218 result(s) have been found!
| Accession | Name | Sequence | Source/Organism | Mechanism | Assay Type | Cell Line | Cancer Type | Activity |
|---|---|---|---|---|---|---|---|---|
| dbacp01596 | BF-30 | KFFRKLKKSVKKRAKEFFKKPRVIGVSIPF | Banded krait | Cytoplasmic membrane permeabilization and DNAspecified-binding | Lactate dehydrogenase release assay, DNA retardation assay, Real-time PCR, Western blot, wound healing assay, and chick embryo chorioallantoic membrane assay | B16F10 | Human Colon cancer | IC50 : 7.3 μM |
| dbacp01597 | BF-30 | KFFRKLKKSVKKRAKEFFKKPRVIGVSIPF | Banded krait | Cytoplasmic membrane permeabilization and DNAspecified-binding | Lactate dehydrogenase release assay, DNA retardation assay, Real-time PCR, Western blot, wound healing assay, and chick embryo chorioallantoic membrane assay | B16 | Human Cervical cancer | IC50 : 13.9 μM |
| dbacp01843 | BLP-7 | GIGGALLSAGKSALKGLAKGLAEHFAN | Oriental Fire-bellied Toad | Cell membrane Permeabilization | MTT assay | Hep G2 | Human hepatoma | IC50 : 2.83 μM |
| dbacp01844 | BLP-7 | GIGGALLSAGKSALKGLAKGLAEHFAN | Oriental Fire-bellied Toad | Cell membrane Permeabilization | MTT assay | SK-HEP-1 | Human hepatoma | IC50 : 0.61μM |
| dbacp01845 | BLP-7 | GIGGALLSAGKSALKGLAKGLAEHFAN | Oriental Fire-bellied Toad | Cell membrane Permeabilization | MTT assay | Huh7 | Human hepatoma | IC50 : 3.87 μM |
| dbacp01857 | Bombinin H-BO | IIGPVLGLIGKALGGLL | Oriental Fire-bellied Toad | Cell Membrane Permeabilization | MTT assay | Hep G2 | Human hepatoma | IC50 : 3.87μM |
| dbacp01858 | Bombinin H-BO | IIGPVLGLIGKALGGLL | Oriental Fire-bellied Toad | Cell Membrane Permeabilization | MTT assay | SK-HEP-1 | Human hepatoma | IC50 : 1.81 μM |
| dbacp01859 | Bombinin H-BO | IIGPVLGLIGKALGGLL | Oriental Fire-bellied Toad | Cell Membrane Permeabilization | MTT assay | Huh8 | Human hepatoma | IC50 : 1.81 μM |
| dbacp02678 | Dermaseptin-PH | ALWKEVLKNAGKAALNEINNLVQ | Northern orange-legged leaf frog | Cell membrane permeabilization | Bioactivity assessment assay, MTT cell proliferation assay | MCF-7 | Not specified | IC50 : 0.69 μM |
| dbacp02679 | Dermaseptin-PH | ALWKEVLKNAGKAALNEINNLVQ | Northern orange-legged leaf frog | Cell membrane permeabilization | Bioactivity assessment assay, MTT cell proliferation assay | H157 | Not specified | IC50 : 2.01 μM |
| dbacp02680 | Dermaseptin-PH | ALWKEVLKNAGKAALNEINNLVQ | Northern orange-legged leaf frog | Cell membrane permeabilization | Bioactivity assessment assay, MTT cell proliferation assay | U251MG | Not specified | IC50 : 2.36 μM |
| dbacp02681 | Dermaseptin-PH | ALWKEVLKNAGKAALNEINNLVQ | Northern orange-legged leaf frog | Cell membrane permeabilization | Bioactivity assessment assay, MTT cell proliferation assay | MDA-MB-435S | Not specified | IC50 : 9.94 μM |
| dbacp02682 | Dermaseptin-PH | ALWKEVLKNAGKAALNEINNLVQ | Northern orange-legged leaf frog | Cell membrane permeabilization | Bioactivity assessment assay, MTT cell proliferation assay | PC-3 | Not specified | IC50 : 11.8 μM |
| dbacp02683 | Dermaseptin-PH | ALWKEVLKNAGKAALNEINNLV | Orange-legged leaf frog, Northern orange-legged leaf frog, South America | Cell membrane permeabilization | MTT cell proliferation assay | MCF-7 | Lung cancer | IC50 : 0.69 μM |
| dbacp02684 | Dermaseptin-PH | ALWKEVLKNAGKAALNEINNLV | Orange-legged leaf frog, Northern orange-legged leaf frog, South America | Cell membrane permeabilization | MTT cell proliferation assay | H157 | Glioma | IC50 : 2.01 μM |
| dbacp02685 | Dermaseptin-PH | ALWKEVLKNAGKAALNEINNLV | Orange-legged leaf frog, Northern orange-legged leaf frog, South America | Cell membrane permeabilization | MTT cell proliferation assay | U251MG | Prostate cancer | IC50 : 2.36 μM |
| dbacp02686 | Dermaseptin-PH | ALWKEVLKNAGKAALNEINNLV | Orange-legged leaf frog, Northern orange-legged leaf frog, South America | Cell membrane permeabilization | MTT cell proliferation assay | MDA-MB-435S | Breast cancer | IC50 : 9.94 μM |
| dbacp02687 | Dermaseptin-PH | ALWKEVLKNAGKAALNEINNLV | Orange-legged leaf frog, Northern orange-legged leaf frog, South America | Cell membrane permeabilization | MTT cell proliferation assay | PC-3 | Human prostate carcinoma | IC50 : 11.8 μM |
| dbacp02843 | Epinecidin-1 | GFIFHIIKGLFHAGKMIHGLV | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HeLa | Cervical cancer | 45% Cytotoxicity at 50 mg/L |
| dbacp02844 | Epinecidin-1 | GFIFHIIKGLFHAGKMIHGLV | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HeLa | Cervical cancer | 38% Cytotoxicity at 25 mg/L |
