.125 mg/L
dbacp05155 Pardaxin-1 GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 88 % Cytotoxicity at 50 mg/L
dbacp05156 Pardaxin-1 GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 82 % Cytotoxicity at 25 mg/L
dbacp05157 Pardaxin-1 GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 40 % Cytotoxicity at 12.5 mg/L
dbacp05158 Pardaxin-1 GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 35 % Cytotoxicity at 6.25 mg/L
dbacp05159 Pardaxin-1 GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 35 % Cytotoxicity at 3.125 mg/L
dbacp05160 Pardaxin-1 GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 90 % Cytotoxicity at 50 mg/L
dbacp05161 Pardaxin-1 GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 90 % Cytotoxicity at 25 mg/L
dbacp05162 Pardaxin-1 GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 30 % Cytotoxicity at 12.5 mg/L
dbacp05163 Pardaxin-1 GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 30 % Cytotoxicity at 6.25 mg/L
dbacp05164 Pardaxin-1 GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 30 % Cytotoxicity at 3.125 mg/L
dbacp05165 Pardaxin-1 GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 97 % Cytotoxicity at 50 mg/L
dbacp05166 Pardaxin-1 GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 95 % Cytotoxicity at 25 mg/L
dbacp05167 Pardaxin-1 GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 39 % Cytotoxicity at 12.5 mg/L
dbacp05168 Pardaxin-1 GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 28 % Cytotoxicity at 6.25 mg/L
dbacp05169 Pardaxin-1 GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 38 % Cytotoxicity at 3.125 mg/L
dbacp05170 Pardaxin-1 GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 90 % Cytotoxicity at 50 mg/L
dbacp05171 Pardaxin-1 GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 90 % Cytotoxicity at 25 mg/L
dbacp05172 Pardaxin-1 GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 15 % Cytotoxicity at 12.5 mg/L
dbacp05173 Pardaxin-1 GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 5 % Cytotoxicity at 6.25 mg/L
dbacp05174 Pardaxin-1 GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 10 % Cytotoxicity at 3.125 mg/L
dbacp05175 Pardaxin-6 GFFALIPKIISSPLFKTLLSAVGSALS Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HeLa Cervical cancer 70 % Cytotoxicity at 50 mg/L
dbacp05176 Pardaxin-6 GFFALIPKIISSPLFKTLLSAVGSALS Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HeLa Cervical cancer 60 % Cytotoxicity at 25 mg/L
dbacp05177 Pardaxin-6 GFFALIPKIISSPLFKTLLSAVGSALS Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HeLa Cervical cancer 4 % Cytotoxicity at 12.5 mg/L
dbacp05178 Pardaxin-6 GFFALIPKIISSPLFKTLLSAVGSALS Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HeLa Cervical cancer 5 % Cytotoxicity at 6.25 mg/L
dbacp05179 Pardaxin-6 GFFALIPKIISSPLFKTLLSAVGSALS Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HeLa Cervical cancer 1 % Cytotoxicity at 3.125 mg/L
dbacp05180 Pardaxin-6 GFFALIPKIISSPLFKTLLSAVGSALS Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HeLa Cervical cancer 78 % Cytotoxicity at 50 mg/L
