110 result(s) have been found!
| Accession | Name | Sequence | Source/Organism | Mechanism | Assay Type | Cell Line | Cancer Type | Activity |
|---|---|---|---|---|---|---|---|---|
| dbacp00719 | 3A | LTAEHYAAQATS | Not found | Cell cycle arrest or apoptosis of cells | Immunoprecipitation assay | HCT-116-p53+/+ | Colon cancer | IC50 : >100 µM |
| dbacp00813 | A5 | KAQIRAMECNIL | Cyclin B (285-296) | Apoptosis inducing | MTT/MTS assay | HCT-116 | Colon cancer | Not found |
| dbacp01146 | Ansalvamide A | NA | Marine fungus, Wilt of banana | Apoptosis inducing | Not specified | HCT-116 | Colon cancer | IC50 : 9.8 µg/mL |
| dbacp01331 | Aurein-2.5 | GLFDIVKKVVGAFGSL | Green and golden bell frog | Cell membrane disintegration | One-dose and five-dose assay | HCT-116 | Colon cancer | IC50 : 4-5 μM |
| dbacp02040 | Buforin IIb | RAGLQFPVGRLLRRLLRRLLR | Histone H2A | Inducing mitochondria-dependent apoptosis | MTT/MTS assay | HCT-116 | Colon cancer | IC50 : 14.6 µg/ml |
| dbacp02168 | C7A | KILRGVAKKIMRTFLRRISKDILTGKK | NK-2 peptide based derivatives | Apoptosis; Necrosis | Cell viability assay | HCT-116 | Colorectal cancer | Cell viability : >50% at 25μM approx. |
| dbacp02173 | C7A | KILRGVAKKIMRTFLRRISKDILTGKK | NK-2 peptide based derivatives | Apoptosis; Necrosis | Cell viability assay | HCT-116 | Colorectal cancer | Cell viability : >40% at 12.5μM approx. |
| dbacp02189 | C7A-D21K | KILRGVAKKIMRTFLRRISKKILTGKK | NK-2 peptide based derivatives | Apoptosis; Necrosis | Cell viability assay | HCT-116 | Colorectal cancer | Cell viability : 50% at 12.5μM approx. |
| dbacp02194 | C7A-D21K | KILRGVAKKIMRTFLRRISKKILTGKK | NK-2 peptide based derivatives | Apoptosis; Necrosis | Cell viability assay | HCT-116 | Colorectal cancer | Cell viability : >40% at 12.5μM approx. |
| dbacp02209 | C7A-Δ | KILRGVAKKIMRTFLRRISKDILTGKK | NK-2 peptide based derivatives | Apoptosis; Necrosis | Cell viability assay | HCT-116 | Colorectal cancer | Cell viability : >50% at 12.5μM approx. |
| dbacp02214 | C7A-Δ | KILRGVAKKIMRTFLRRISKDILTGKK | NK-2 peptide based derivatives | Apoptosis; Necrosis | Cell viability assay | HCT-116 | Colorectal cancer | Cell viability : >50% at 12.5μM approx. |
| dbacp02596 | Cyclic [W(RW)4 ]-Dox | WRWRWRWRW | Not found | Inhibition of the cell proliferation | MTT/MTS assay | HCT-116 | Colon cancer | 50-67% inhibition of cell proliferation at 1 µM |
| dbacp02746 | DI | LTFEHYWAQLTS | E3 ubiquitin-protein ligase | Cell cycle arrest or apoptosis of cells | Immunoprecipitation assay | HCT-116-p53+/+ | Colon cancer | IC50 : 0.29 µM |
| dbacp02747 | DI | LTFEHYWAQLTS | E3 ubiquitin-protein ligase | Cell cycle arrest or apoptosis of cells | Immunoprecipitation assay | HCT-116-p53+/+ | Colon cancer | IC50 : 1.6 µM |
| dbacp02974 | GA-K3 | FLGWLFKWAKK | Undecapeptide analogues derived from Brevinin-1EMa | Cell membrane disruption | MTT/MTS assay | HCT-116 | Colon cancer | IC50 : 27.00 µM |