| dbacp02845 | Epinecidin-1 | GFIFHIIKGLFHAGKMIHGLV | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HeLa | Cervical cancer | 75% Cytotoxicity at 50 mg/L |
| dbacp02846 | Epinecidin-1 | GFIFHIIKGLFHAGKMIHGLV | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HeLa | Cervical cancer | 65% Cytotoxicity at 25 mg/L |
| dbacp02847 | Epinecidin-1 | GFIFHIIKGLFHAGKMIHGLV | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HeLa | Cervical cancer | 75 % Cytotoxicity at 50 mg/L |
| dbacp02848 | Epinecidin-1 | GFIFHIIKGLFHAGKMIHGLV | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HeLa | Cervical cancer | 65% Cytotoxicity at 25 mg/L |
| dbacp02849 | Epinecidin-1 | GFIFHIIKGLFHAGKMIHGLV | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HeLa | Cervical cancer | 83% Cytotoxicity at 50 mg/L |
| dbacp02850 | Epinecidin-1 | GFIFHIIKGLFHAGKMIHGLV | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HeLa | Cervical cancer | 77 % Cytotoxicity at 25 mg/L |
| dbacp02851 | Epinecidin-1 | GFIFHIIKGLFHAGKMIHGLV | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HT-1080 | Fibrosarcoma | 82 % Cytotoxicity at 50 mg/L |
| dbacp02852 | Epinecidin-1 | GFIFHIIKGLFHAGKMIHGLV | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HT-1080 | Fibrosarcoma | 85 % Cytotoxicity at 25 mg/L |
| dbacp02853 | Epinecidin-1 | GFIFHIIKGLFHAGKMIHGLV | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HT-1080 | Fibrosarcoma | 42 % Cytotoxicity at 12.5 mg/L |
| dbacp02854 | Epinecidin-1 | GFIFHIIKGLFHAGKMIHGLV | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HT-1080 | Fibrosarcoma | 41 % Cytotoxicity at 6.25 mg/L |
| dbacp02855 | Epinecidin-1 | GFIFHIIKGLFHAGKMIHGLV | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HT-1080 | Fibrosarcoma | 39 % Cytotoxicity at 3.125 mg/L |
| dbacp02856 | Epinecidin-1 | GFIFHIIKGLFHAGKMIHGLV | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HT-1080 | Fibrosarcoma | 90 % Cytotoxicity at 50 mg/L |
| dbacp02857 | Epinecidin-1 | GFIFHIIKGLFHAGKMIHGLV | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HT-1080 | Fibrosarcoma | 95 % Cytotoxicity at 25 mg/L |
| dbacp02858 | Epinecidin-1 | GFIFHIIKGLFHAGKMIHGLV | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HT-1080 | Fibrosarcoma | 45 % Cytotoxicity at 12.5 mg/L |
| dbacp02859 | Epinecidin-1 | GFIFHIIKGLFHAGKMIHGLV | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HT-1080 | Fibrosarcoma | 25 % Cytotoxicity at 6.25 mg/L |
| dbacp02860 | Epinecidin-1 | GFIFHIIKGLFHAGKMIHGLV | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HT-1080 | Fibrosarcoma | 25 % Cytotoxicity at 3.125 mg/L |
| dbacp02861 | Epinecidin-1 | GFIFHIIKGLFHAGKMIHGLV | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HT-1080 | Fibrosarcoma | 95 % Cytotoxicity at 50 mg/L |
| dbacp02862 | Epinecidin-1 | GFIFHIIKGLFHAGKMIHGLV | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HT-1080 | Fibrosarcoma | 96 % Cytotoxicity at 25 mg/L |
| dbacp02863 | Epinecidin-1 | GFIFHIIKGLFHAGKMIHGLV | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HT-1080 | Fibrosarcoma | 46 % Cytotoxicity at 12.5 mg/L |
| dbacp02864 | Epinecidin-1 | GFIFHIIKGLFHAGKMIHGLV | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HT-1080 | Fibrosarcoma | 30 % Cytotoxicity at 6.25 mg/L |
| dbacp02865 | Epinecidin-1 | GFIFHIIKGLFHAGKMIHGLV | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HT-1080 | Fibrosarcoma | 28 % Cytotoxicity at 3.125 mg/L |
| dbacp02866 | Epinecidin-1 | GFIFHIIKGLFHAGKMIHGLV | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HT-1080 | Fibrosarcoma | 84 % Cytotoxicity at 50 mg/L |
| dbacp02867 | Epinecidin-1 | GFIFHIIKGLFHAGKMIHGLV | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HT-1080 | Fibrosarcoma | 85 % Cytotoxicity at 25 mg/L |
| dbacp02868 | Epinecidin-1 | GFIFHIIKGLFHAGKMIHGLV | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HT-1080 | Fibrosarcoma | 38 % Cytotoxicity at 12.5 mg/L |
| dbacp02869 | Epinecidin-1 | GFIFHIIKGLFHAGKMIHGLV | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HT-1080 | Fibrosarcoma | 30 % Cytotoxicity at 6.25 mg/L |
| dbacp02870 | Epinecidin-1 | GFIFHIIKGLFHAGKMIHGLV | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HT-1080 | Fibrosarcoma | 28 % Cytotoxicity at 3.125 mg/L |
| dbacp02874 | Epinecidin-8 | FIFHIIKGLFHAGKMI | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HeLa | Cervical cancer | 60 % Cytotoxicity at 50 mg/L |