dbacp05181 Pardaxin-6 GFFALIPKIISSPLFKTLLSAVGSALS Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HeLa Cervical cancer 70 % Cytotoxicity at 25 mg/L
dbacp05182 Pardaxin-6 GFFALIPKIISSPLFKTLLSAVGSALS Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HeLa Cervical cancer 10 % Cytotoxicity at 12.5 mg/L
dbacp05183 Pardaxin-6 GFFALIPKIISSPLFKTLLSAVGSALS Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HeLa Cervical cancer 10 % Cytotoxicity at 6.25 mg/L
dbacp05184 Pardaxin-6 GFFALIPKIISSPLFKTLLSAVGSALS Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HeLa Cervical cancer 5 % Cytotoxicity at 3.125 mg/L
dbacp05185 Pardaxin-6 GFFALIPKIISSPLFKTLLSAVGSALS Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HeLa Cervical cancer 82 % Cytotoxicity at 50 mg/L
dbacp05186 Pardaxin-6 GFFALIPKIISSPLFKTLLSAVGSALS Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HeLa Cervical cancer 70 % Cytotoxicity at 25 mg/L
dbacp05187 Pardaxin-6 GFFALIPKIISSPLFKTLLSAVGSALS Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HeLa Cervical cancer 18 % Cytotoxicity at 12.5 mg/L
dbacp05188 Pardaxin-6 GFFALIPKIISSPLFKTLLSAVGSALS Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HeLa Cervical cancer 4 % Cytotoxicity at 6.25 mg/L
dbacp05189 Pardaxin-6 GFFALIPKIISSPLFKTLLSAVGSALS Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HeLa Cervical cancer 10 % Cytotoxicity at 3.125 mg/L
dbacp05190 Pardaxin-6 GFFALIPKIISSPLFKTLLSAVGSALS Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HeLa Cervical cancer 90 % Cytotoxicity at 50 mg/L
dbacp05191 Pardaxin-6 GFFALIPKIISSPLFKTLLSAVGSALS Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HeLa Cervical cancer 82 % Cytotoxicity at 25 mg/L
dbacp05192 Pardaxin-6 GFFALIPKIISSPLFKTLLSAVGSALS Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HeLa Cervical cancer 18 % Cytotoxicity at 12.5 mg/L
dbacp05193 Pardaxin-6 GFFALIPKIISSPLFKTLLSAVGSALS Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HeLa Cervical cancer 18 % Cytotoxicity at 6.25 mg/L
dbacp05194 Pardaxin-6 GFFALIPKIISSPLFKTLLSAVGSALS Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HeLa Cervical cancer 18 % Cytotoxicity at 3.125 mg/L
dbacp05195 Pardaxin-6 GFFALIPKIISSPLFKTLLSAVGSALS Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 80 % Cytotoxicity at 50 mg/L
dbacp05196 Pardaxin-6 GFFALIPKIISSPLFKTLLSAVGSALS Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 85 % Cytotoxicity at 25 mg/L
dbacp05197 Pardaxin-6 GFFALIPKIISSPLFKTLLSAVGSALS Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 45 % Cytotoxicity at 12.5 mg/L
dbacp05198 Pardaxin-6 GFFALIPKIISSPLFKTLLSAVGSALS Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 30 % Cytotoxicity at 6.25 mg/L
dbacp05199 Pardaxin-6 GFFALIPKIISSPLFKTLLSAVGSALS Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 25 % Cytotoxicity at 3.125 mg/L
dbacp05200 Pardaxin-6 GFFALIPKIISSPLFKTLLSAVGSALS Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 84 % Cytotoxicity at 50 mg/L
dbacp05201 Pardaxin-6 GFFALIPKIISSPLFKTLLSAVGSALS Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 84% Cytotoxicity at 25 mg/L
dbacp05202 Pardaxin-6 GFFALIPKIISSPLFKTLLSAVGSALS Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 48 % Cytotoxicity at 12.5 mg/L