| dbacp02981 | GA-K3 | FLGWLFKWAKK | Brevinin-1EMa | Cell membrane disruption | MTT/MTS assay | HCT-116 | Colon cancer | IC50 : 27.00 µM |
| dbacp02988 | GA-K4 | FLKWLFKWAKK | Undecapeptide analogues derived from Brevinin-1EMa | Cell membrane disruption | MTT/MTS assay | HCT-116 | Colon cancer | IC50 : 14.80 µM |
| dbacp02995 | GA-K4 | FLKWLFKWAKK | Brevinin-1EMa | Cell membrane disruption | MTT/MTS assay | HCT-116 | Colon cancer | IC50 : 14.8 µM |
| dbacp03002 | GA-W3 | FLGWLFKWAWK | Undecapeptide analogues derived from Brevinin-1EMa | Cell membrane disruption | MTT/MTS assay | HCT-116 | Colon cancer | IC50 : 24.63 µM |
| dbacp03009 | GA-W3 | FLGWLFKWAWK | Brevinin-1EMa | Cell membrane disruption | MTT/MTS assay | HCT-116 | Colon cancer | IC50 : 24.63 µM |
| dbacp03016 | GA-W4 | FLWWLFKWAWK | Undecapeptide analogues derived from Brevinin-1EMa | Cell membrane disruption | MTT/MTS assay | HCT-116 | Colon cancer | IC50 : 14.80 µM |
| dbacp03023 | GA-W4 | FLWWLFKWAWK | Brevinin-1EMa | Cell membrane disruption | MTT/MTS assay | HCT-116 | Colon cancer | IC50 : 14.80 µM |
| dbacp03648 | Lan-7 | fA*YwKA*T | Analogue of TT-232 | Tubulin depolymerization | Sulforhodamine B assay | HCT-116 | Colon cancer | IC50 : 29.97 ± 1.19 µM |
| dbacp04105 | linear (RW)4-Dox | RWRWRWRW | Doxorubicin (Dox) is a well-known anthracycline which has been conjugated to a CPP | Inhibition of the cell proliferation | MTT/MTS assay | HCT-116 | Colon cancer | 21-61% anti-proliferative activity at 1 µM |
| dbacp04310 | Lunasin | SKWQHQQDSCRKQLQGVNLTPCEKHIMEKIQGRDDDDDDDDDD | Plant sources | Inducing apoptosis | MTT assay | HCT-116 parentl | Colorectal cancer | IC50 : 107.5 ± 1.9 μM |
| dbacp04313 | Lunasin | SKWQHQQDSCRKQLQGVNLTPCEKHIMEKIQGRGDDDDDDDDD | Soyabean | Apoptosis inducing; Anti-proliferative | MTT/MTS | HCT-116 | Not specified | IC50 : 31.6 µM |
| dbacp04685 | MIP | PRFWEYWLRLME | E3 ubiquitin-protein ligase | Cell cycle arrest or apoptosis of cells | Immunoprecipitation assay | HCT-116-p53+/+ | Colon cancer | IC50 : 0.01 µM |
| dbacp04686 | MIP | PRFWEYWLRLME | E3 ubiquitin-protein ligase | Cell cycle arrest or apoptosis of cells | Immunoprecipitation assay | HCT-116-p53+/+ | Colon cancer | IC50 : 0.12 µM |
| dbacp04687 | MIP(F3A) | PRAWEYWLRLME | E3 ubiquitin-protein ligase | Cell cycle arrest or apoptosis of cells | Immunoprecipitation assay | HCT-116-p53+/+ | Colon cancer | IC50 : 0.57 µM |
| dbacp04688 | MIP(L10A) | PRFWEYWLRAME | E3 ubiquitin-protein ligase | Cell cycle arrest or apoptosis of cells | Immunoprecipitation assay | HCT-116-p53+/+ | Colon cancer | IC50 : 1.14 µM |
| dbacp04689 | MIP(M11A) | PRFWEYWLRLAE | E3 ubiquitin-protein ligase | Cell cycle arrest or apoptosis of cells | Immunoprecipitation assay | HCT-116-p53+/+ | Colon cancer | IC50 : 0.4 µM |