| dbacp02875 | Epinecidin-8 | FIFHIIKGLFHAGKMI | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HeLa | Cervical cancer | 50 % Cytotoxicity at 25 mg/L |
| dbacp02876 | Epinecidin-8 | FIFHIIKGLFHAGKMI | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HeLa | Cervical cancer | 8 % Cytotoxicity at 12.5 mg/L |
| dbacp02877 | Epinecidin-8 | FIFHIIKGLFHAGKMI | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HeLa | Cervical cancer | 10 % Cytotoxicity at 6.25 mg/L |
| dbacp02878 | Epinecidin-8 | FIFHIIKGLFHAGKMI | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HeLa | Cervical cancer | 5 % Cytotoxicity at 3.125 mg/L |
| dbacp02879 | Epinecidin-8 | FIFHIIKGLFHAGKMI | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HeLa | Cervical cancer | 75 % Cytotoxicity at 50 mg/L |
| dbacp02880 | Epinecidin-8 | FIFHIIKGLFHAGKMI | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HeLa | Cervical cancer | 70 % Cytotoxicity at 25 mg/L |
| dbacp02881 | Epinecidin-8 | FIFHIIKGLFHAGKMI | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HeLa | Cervical cancer | 5 % Cytotoxicity at 12.5 mg/L |
| dbacp02882 | Epinecidin-8 | FIFHIIKGLFHAGKMI | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HeLa | Cervical cancer | 7 % Cytotoxicity at 6.25 mg/L |
| dbacp02883 | Epinecidin-8 | FIFHIIKGLFHAGKMI | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HeLa | Cervical cancer | 10 % Cytotoxicity at 3.125 mg/L |
| dbacp02884 | Epinecidin-8 | FIFHIIKGLFHAGKMI | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HeLa | Cervical cancer | 76 % Cytotoxicity at 50 mg/L |
| dbacp02885 | Epinecidin-8 | FIFHIIKGLFHAGKMI | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HeLa | Cervical cancer | 70 % Cytotoxicity at 25 mg/L |
| dbacp02886 | Epinecidin-8 | FIFHIIKGLFHAGKMI | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HeLa | Cervical cancer | 12 % Cytotoxicity at 12.5 mg/L |
| dbacp02887 | Epinecidin-8 | FIFHIIKGLFHAGKMI | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HeLa | Cervical cancer | 4 % Cytotoxicity at 6.25 mg/L |
| dbacp02888 | Epinecidin-8 | FIFHIIKGLFHAGKMI | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HeLa | Cervical cancer | 4 % Cytotoxicity at 3.125 mg/L |
| dbacp02889 | Epinecidin-8 | FIFHIIKGLFHAGKMI | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HeLa | Cervical cancer | 90 % Cytotoxicity at 50 mg/L |
| dbacp02890 | Epinecidin-8 | FIFHIIKGLFHAGKMI | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HeLa | Cervical cancer | 75 % Cytotoxicity at 25 mg/L |
| dbacp02891 | Epinecidin-8 | FIFHIIKGLFHAGKMI | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HeLa | Cervical cancer | 8 % Cytotoxicity at 12.5 mg/L |
| dbacp02892 | Epinecidin-8 | FIFHIIKGLFHAGKMI | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HeLa | Cervical cancer | 3 % Cytotoxicity at 6.25 mg/L |
| dbacp02893 | Epinecidin-8 | FIFHIIKGLFHAGKMI | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HeLa | Cervical cancer | 3 % Cytotoxicity at 3.125 mg/L |
| dbacp02894 | Epinecidin-8 | FIFHIIKGLFHAGKMI | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HT-1080 | Fibrosarcoma | 60 % Cytotoxicity at 50 mg/L |
| dbacp02895 | Epinecidin-8 | FIFHIIKGLFHAGKMI | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HT-1080 | Fibrosarcoma | 50 % Cytotoxicity at 25 mg/L |
| dbacp02896 | Epinecidin-8 | FIFHIIKGLFHAGKMI | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HT-1080 | Fibrosarcoma | 8 % Cytotoxicity at 12.5 mg/L |
| dbacp02897 | Epinecidin-8 | FIFHIIKGLFHAGKMI | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HT-1080 | Fibrosarcoma | 10 % Cytotoxicity at 6.25 mg/L |
| dbacp02898 | Epinecidin-8 | FIFHIIKGLFHAGKMI | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HT-1080 | Fibrosarcoma | 5 % Cytotoxicity at 3.125 mg/L |
| dbacp02899 | Epinecidin-8 | FIFHIIKGLFHAGKMI | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HT-1080 | Fibrosarcoma | 75 % Cytotoxicity at 50 mg/L |
| dbacp02900 | Epinecidin-8 | FIFHIIKGLFHAGKMI | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HT-1080 | Fibrosarcoma | 70 % Cytotoxicity at 25 mg/L |
| dbacp02901 | Epinecidin-8 | FIFHIIKGLFHAGKMI | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HT-1080 | Fibrosarcoma | 5 %Cytotoxicity at 12.5 mg/L |
| dbacp02902 | Epinecidin-8 | FIFHIIKGLFHAGKMI | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HT-1080 | Fibrosarcoma | 7 % Cytotoxicity at 6.25 mg/L |
| dbacp02903 | Epinecidin-8 | FIFHIIKGLFHAGKMI | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HT-1080 | Fibrosarcoma | 10 % Cytotoxicity at 3.125 mg/L |
