dbACP: A Comprehensive Database of Anti-Cancer Peptides

36 result(s) have been found!

Accession Name Sequence Source/Organism Mechanism Assay Type Cell Line Cancer Type Activity
dbacp02304 Cartilage protein hydrolysate peptide FIMGPY Skate Cell proliferation inhibition; Apoptosis inducing MTT assay HeLa Cervical cancer IC50 : 4.81 mg/mL
dbacp04884 Non-digestible fraction peptide GLTSK Common bean Cell proliferation inhibition; Apoptosis inducing MTS assay HCT116 Colorectal cancer IC50 : 0.51 mg/ml
dbacp04885 Non-digestible fraction peptide LSGNK Common bean Cell proliferation inhibition; Apoptosis inducing MTS assay HCT116 Colorectal cancer IC50 : 0.51 mg/ml
dbacp04886 Non-digestible fraction peptide GEGSGA Common bean Cell proliferation inhibition; Apoptosis inducing MTS assay HCT116 Colorectal cancer IC50 : 0.51 mg/ml
dbacp04887 Non-digestible fraction peptide MPACGSS Common bean Cell proliferation inhibition; Apoptosis inducing MTS assay HCT116 Colorectal cancer IC50 : 0.51 mg/ml
dbacp04888 Non-digestible fraction peptide MTEEY Common bean Cell proliferation inhibition; Apoptosis inducing MTS assay HCT116 Colorectal cancer IC50 : 0.51 mg/ml
dbacp05103 PA10 RQIKIWFQNRRMKWKKGGGGNNETTSIQIAGSLHHHHHH Synthetic construct Cell proliferation inhibition; Cell penetration; Apoptosis Cell viability assay MDA-MB231 Breast cancer MIC : 10 μM
dbacp05104 PA10 RQIKIWFQNRRMKWKKGGGGNNETTSIQIAGSLHHHHHH Synthetic construct Cell proliferation inhibition; Cell penetration; Apoptosis Cell viability assay HCC1806 Breast cancer MIC : 10 μM
dbacp05105 PA10 RQIKIWFQNRRMKWKKGGGGNNETTSIQIAGSLHHHHHH Synthetic construct Cell proliferation inhibition; Cell penetration; Apoptosis Cell viability assay 184B5 Breast cancer MIC : 10 μM
dbacp05106 PA10 RQIKIWFQNRRMKWKKGGGGNNETTSIQIAGSLHHHHHH Synthetic construct Cell proliferation inhibition; Cell penetration; Apoptosis Cell viability assay MCF10A Breast cancer MIC : 10 μM
dbacp05107 PA15 RQIKIWFQNRRMKWKKGGSLSAACHEQWSLGAQHHHHHH Synthetic construct Cell proliferation inhibition; Cell penetration; Apoptosis Cell viability assay MDA-MB231 Breast cancer MIC : 10 μM
dbacp05108 PA15 RQIKIWFQNRRMKWKKGGSLSAACHEQWSLGAQHHHHHH Synthetic construct Cell proliferation inhibition; Cell penetration; Apoptosis Cell viability assay HCC1806 Breast cancer MIC : 10 μM
dbacp05109 PA15 RQIKIWFQNRRMKWKKGGSLSAACHEQWSLGAQHHHHHH Synthetic construct Cell proliferation inhibition; Cell penetration; Apoptosis Cell viability assay 184B5 Breast cancer MIC : 10 μM
dbacp05110 PA15 RQIKIWFQNRRMKWKKGGSLSAACHEQWSLGAQHHHHHH Synthetic construct Cell proliferation inhibition; Cell penetration; Apoptosis Cell viability assay MCF10A Breast cancer MIC : 10 μM
dbacp05111 PA2 RQIKIWFQNRRMKWKKGGATRPRVDTQPELCGMHHHHHH Synthetic construct Cell proliferation inhibition; Cell penetration; Apoptosis Cell viability assay MDA-MB231 Breast cancer MIC : 10 μM
dbacp05112 PA2 RQIKIWFQNRRMKWKKGGATRPRVDTQPELCGMHHHHHH Synthetic construct Cell proliferation inhibition; Cell penetration; Apoptosis Cell viability assay HCC1806 Breast cancer MIC : 10 μM
dbacp05113 PA2 RQIKIWFQNRRMKWKKGGATRPRVDTQPELCGMHHHHHH Synthetic construct Cell proliferation inhibition; Cell penetration; Apoptosis Cell viability assay 184B5 Breast cancer MIC : 10 μM