dbacp05203 Pardaxin-6 GFFALIPKIISSPLFKTLLSAVGSALS Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 30 % Cytotoxicity at 6.25 mg/L
dbacp05204 Pardaxin-6 GFFALIPKIISSPLFKTLLSAVGSALS Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 35 % Cytotoxicity at 3.125 mg/L
dbacp05205 Pardaxin-6 GFFALIPKIISSPLFKTLLSAVGSALS Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 90 % Cytotoxicity at 50 mg/L
dbacp05206 Pardaxin-6 GFFALIPKIISSPLFKTLLSAVGSALS Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 85 % Cytotoxicity at 25 mg/L
dbacp05207 Pardaxin-6 GFFALIPKIISSPLFKTLLSAVGSALS Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 30 % Cytotoxicity at 12.5 mg/L
dbacp05208 Pardaxin-6 GFFALIPKIISSPLFKTLLSAVGSALS Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 35 % Cytotoxicity at 6.25 mg/L
dbacp05209 Pardaxin-6 GFFALIPKIISSPLFKTLLSAVGSALS Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 15 % Cytotoxicity at 3.125 mg/L
dbacp05210 Pardaxin-6 GFFALIPKIISSPLFKTLLSAVGSALS Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 90 % Cytotoxicity at 50 mg/L
dbacp05211 Pardaxin-6 GFFALIPKIISSPLFKTLLSAVGSALS Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 90 % Cytotoxicity at 25 mg/L
dbacp05212 Pardaxin-6 GFFALIPKIISSPLFKTLLSAVGSALS Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 20 % Cytotoxicity at 12.5 mg/L
dbacp05213 Pardaxin-6 GFFALIPKIISSPLFKTLLSAVGSALS Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 1 % Cytotoxicity at 6.25 mg/L
dbacp05214 Pardaxin-6 GFFALIPKIISSPLFKTLLSAVGSALS Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 10 % Cytotoxicity at 3.125 mg/L
dbacp05215 PcTx-1 EDCIPKWKGCVNRHGDCCEGLECWKRRRSFEVCVPKTPKTOHa Trinidad chevron tarantula Membrane permeabilization Transwell Migration assay, Scratch wound migration assay D54-MG Glioma Not found
dbacp06723 L14 ALWKSILKNAGKALNEINQIVQ Dermaseptin-SS1- Analog Membrane Permeabilization MTT assay H-838 Lung Cancer IC50 = 64.4 µM
dbacp06724 L14 ALWKSILKNAGKALNEINQIVQ Dermaseptin-SS1- Analog Membrane Permeabilization MTT assay H-460 Lung Cancer IC50 = 20.1 µM
dbacp06725 14V ALWKSILKNAGKAVLNEINQIVQ Dermaseptin-SS1- Analog Membrane Permeabilization MTT assay H-838 Lung Cancer IC50 = 7.0 µM
dbacp06726 14V ALWKSILKNAGKAVLNEINQIVQ Dermaseptin-SS1- Analog Membrane Permeabilization MTT assay H-460 Lung Cancer IC50 = 4.1 µM
dbacp06727 14G ALWKSILKNAGKAGLNEINQIVQ Dermaseptin-SS1- Analog Membrane Permeabilization MTT assay H-838 Lung Cancer IC50 = 48.7 µM
dbacp06728 14G ALWKSILKNAGKAGLNEINQIVQ Dermaseptin-SS1- Analog Membrane Permeabilization MTT assay H-460 Lung Cancer IC50 = 31.7 µM
dbacp06729 L2V ALWKSILKNVGKVLNEINQIVQ Dermaseptin-SS1- Analog Membrane Permeabilization MTT assay H-838 Lung Cancer IC50 = 2.2 µM
dbacp06730 L2V ALWKSILKNVGKVLNEINQIVQ Dermaseptin-SS1- Analog Membrane Permeabilization MTT assay H-460 Lung Cancer IC50 = 0.6 µM
dbacp06731 14V5K ALWKKILKNAGKAVLNEINQIVQ Dermaseptin-SS1- Analog Membrane Permeabilization MTT assay H-838 Lung Cancer IC50 = 8.1 µM
dbacp06732 14V5K ALWKKILKNAGKAVLNEINQIVQ Dermaseptin-SS1- Analog Membrane Permeabilization MTT assay H-460 Lung Cancer IC50 = 6.1 µM