| dbacp02904 | Epinecidin-8 | FIFHIIKGLFHAGKMI | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HT-1080 | Fibrosarcoma | 76 % Cytotoxicity at 50 mg/L |
| dbacp02905 | Epinecidin-8 | FIFHIIKGLFHAGKMI | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HT-1080 | Fibrosarcoma | 70 % Cytotoxicity at 25 mg/L |
| dbacp02906 | Epinecidin-8 | FIFHIIKGLFHAGKMI | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HT-1080 | Fibrosarcoma | 12 % Cytotoxicity at 12.5 mg/L |
| dbacp02907 | Epinecidin-8 | FIFHIIKGLFHAGKMI | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HT-1080 | Fibrosarcoma | 4 % Cytotoxicity at 6.25 mg/L |
| dbacp02908 | Epinecidin-8 | FIFHIIKGLFHAGKMI | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HT-1080 | Fibrosarcoma | 4 % Cytotoxicity at 3.125 mg/L |
| dbacp02909 | Epinecidin-8 | FIFHIIKGLFHAGKMI | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HT-1080 | Fibrosarcoma | 90 % Cytotoxicity at 50 mg/L |
| dbacp02910 | Epinecidin-8 | FIFHIIKGLFHAGKMI | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HT-1080 | Fibrosarcoma | 75 % Cytotoxicity at 25 mg/L |
| dbacp02911 | Epinecidin-8 | FIFHIIKGLFHAGKMI | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HT-1080 | Fibrosarcoma | 8 % Cytotoxicity at 12.5 mg/L |
| dbacp02912 | Epinecidin-8 | FIFHIIKGLFHAGKMI | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HT-1080 | Fibrosarcoma | 3 % Cytotoxicity at 6.25 mg/L |
| dbacp02913 | Epinecidin-8 | FIFHIIKGLFHAGKMI | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HT-1080 | Fibrosarcoma | 3 % Cytotoxicity at 3.125 mg/L |
| dbacp03124 | Gomesin | GCRRLCYKQRCVTYCRGR | Tarantula spider sp. | Membrane permeabilization | Lactate dehydrogenase (LDH) assay | U-87 MG | Glioblastoma | MIC : 10 mM |
| dbacp03522 | KillerFLIP | YGRKKRRQRRRREADFFWSLCTADMS | Not found | Apoptotic activity and necroptosis; Plasma membrane permeabilization | Not specified | Jurkat | Blood cancer | Not found |
| dbacp05139 | Pardaxin-1 | GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HeLa | Cervical cancer | 62 % Cytotoxicity at 50 mg/L |
| dbacp05140 | Pardaxin-1 | GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HeLa | Cervical cancer | 44 % Cytotoxicity at 25 mg/L |
| dbacp05141 | Pardaxin-1 | GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HeLa | Cervical cancer | 4 % Cytotoxicity at 12.5 mg/L |
| dbacp05142 | Pardaxin-1 | GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HeLa | Cervical cancer | 75 % Cytotoxicity at 50 mg/L |
| dbacp05143 | Pardaxin-1 | GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HeLa | Cervical cancer | 70 % Cytotoxicity at 25 mg/L |
| dbacp05144 | Pardaxin-1 | GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HeLa | Cervical cancer | 4 % Cytotoxicity at 3.125 mg/L |
| dbacp05145 | Pardaxin-1 | GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HeLa | Cervical cancer | 78 % Cytotoxicity at 50 mg/L |
| dbacp05146 | Pardaxin-1 | GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HeLa | Cervical cancer | 68 % Cytotoxicity at 25 mg/L |
| dbacp05147 | Pardaxin-1 | GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HeLa | Cervical cancer | 4 % Cytotoxicity at 12.5 mg/L |
| dbacp05148 | Pardaxin-1 | GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HeLa | Cervical cancer | 5 % Cytotoxicity at 6.25 mg/L |
| dbacp05149 | Pardaxin-1 | GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HeLa | Cervical cancer | 10 % Cytotoxicity at 3.125 mg/L |
| dbacp05150 | Pardaxin-1 | GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HeLa | Cervical cancer | 90 % Cytotoxicity at 50 mg/L |
| dbacp05151 | Pardaxin-1 | GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HeLa | Cervical cancer | 80 % Cytotoxicity at 25 mg/L |
| dbacp05152 | Pardaxin-1 | GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HeLa | Cervical cancer | 15 % Cytotoxicity at 12.5 mg/L |
| dbacp05153 | Pardaxin-1 | GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HeLa | Cervical cancer | 12 % Cytotoxicity at 6.25 mg/L |
| dbacp05154 | Pardaxin-1 | GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HeLa | Cervical cancer | 5 % Cytotoxicity at 3.125 mg/L |
| dbacp05155 | Pardaxin-1 | GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HT-1080 | Fibrosarcoma | 88 % Cytotoxicity at 50 mg/L |
| dbacp05156 | Pardaxin-1 | GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HT-1080 | Fibrosarcoma | 82 % Cytotoxicity at 25 mg/L |