dbacp05114 PA2 RQIKIWFQNRRMKWKKGGATRPRVDTQPELCGMHHHHHH Synthetic construct Cell proliferation inhibition; Cell penetration; Apoptosis Cell viability assay MCF10A Breast cancer MIC : 10 μM
dbacp05115 PA3 RQIKIWFQNRRMKWKKGGDCLCISRRARLLRATHHHHHH Synthetic construct Cell proliferation inhibition; Cell penetration; Apoptosis Cell viability assay MDA-MB231 Breast cancer MIC : 10 μM
dbacp05116 PA3 RQIKIWFQNRRMKWKKGGDCLCISRRARLLRATHHHHHH Synthetic construct Cell proliferation inhibition; Cell penetration; Apoptosis Cell viability assay HCC1806 Breast cancer MIC : 10 μM
dbacp05117 PA3 RQIKIWFQNRRMKWKKGGDCLCISRRARLLRATHHHHHH Synthetic construct Cell proliferation inhibition; Cell penetration; Apoptosis Cell viability assay 184B5 Breast cancer MIC : 10 μM
dbacp05118 PA3 RQIKIWFQNRRMKWKKGGDCLCISRRARLLRATHHHHHH Synthetic construct Cell proliferation inhibition; Cell penetration; Apoptosis Cell viability assay MCF10A Breast cancer MIC : 10 μM
dbacp05119 PA38 RQIKIWFQNRRMKWKKGGKYNGRFTTHHLLHLLNHHHHHH Synthetic construct Cell proliferation inhibition; Cell penetration; Apoptosis Cell viability assay MDA-MB231 Breast cancer MIC : 10 μM
dbacp05120 PA38 RQIKIWFQNRRMKWKKGGKYNGRFTTHHLLHLLNHHHHHH Synthetic construct Cell proliferation inhibition; Cell penetration; Apoptosis Cell viability assay HCC1806 Breast cancer MIC : 10 μM
dbacp05121 PA38 RQIKIWFQNRRMKWKKGGKYNGRFTTHHLLHLLNHHHHHH Synthetic construct Cell proliferation inhibition; Cell penetration; Apoptosis Cell viability assay 184B5 Breast cancer MIC : 10 μM
dbacp05122 PA38 RQIKIWFQNRRMKWKKGGKYNGRFTTHHLLHLLNHHHHHH Synthetic construct Cell proliferation inhibition; Cell penetration; Apoptosis Cell viability assay MCF10A Breast cancer MIC : 10 μM
dbacp05123 PA49 RQIKIWFQNRRMKWKKGGAGVYTFLVGADNRGWEHHHHHH Synthetic construct Cell proliferation inhibition; Cell penetration; Apoptosis Cell viability assay MDA-MB231 Breast cancer MIC : 10 μM
dbacp05124 PA49 RQIKIWFQNRRMKWKKGGAGVYTFLVGADNRGWEHHHHHH Synthetic construct Cell proliferation inhibition; Cell penetration; Apoptosis Cell viability assay HCC1806 Breast cancer MIC : 10 μM
dbacp05125 PA49 RQIKIWFQNRRMKWKKGGAGVYTFLVGADNRGWEHHHHHH Synthetic construct Cell proliferation inhibition; Cell penetration; Apoptosis Cell viability assay 184B5 Breast cancer MIC : 10 μM
dbacp05126 PA49 RQIKIWFQNRRMKWKKGGAGVYTFLVGADNRGWEHHHHHH Synthetic construct Cell proliferation inhibition; Cell penetration; Apoptosis Cell viability assay MCF10A Breast cancer MIC : 10 μM
dbacp06415 U3 NGSIPATWASL Date palm Cell proliferation inhibition MTT/MTS assay T47D Breast cancer IC50 : 434.7 – 616.5 μM
dbacp06416 U3 NGSIPATWASL Date palm Cell proliferation inhibition MTT/MTS assay MCF-7 Breast cancer IC50 : 555 μM
dbacp06417 U3 NGSIPATWASL Date palm Cell proliferation inhibition MTT/MTS assay Hep G2 Liver cancer IC50 : 561 μM
dbacp06418 U7 NCSIHGDIPAY Date palm Cell proliferation inhibition MTT/MTS assay T47D Breast cancer IC50 : 485.3–702.8 μM
dbacp06419 U7 NCSIHGDIPAY Date palm Cell proliferation inhibition MTT/MTS assay MCF-7 Breast cancer IC50 : 554 μM
dbacp06420 U7 NCSIHGDIPAY Date palm Cell proliferation inhibition MTT/MTS assay Hep G2 Liver cancer IC50 : 523 μM