dbacp06733 14VL23 ALWKSILKNAGKAVLNEINQIV Dermaseptin-SS1- Analog Membrane Permeabilization MTT assay H-838 Lung Cancer IC50 = 5.7 µM
dbacp06734 14VL23 ALWKSILKNAGKAVLNEINQIV Dermaseptin-SS1- Analog Membrane Permeabilization MTT assay H-460 Lung Cancer IC50 = 16.4 µM
dbacp06774 PMAP-NC RIIDRLWLVRRPQKPKFVLVWVL Synthetic Analgog of PMAP-23 Membrane permeabilization MTT assay MDA-MB-361 Breast Cancer IC50 = 6.4 μM
dbacp06775 PMAP-NC RIIDRLWLVRRPQKPKFVLVWVL Synthetic Analgog of PMAP-24 Membrane permeabilization MTT assay A-549 Lung Cancer IC50 = 7.1 μM
dbacp07599 Tritrp-Agb V(Agb)(Agb)FPWWWPFL(Agb)(Agb) Synthetic Membrane permeabilization via lysine substitution MTT assay Jurkat Blood Cancer IC50 = 9.6 μM
dbacp07600 Tritrp-hArg V(hArg)(hArg)FPWWWPFL(hArg)(hArg) Synthetic Membrane permeabilization via lysine substitution MTT assay Jurkat Blood Cancer IC50 = 13.3 μM
dbacp07601 Tritrp-Lys VKKFPWWWPFLKK Synthetic Membrane permeabilization via lysine substitution MTT assay Jurkat Blood Cancer IC50 = 11.5 μM
dbacp07602 Tritrp-Dap V(Dap)(Dap)FPWWWPFL(Dap)(Dap) Synthetic Membrane permeabilization via lysine substitution MTT assay Jurkat Blood Cancer IC50 ≥ 65 μM
dbacp07603 Tritrp-Dab V(Dab)(Dab)FPWWWPFL(Dab)(Dab) Synthetic Membrane permeabilization via lysine substitution MTT assay Jurkat Blood Cancer IC50 ≤ 6.5 μM
dbacp07604 Tritrp-Orn V(Orn)(Orn)FPWWWPFL(Orn)(Orn) Synthetic Membrane permeabilization via lysine substitution MTT assay Jurkat Blood Cancer IC50 ≤ 6.5 μM
dbacp07605 Tritrp-P59A VRRFAWWWAFLRR Synthetic Membrane permeabilization via lysine substitution MTT assay Jurkat Blood Cancer IC50 = 12.5 μM
dbacp07606 Tritrp-P59A-Lys VKKFAWWWAFLKK Synthetic Membrane permeabilization via lysine substitution MTT assay Jurkat Blood Cancer IC50 = 27.6 μM
dbacp07607 Tritrp-P5A VRRFAWWWPFLRR Synthetic Membrane permeabilization via lysine substitution MTT assay Jurkat Blood Cancer IC50 = 16.2 μM
dbacp07608 Tritrp-P5A-Lys VKKFAWWWPFLKK Synthetic Membrane permeabilization via lysine substitution MTT assay Jurkat Blood Cancer IC50 = 27.6 μM
dbacp07609 Tritrp-P9A VRRFPWWWAFLRR Synthetic Membrane permeabilization via lysine substitution MTT assay Jurkat Blood Cancer IC50 = 6.8 μM
dbacp07610 Tritrp-P9A-Lys VKKFPWWWAFLKK Synthetic Membrane permeabilization via lysine substitution MTT assay Jurkat Blood Cancer IC50 = 15.1 μM
dbacp07611 Tritrp-W678F VRRFPFFFPFLRR Synthetic Membrane permeabilization via lysine substitution MTT assay Jurkat Blood Cancer IC50 = 24.6 μM
dbacp07612 Tritrp-W678bTA VRRFP(bTA)(bTA)(bTA)PFLRR Synthetic Membrane permeabilization via lysine substitution MTT assay Jurkat Blood Cancer IC50 = 9.6 μM
dbacp07613 Tritrp-W6hW VRRFP(hW)WWPFLRR Synthetic Membrane permeabilization via lysine substitution MTT assay Jurkat Blood Cancer IC50 = 16.1 μM
dbacp07614 Tritrp-W7hW VRRFPW(hW)WPFLRR Synthetic Membrane permeabilization via lysine substitution MTT assay Jurkat Blood Cancer IC50 = 15.1 μM
dbacp07615 Tritrp-W8hW VRRFPWW(hW)PFLRR Synthetic Membrane permeabilization via lysine substitution MTT assay Jurkat Blood Cancer IC50 = 10.7 μM