| dbacp05157 | Pardaxin-1 | GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HT-1080 | Fibrosarcoma | 40 % Cytotoxicity at 12.5 mg/L |
| dbacp05158 | Pardaxin-1 | GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HT-1080 | Fibrosarcoma | 35 % Cytotoxicity at 6.25 mg/L |
| dbacp05159 | Pardaxin-1 | GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HT-1080 | Fibrosarcoma | 35 % Cytotoxicity at 3.125 mg/L |
| dbacp05160 | Pardaxin-1 | GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HT-1080 | Fibrosarcoma | 90 % Cytotoxicity at 50 mg/L |
| dbacp05161 | Pardaxin-1 | GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HT-1080 | Fibrosarcoma | 90 % Cytotoxicity at 25 mg/L |
| dbacp05162 | Pardaxin-1 | GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HT-1080 | Fibrosarcoma | 30 % Cytotoxicity at 12.5 mg/L |
| dbacp05163 | Pardaxin-1 | GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HT-1080 | Fibrosarcoma | 30 % Cytotoxicity at 6.25 mg/L |
| dbacp05164 | Pardaxin-1 | GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HT-1080 | Fibrosarcoma | 30 % Cytotoxicity at 3.125 mg/L |
| dbacp05165 | Pardaxin-1 | GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HT-1080 | Fibrosarcoma | 97 % Cytotoxicity at 50 mg/L |
| dbacp05166 | Pardaxin-1 | GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HT-1080 | Fibrosarcoma | 95 % Cytotoxicity at 25 mg/L |
| dbacp05167 | Pardaxin-1 | GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HT-1080 | Fibrosarcoma | 39 % Cytotoxicity at 12.5 mg/L |
| dbacp05168 | Pardaxin-1 | GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HT-1080 | Fibrosarcoma | 28 % Cytotoxicity at 6.25 mg/L |
| dbacp05169 | Pardaxin-1 | GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HT-1080 | Fibrosarcoma | 38 % Cytotoxicity at 3.125 mg/L |
| dbacp05170 | Pardaxin-1 | GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HT-1080 | Fibrosarcoma | 90 % Cytotoxicity at 50 mg/L |
| dbacp05171 | Pardaxin-1 | GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HT-1080 | Fibrosarcoma | 90 % Cytotoxicity at 25 mg/L |
| dbacp05172 | Pardaxin-1 | GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HT-1080 | Fibrosarcoma | 15 % Cytotoxicity at 12.5 mg/L |
| dbacp05173 | Pardaxin-1 | GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HT-1080 | Fibrosarcoma | 5 % Cytotoxicity at 6.25 mg/L |
| dbacp05174 | Pardaxin-1 | GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HT-1080 | Fibrosarcoma | 10 % Cytotoxicity at 3.125 mg/L |
| dbacp05175 | Pardaxin-6 | GFFALIPKIISSPLFKTLLSAVGSALS | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HeLa | Cervical cancer | 70 % Cytotoxicity at 50 mg/L |
| dbacp05176 | Pardaxin-6 | GFFALIPKIISSPLFKTLLSAVGSALS | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HeLa | Cervical cancer | 60 % Cytotoxicity at 25 mg/L |
| dbacp05177 | Pardaxin-6 | GFFALIPKIISSPLFKTLLSAVGSALS | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HeLa | Cervical cancer | 4 % Cytotoxicity at 12.5 mg/L |
| dbacp05178 | Pardaxin-6 | GFFALIPKIISSPLFKTLLSAVGSALS | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HeLa | Cervical cancer | 5 % Cytotoxicity at 6.25 mg/L |
| dbacp05179 | Pardaxin-6 | GFFALIPKIISSPLFKTLLSAVGSALS | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HeLa | Cervical cancer | 1 % Cytotoxicity at 3.125 mg/L |
| dbacp05180 | Pardaxin-6 | GFFALIPKIISSPLFKTLLSAVGSALS | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HeLa | Cervical cancer | 78 % Cytotoxicity at 50 mg/L |
| dbacp05181 | Pardaxin-6 | GFFALIPKIISSPLFKTLLSAVGSALS | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HeLa | Cervical cancer | 70 % Cytotoxicity at 25 mg/L |
| dbacp05182 | Pardaxin-6 | GFFALIPKIISSPLFKTLLSAVGSALS | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HeLa | Cervical cancer | 10 % Cytotoxicity at 12.5 mg/L |
| dbacp05183 | Pardaxin-6 | GFFALIPKIISSPLFKTLLSAVGSALS | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HeLa | Cervical cancer | 10 % Cytotoxicity at 6.25 mg/L |
| dbacp05184 | Pardaxin-6 | GFFALIPKIISSPLFKTLLSAVGSALS | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HeLa | Cervical cancer | 5 % Cytotoxicity at 3.125 mg/L |
| dbacp05185 | Pardaxin-6 | GFFALIPKIISSPLFKTLLSAVGSALS | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HeLa | Cervical cancer | 82 % Cytotoxicity at 50 mg/L |
| dbacp05186 | Pardaxin-6 | GFFALIPKIISSPLFKTLLSAVGSALS | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HeLa | Cervical cancer | 70 % Cytotoxicity at 25 mg/L |