| dbacp04690 | MIP(R9A) | PRFWEYWLALME | E3 ubiquitin-protein ligase | Cell cycle arrest or apoptosis of cells | Immunoprecipitation assay | HCT-116-p53+/+ | Colon cancer | IC50 : 0.02 µM |
| dbacp04691 | MIP(W7A) | PRFWEYALRLME | E3 ubiquitin-protein ligase | Cell cycle arrest or apoptosis of cells | Immunoprecipitation assay | HCT-116-p53+/+ | Colon cancer | IC50 : >100 µM |
| dbacp04692 | MIP(Y6A) | PRFWEAWLRLME | E3 ubiquitin-protein ligase | Cell cycle arrest or apoptosis of cells | Immunoprecipitation assay | HCT-116-p53+/+ | Colon cancer | IC50 : >100 µM |
| dbacp05082 | P5317-28 | QETFSDLWKLLP | E3 ubiquitin-protein ligase | Cell cycle arrest or apoptosis of cells | Immunoprecipitation assay | HCT-116-p53+/+ | Colon cancer | IC50 : 4.7 µM |
| dbacp05083 | P5317-28 | QETFSDLWKLLP | E3 ubiquitin-protein ligase | Cell cycle arrest or apoptosis of cells | Immunoprecipitation assay | HCT-116-p53+/+ | Colon cancer | IC50 : 30 µM |
| dbacp06022 | San A-amide | NA | Marine fungus, Wilt of banana | Apoptosis induction | Not specified | HCT-116 | Colon cancer | MIC : 0.98 µg/mL |
| dbacp06165 | Styelin D | GW*LR**K**AAK**SVGK**FY*Y*K**HK*Y*Y*IK*AAWQIGKHAL-NH2 | Asian sea squirt | Disruption of cellular membranes | MTT assay | HCT-116 | Human melanoma cancer | IC50 : 10.1 mg/ml |
| dbacp06195 | Tat | RKKRRQRRR | HIV-Tat (49-57) | Apoptosis inducing | MTT/MTS assay | HCT-116 | Colon cancer | ~10% cytotoxicity at 100 µM |
| dbacp06199 | Tat-a5 | KAQIRAMECNILGRKKRRQRRR | HIV-Tat (49-57) | Apoptosis inducing | MTT/MTS assay | HCT-116 | Colon cancer | ~80% cytotoxicity at 100 µM |
| dbacp06672 | Crabrolin | FLPLILRKIVTAL | European hornet (Vespa crabro) | Not available | MTT assay | HCT-116 | Colon Cancer | IC50 = 8.539 μM |
| dbacp06677 | Crabrolin-4R | FLPRILRKIVTAL | Synthetic Analog of Crabrolin | Not available | MTT assay | HCT-116 | Colon Cancer | IC50 = 47.02 μM |
| dbacp06682 | Crabrolin-4K | FLPKILRKIVTAL | Synthetic Analog of Crabrolin | Not available | MTT assay | HCT-116 | Colon Cancer | IC50 = 42.88 μM |
| dbacp06687 | Crabrolin-TR | FLPRILRKIVRAL | Synthetic Analog of Crabrolin | Not available | MTT assay | HCT-116 | Colon Cancer | IC50 = 2.810 μM |
| dbacp06692 | Crabrolin-FR | RLPRILRKIVRAL | Synthetic Analog of Crabrolin | Not available | MTT assay | HCT-116 | Colon Cancer | IC50 = 30.29 μM |
| dbacp06697 | Crabrolin-AR | RLPRILRKIVRRL | Synthetic Analog of Crabrolin | Not available | MTT assay | HCT-116 | Colon Cancer | IC50 = 29.90 μM |
| dbacp06702 | Crabrolin-PR | RLRRILRKIVRRL | Synthetic Analog of Crabrolin | Not available | MTT assay | HCT-116 | Colon Cancer | IC50 = 16.29 μM |
| dbacp06767 | M1-21 | rrrqrrkkrg-QTQPRLGPPQTPAGGCSILIF | Synthetic | FOXM1 inhibitor | Cell Viability assay | HCT-116 | Colon Cancer | IC50 = 9.08 µM |