dbacp07616 Tritrp-W789hW VRRFP(hW)(hW)(hW)PFLRR Synthetic Membrane permeabilization via lysine substitution MTT assay Jurkat Blood Cancer IC50 = 44.8 μM
dbacp07617 Tritrp-W6A VRRFPAWWPFLRR Synthetic Membrane permeabilization via lysine substitution MTT assay Jurkat Blood Cancer IC50 = 36.5 μM
dbacp07618 Tritrp-W7A VRRFPWAWPFLRR Synthetic Membrane permeabilization via lysine substitution MTT assay Jurkat Blood Cancer IC50 = 48.2 μM
dbacp07619 Tritrp-W8A VRRFPWWAPFLRR Synthetic Membrane permeabilization via lysine substitution MTT assay Jurkat Blood Cancer IC50 = 22.8 μM
dbacp07620 Tritrp-W67A VRRFPAAWPFLRR Synthetic Membrane permeabilization via lysine substitution MTT assay Jurkat Blood Cancer IC50 ≥ 65 μM
dbacp07621 Tritrp-W68A VRRFPAWAPFLRR Synthetic Membrane permeabilization via lysine substitution MTT assay Jurkat Blood Cancer IC50 ≥ 65 μM
dbacp07622 Tritrp-W78A VRRFPWAAPFLRR Synthetic Membrane permeabilization via lysine substitution MTT assay Jurkat Blood Cancer IC50 ≥ 65 μM
dbacp07623 Tritrp-W678A VRRFPAAAPFLRR Synthetic Membrane permeabilization via lysine substitution MTT assay Jurkat Blood Cancer IC50 ≥ 65 μM
dbacp07624 Tritrp-W6Y VRRFPYWWPFLRR Synthetic Membrane permeabilization via lysine substitution MTT assay Jurkat Blood Cancer IC50 = 19.3 μM
dbacp07625 Tritrp-W7Y VRRFPWYWPFLRR Synthetic Membrane permeabilization via lysine substitution MTT assay Jurkat Blood Cancer IC50 = 11.4 μM
dbacp07626 Tritrp-W8Y VRRFPWWYPFLRR Synthetic Membrane permeabilization via lysine substitution MTT assay Jurkat Blood Cancer IC50 = 12.0 μM
dbacp07627 Tritrp-W67Y VRRFPYYWPFLRR Synthetic Membrane permeabilization via lysine substitution MTT assay Jurkat Blood Cancer IC50 = 32.2 μM
dbacp07628 Tritrp-W68Y VRRFPYWYPFLRR Synthetic Membrane permeabilization via lysine substitution MTT assay Jurkat Blood Cancer IC50 = 35.4 μM
dbacp07629 Tritrp-W78Y VRRFPWYYPFLRR Synthetic Membrane permeabilization via lysine substitution MTT assay Jurkat Blood Cancer IC50 = 25.6 μM
dbacp07630 Tritrp-W678Y VRRFPYYYPFLRR Synthetic Membrane permeabilization via lysine substitution MTT assay Jurkat Blood Cancer IC50 ≥ 65 μM
dbacp07631 Tritrp DiSu CVRRFPWWYPFLRRC Synthetic Membrane permeabilization via lysine substitution MTT assay Jurkat Blood Cancer IC50 = 12.3 μM
dbacp07632 MagaininF5W-Lys GIGKWLHSAKKFGKAFVGEIMNS Synthetic Membrane permeabilization via lysine substitution MTT assay Jurkat Blood Cancer IC50 = 16.8 μM
dbacp07633 MagaininF5W-Arg GIGRWLHSARRFGRAFVGEIMNS Synthetic Membrane permeabilization via lysine substitution MTT assay Jurkat Blood Cancer IC50 = 16.8 μM
dbacp07634 PuroA-Arg FPVTWKWWKWWKG Synthetic Membrane permeabilization via lysine substitution MTT assay Jurkat Blood Cancer IC50 = 10.0 μM
dbacp07635 PuroA-Lys FPVTWRWWRWWRG Synthetic Membrane permeabilization via lysine substitution MTT assay Jurkat Blood Cancer IC50 = 12.0 μM
dbacp07636 Indolicidin-Lys ILPWKWPWWPWKK Synthetic Membrane permeabilization via lysine substitution MTT assay Jurkat Blood Cancer IC50 = 9.5 μM
dbacp07637 MPG GALFLGFLGAAGSTMGAWSQPKKKRKV Synthetic Membrane permeabilization via lysine substitution MTT assay Jurkat Blood Cancer IC50 = 15.8 μM