| dbacp05187 | Pardaxin-6 | GFFALIPKIISSPLFKTLLSAVGSALS | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HeLa | Cervical cancer | 18 % Cytotoxicity at 12.5 mg/L |
| dbacp05188 | Pardaxin-6 | GFFALIPKIISSPLFKTLLSAVGSALS | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HeLa | Cervical cancer | 4 % Cytotoxicity at 6.25 mg/L |
| dbacp05189 | Pardaxin-6 | GFFALIPKIISSPLFKTLLSAVGSALS | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HeLa | Cervical cancer | 10 % Cytotoxicity at 3.125 mg/L |
| dbacp05190 | Pardaxin-6 | GFFALIPKIISSPLFKTLLSAVGSALS | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HeLa | Cervical cancer | 90 % Cytotoxicity at 50 mg/L |
| dbacp05191 | Pardaxin-6 | GFFALIPKIISSPLFKTLLSAVGSALS | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HeLa | Cervical cancer | 82 % Cytotoxicity at 25 mg/L |
| dbacp05192 | Pardaxin-6 | GFFALIPKIISSPLFKTLLSAVGSALS | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HeLa | Cervical cancer | 18 % Cytotoxicity at 12.5 mg/L |
| dbacp05193 | Pardaxin-6 | GFFALIPKIISSPLFKTLLSAVGSALS | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HeLa | Cervical cancer | 18 % Cytotoxicity at 6.25 mg/L |
| dbacp05194 | Pardaxin-6 | GFFALIPKIISSPLFKTLLSAVGSALS | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HeLa | Cervical cancer | 18 % Cytotoxicity at 3.125 mg/L |
| dbacp05195 | Pardaxin-6 | GFFALIPKIISSPLFKTLLSAVGSALS | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HT-1080 | Fibrosarcoma | 80 % Cytotoxicity at 50 mg/L |
| dbacp05196 | Pardaxin-6 | GFFALIPKIISSPLFKTLLSAVGSALS | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HT-1080 | Fibrosarcoma | 85 % Cytotoxicity at 25 mg/L |
| dbacp05197 | Pardaxin-6 | GFFALIPKIISSPLFKTLLSAVGSALS | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HT-1080 | Fibrosarcoma | 45 % Cytotoxicity at 12.5 mg/L |
| dbacp05198 | Pardaxin-6 | GFFALIPKIISSPLFKTLLSAVGSALS | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HT-1080 | Fibrosarcoma | 30 % Cytotoxicity at 6.25 mg/L |
| dbacp05199 | Pardaxin-6 | GFFALIPKIISSPLFKTLLSAVGSALS | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HT-1080 | Fibrosarcoma | 25 % Cytotoxicity at 3.125 mg/L |
| dbacp05200 | Pardaxin-6 | GFFALIPKIISSPLFKTLLSAVGSALS | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HT-1080 | Fibrosarcoma | 84 % Cytotoxicity at 50 mg/L |
| dbacp05201 | Pardaxin-6 | GFFALIPKIISSPLFKTLLSAVGSALS | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HT-1080 | Fibrosarcoma | 84% Cytotoxicity at 25 mg/L |
| dbacp05202 | Pardaxin-6 | GFFALIPKIISSPLFKTLLSAVGSALS | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HT-1080 | Fibrosarcoma | 48 % Cytotoxicity at 12.5 mg/L |
| dbacp05203 | Pardaxin-6 | GFFALIPKIISSPLFKTLLSAVGSALS | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HT-1080 | Fibrosarcoma | 30 % Cytotoxicity at 6.25 mg/L |
| dbacp05204 | Pardaxin-6 | GFFALIPKIISSPLFKTLLSAVGSALS | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HT-1080 | Fibrosarcoma | 35 % Cytotoxicity at 3.125 mg/L |
| dbacp05205 | Pardaxin-6 | GFFALIPKIISSPLFKTLLSAVGSALS | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HT-1080 | Fibrosarcoma | 90 % Cytotoxicity at 50 mg/L |
| dbacp05206 | Pardaxin-6 | GFFALIPKIISSPLFKTLLSAVGSALS | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HT-1080 | Fibrosarcoma | 85 % Cytotoxicity at 25 mg/L |
| dbacp05207 | Pardaxin-6 | GFFALIPKIISSPLFKTLLSAVGSALS | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HT-1080 | Fibrosarcoma | 30 % Cytotoxicity at 12.5 mg/L |
| dbacp05208 | Pardaxin-6 | GFFALIPKIISSPLFKTLLSAVGSALS | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HT-1080 | Fibrosarcoma | 35 % Cytotoxicity at 6.25 mg/L |
| dbacp05209 | Pardaxin-6 | GFFALIPKIISSPLFKTLLSAVGSALS | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HT-1080 | Fibrosarcoma | 15 % Cytotoxicity at 3.125 mg/L |
| dbacp05210 | Pardaxin-6 | GFFALIPKIISSPLFKTLLSAVGSALS | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HT-1080 | Fibrosarcoma | 90 % Cytotoxicity at 50 mg/L |
| dbacp05211 | Pardaxin-6 | GFFALIPKIISSPLFKTLLSAVGSALS | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HT-1080 | Fibrosarcoma | 90 % Cytotoxicity at 25 mg/L |
| dbacp05212 | Pardaxin-6 | GFFALIPKIISSPLFKTLLSAVGSALS | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HT-1080 | Fibrosarcoma | 20 % Cytotoxicity at 12.5 mg/L |
| dbacp05213 | Pardaxin-6 | GFFALIPKIISSPLFKTLLSAVGSALS | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HT-1080 | Fibrosarcoma | 1 % Cytotoxicity at 6.25 mg/L |
| dbacp05214 | Pardaxin-6 | GFFALIPKIISSPLFKTLLSAVGSALS | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HT-1080 | Fibrosarcoma | 10 % Cytotoxicity at 3.125 mg/L |
| dbacp05215 | PcTx-1 | EDCIPKWKGCVNRHGDCCEGLECWKRRRSFEVCVPKTPKTOHa | Trinidad chevron tarantula | Membrane permeabilization | Transwell Migration assay, Scratch wound migration assay | D54-MG | Glioma | Not found |
| dbacp06723 | L14 | ALWKSILKNAGKALNEINQIVQ | Dermaseptin-SS1- Analog | Membrane Permeabilization | MTT assay | H-838 | Lung Cancer | IC50 = 64.4 µM |
| dbacp06724 | L14 | ALWKSILKNAGKALNEINQIVQ | Dermaseptin-SS1- Analog | Membrane Permeabilization | MTT assay | H-460 | Lung Cancer | IC50 = 20.1 µM |
| dbacp06725 | 14V | ALWKSILKNAGKAVLNEINQIVQ | Dermaseptin-SS1- Analog | Membrane Permeabilization | MTT assay | H-838 | Lung Cancer | IC50 = 7.0 µM |
| dbacp06726 | 14V | ALWKSILKNAGKAVLNEINQIVQ | Dermaseptin-SS1- Analog | Membrane Permeabilization | MTT assay | H-460 | Lung Cancer | IC50 = 4.1 µM |
| dbacp06727 | 14G | ALWKSILKNAGKAGLNEINQIVQ | Dermaseptin-SS1- Analog | Membrane Permeabilization | MTT assay | H-838 | Lung Cancer | IC50 = 48.7 µM |
| dbacp06728 | 14G | ALWKSILKNAGKAGLNEINQIVQ | Dermaseptin-SS1- Analog | Membrane Permeabilization | MTT assay | H-460 | Lung Cancer | IC50 = 31.7 µM |
| dbacp06729 | L2V | ALWKSILKNVGKVLNEINQIVQ | Dermaseptin-SS1- Analog | Membrane Permeabilization | MTT assay | H-838 | Lung Cancer | IC50 = 2.2 µM |
| dbacp06730 | L2V | ALWKSILKNVGKVLNEINQIVQ | Dermaseptin-SS1- Analog | Membrane Permeabilization | MTT assay | H-460 | Lung Cancer | IC50 = 0.6 µM |
| dbacp06731 | 14V5K | ALWKKILKNAGKAVLNEINQIVQ | Dermaseptin-SS1- Analog | Membrane Permeabilization | MTT assay | H-838 | Lung Cancer | IC50 = 8.1 µM |
| dbacp06732 | 14V5K | ALWKKILKNAGKAVLNEINQIVQ | Dermaseptin-SS1- Analog | Membrane Permeabilization | MTT assay | H-460 | Lung Cancer | IC50 = 6.1 µM |
| dbacp06733 | 14VL23 | ALWKSILKNAGKAVLNEINQIV | Dermaseptin-SS1- Analog | Membrane Permeabilization | MTT assay | H-838 | Lung Cancer | IC50 = 5.7 µM |
| dbacp06734 | 14VL23 | ALWKSILKNAGKAVLNEINQIV | Dermaseptin-SS1- Analog | Membrane Permeabilization | MTT assay | H-460 | Lung Cancer | IC50 = 16.4 µM |
| dbacp06774 | PMAP-NC | RIIDRLWLVRRPQKPKFVLVWVL | Synthetic Analgog of PMAP-23 | Membrane permeabilization | MTT assay | MDA-MB-361 | Breast Cancer | IC50 = 6.4 μM |
| dbacp06775 | PMAP-NC | RIIDRLWLVRRPQKPKFVLVWVL | Synthetic Analgog of PMAP-24 | Membrane permeabilization | MTT assay | A-549 | Lung Cancer | IC50 = 7.1 μM |
| dbacp07599 | Tritrp-Agb | V(Agb)(Agb)FPWWWPFL(Agb)(Agb) | Synthetic | Membrane permeabilization via lysine substitution | MTT assay | Jurkat | Blood Cancer | IC50 = 9.6 μM |
| dbacp07600 | Tritrp-hArg | V(hArg)(hArg)FPWWWPFL(hArg)(hArg) | Synthetic | Membrane permeabilization via lysine substitution | MTT assay | Jurkat | Blood Cancer | IC50 = 13.3 μM |
| dbacp07601 | Tritrp-Lys | VKKFPWWWPFLKK | Synthetic | Membrane permeabilization via lysine substitution | MTT assay | Jurkat | Blood Cancer | IC50 = 11.5 μM |
| dbacp07602 | Tritrp-Dap | V(Dap)(Dap)FPWWWPFL(Dap)(Dap) | Synthetic | Membrane permeabilization via lysine substitution | MTT assay | Jurkat | Blood Cancer | IC50 ≥ 65 μM |
| dbacp07603 | Tritrp-Dab | V(Dab)(Dab)FPWWWPFL(Dab)(Dab) | Synthetic | Membrane permeabilization via lysine substitution | MTT assay | Jurkat | Blood Cancer | IC50 ≤ 6.5 μM |
| dbacp07604 | Tritrp-Orn | V(Orn)(Orn)FPWWWPFL(Orn)(Orn) | Synthetic | Membrane permeabilization via lysine substitution | MTT assay | Jurkat | Blood Cancer | IC50 ≤ 6.5 μM |
| dbacp07605 | Tritrp-P59A | VRRFAWWWAFLRR | Synthetic | Membrane permeabilization via lysine substitution | MTT assay | Jurkat | Blood Cancer | IC50 = 12.5 μM |
| dbacp07606 | Tritrp-P59A-Lys | VKKFAWWWAFLKK | Synthetic | Membrane permeabilization via lysine substitution | MTT assay | Jurkat | Blood Cancer | IC50 = 27.6 μM |
| dbacp07607 | Tritrp-P5A | VRRFAWWWPFLRR | Synthetic | Membrane permeabilization via lysine substitution | MTT assay | Jurkat | Blood Cancer | IC50 = 16.2 μM |
| dbacp07608 | Tritrp-P5A-Lys | VKKFAWWWPFLKK | Synthetic | Membrane permeabilization via lysine substitution | MTT assay | Jurkat | Blood Cancer | IC50 = 27.6 μM |
| dbacp07609 | Tritrp-P9A | VRRFPWWWAFLRR | Synthetic | Membrane permeabilization via lysine substitution | MTT assay | Jurkat | Blood Cancer | IC50 = 6.8 μM |
| dbacp07610 | Tritrp-P9A-Lys | VKKFPWWWAFLKK | Synthetic | Membrane permeabilization via lysine substitution | MTT assay | Jurkat | Blood Cancer | IC50 = 15.1 μM |
| dbacp07611 | Tritrp-W678F | VRRFPFFFPFLRR | Synthetic | Membrane permeabilization via lysine substitution | MTT assay | Jurkat | Blood Cancer | IC50 = 24.6 μM |
| dbacp07612 | Tritrp-W678bTA | VRRFP(bTA)(bTA)(bTA)PFLRR | Synthetic | Membrane permeabilization via lysine substitution | MTT assay | Jurkat | Blood Cancer | IC50 = 9.6 μM |
| dbacp07613 | Tritrp-W6hW | VRRFP(hW)WWPFLRR | Synthetic | Membrane permeabilization via lysine substitution | MTT assay | Jurkat | Blood Cancer | IC50 = 16.1 μM |
| dbacp07614 | Tritrp-W7hW | VRRFPW(hW)WPFLRR | Synthetic | Membrane permeabilization via lysine substitution | MTT assay | Jurkat | Blood Cancer | IC50 = 15.1 μM |
| dbacp07615 | Tritrp-W8hW | VRRFPWW(hW)PFLRR | Synthetic | Membrane permeabilization via lysine substitution | MTT assay | Jurkat | Blood Cancer | IC50 = 10.7 μM |
| dbacp07616 | Tritrp-W789hW | VRRFP(hW)(hW)(hW)PFLRR | Synthetic | Membrane permeabilization via lysine substitution | MTT assay | Jurkat | Blood Cancer | IC50 = 44.8 μM |
| dbacp07617 | Tritrp-W6A | VRRFPAWWPFLRR | Synthetic | Membrane permeabilization via lysine substitution | MTT assay | Jurkat | Blood Cancer | IC50 = 36.5 μM |
| dbacp07618 | Tritrp-W7A | VRRFPWAWPFLRR | Synthetic | Membrane permeabilization via lysine substitution | MTT assay | Jurkat | Blood Cancer | IC50 = 48.2 μM |
| dbacp07619 | Tritrp-W8A | VRRFPWWAPFLRR | Synthetic | Membrane permeabilization via lysine substitution | MTT assay | Jurkat | Blood Cancer | IC50 = 22.8 μM |
| dbacp07620 | Tritrp-W67A | VRRFPAAWPFLRR | Synthetic | Membrane permeabilization via lysine substitution | MTT assay | Jurkat | Blood Cancer | IC50 ≥ 65 μM |
| dbacp07621 | Tritrp-W68A | VRRFPAWAPFLRR | Synthetic | Membrane permeabilization via lysine substitution | MTT assay | Jurkat | Blood Cancer | IC50 ≥ 65 μM |
| dbacp07622 | Tritrp-W78A | VRRFPWAAPFLRR | Synthetic | Membrane permeabilization via lysine substitution | MTT assay | Jurkat | Blood Cancer | IC50 ≥ 65 μM |
| dbacp07623 | Tritrp-W678A | VRRFPAAAPFLRR | Synthetic | Membrane permeabilization via lysine substitution | MTT assay | Jurkat | Blood Cancer | IC50 ≥ 65 μM |
| dbacp07624 | Tritrp-W6Y | VRRFPYWWPFLRR | Synthetic | Membrane permeabilization via lysine substitution | MTT assay | Jurkat | Blood Cancer | IC50 = 19.3 μM |
| dbacp07625 | Tritrp-W7Y | VRRFPWYWPFLRR | Synthetic | Membrane permeabilization via lysine substitution | MTT assay | Jurkat | Blood Cancer | IC50 = 11.4 μM |
| dbacp07626 | Tritrp-W8Y | VRRFPWWYPFLRR | Synthetic | Membrane permeabilization via lysine substitution | MTT assay | Jurkat | Blood Cancer | IC50 = 12.0 μM |
| dbacp07627 | Tritrp-W67Y | VRRFPYYWPFLRR | Synthetic | Membrane permeabilization via lysine substitution | MTT assay | Jurkat | Blood Cancer | IC50 = 32.2 μM |
| dbacp07628 | Tritrp-W68Y | VRRFPYWYPFLRR | Synthetic | Membrane permeabilization via lysine substitution | MTT assay | Jurkat | Blood Cancer | IC50 = 35.4 μM |
| dbacp07629 | Tritrp-W78Y | VRRFPWYYPFLRR | Synthetic | Membrane permeabilization via lysine substitution | MTT assay | Jurkat | Blood Cancer | IC50 = 25.6 μM |
| dbacp07630 | Tritrp-W678Y | VRRFPYYYPFLRR | Synthetic | Membrane permeabilization via lysine substitution | MTT assay | Jurkat | Blood Cancer | IC50 ≥ 65 μM |
| dbacp07631 | Tritrp DiSu | CVRRFPWWYPFLRRC | Synthetic | Membrane permeabilization via lysine substitution | MTT assay | Jurkat | Blood Cancer | IC50 = 12.3 μM |
| dbacp07632 | MagaininF5W-Lys | GIGKWLHSAKKFGKAFVGEIMNS | Synthetic | Membrane permeabilization via lysine substitution | MTT assay | Jurkat | Blood Cancer | IC50 = 16.8 μM |
| dbacp07633 | MagaininF5W-Arg | GIGRWLHSARRFGRAFVGEIMNS | Synthetic | Membrane permeabilization via lysine substitution | MTT assay | Jurkat | Blood Cancer | IC50 = 16.8 μM |
| dbacp07634 | PuroA-Arg | FPVTWKWWKWWKG | Synthetic | Membrane permeabilization via lysine substitution | MTT assay | Jurkat | Blood Cancer | IC50 = 10.0 μM |
| dbacp07635 | PuroA-Lys | FPVTWRWWRWWRG | Synthetic | Membrane permeabilization via lysine substitution | MTT assay | Jurkat | Blood Cancer | IC50 = 12.0 μM |
| dbacp07636 | Indolicidin-Lys | ILPWKWPWWPWKK | Synthetic | Membrane permeabilization via lysine substitution | MTT assay | Jurkat | Blood Cancer | IC50 = 9.5 μM |
| dbacp07637 | MPG | GALFLGFLGAAGSTMGAWSQPKKKRKV | Synthetic | Membrane permeabilization via lysine substitution | MTT assay | Jurkat | Blood Cancer | IC50 = 15.8 μM |