| dbacp06777 | BK-1 | rRP-Hyp-G-Thi-S-Apc-Thi-R | Synthetic analogue of Bradykinin | Not available | MTS assay | HCT-116 | Colorectal Cancer | Not Available |
| dbacp06778 | BK-2 | rRP-Hyp-G-Thi-S-f-Apc-R | Synthetic analogue of Bradykinin | Not available | MTS assay | HCT-116 | Colorectal Cancer | Not Available |
| dbacp06779 | BK-3 | Aaa-rRP-Hyp-G-Thi-S-Acc-Thi-R | Synthetic analogue of Bradykinin | Not available | MTS assay | HCT-116 | Colorectal Cancer | Not Available |
| dbacp06780 | BK-4 | Aaa-rRP-Hyp-G-Thi-S-f-Acc-R | Synthetic analogue of Bradykinin | Not available | MTS assay | HCT-116 | Colorectal Cancer | Not Available |
| dbacp06781 | BK-5 | rRP-Hyp-G-Thi-S-f-(L)Pip-R | Synthetic analogue of Bradykinin | Not available | MTS assay | HCT-116 | Colorectal Cancer | Not Available |
| dbacp06782 | BK-6 | Aaa-rRP-Hyp-G-Thi-S-(D)Pip-(L)Pip-R | Synthetic analogue of Bradykinin | Not available | MTS assay | HCT-116 | Colorectal Cancer | Not Available |
| dbacp06783 | BK-7 | rRP-Hyp-G-Thi-S-(D)Pip-Thi-R | Synthetic analogue of Bradykinin | Not available | MTS assay | HCT-116 | Colorectal Cancer | Not Available |
| dbacp06784 | BK-8 | Aaa-rRP-Hyp-G-Thi-S-(D)Pip-Thi-R | Synthetic analogue of Bradykinin | Not available | MTS assay | HCT-116 | Colorectal Cancer | Not Available |
| dbacp06785 | NT-9 | RRPYIL | Synthetic analogue of Neurotensin | Not available | MTS assay | HCT-116 | Colorectal Cancer | Not Available |
| dbacp06786 | NT-10 | RRPAIL | Synthetic analogue of Neurotensin | Not available | MTS assay | HCT-116 | Colorectal Cancer | Not Available |
| dbacp06787 | NT-11 | RRPYAL | Synthetic analogue of Neurotensin | Not available | MTS assay | HCT-116 | Colorectal Cancer | Not Available |
| dbacp06788 | NT-12 | PEGRKPY-Tle-L | Synthetic analogue of Neurotensin | Not available | MTS assay | HCT-116 | Colorectal Cancer | Not Available |
| dbacp06789 | NT-12 | PEGKRPY-Tle-L | Synthetic analogue of Neurotensin | Not available | MTS assay | HCT-116 | Colorectal Cancer | Not Available |
| dbacp06790 | NT-12 | PEGKKPY-Tle-L | Synthetic analogue of Neurotensin | Not available | MTS assay | HCT-116 | Colorectal Cancer | Not Available |
| dbacp07012 | Sansalvimide A | LXVLF | Fusarium sp. | Not Available | Not Available | HCT-116 | Colon Cancer | IC50 = 9.8 µg/ml |
| dbacp07053 | Temporin-PKE | FLPLIIGALSSLLPKIF | skin secretion of Pelophylax kl. esculentus | Charge-optimized membranolysis induces apoptosis. | MTT assay | HCT-116 | Colorectal Cancer | IC50 = 21.31 μM |
| dbacp07058 | Temporin-PKE-2K | FLPLIIGKLSSLLPKIF | Synthetic | Charge-optimized membranolysis induces apoptosis. | MTT assay | HCT-116 | Colorectal Cancer | IC50 = 2.84 μM |
| dbacp07063 | Temporin-PKE-K12 | FLPLIIGALSSKLPKIF | Synthetic | Charge-optimized membranolysis induces apoptosis. | MTT assay | HCT-116 | Colorectal Cancer | IC50 = 22.09 μM |
| dbacp07068 | Temporin-PKE-3K | FLPKIIGKLSSLLPKIF | Synthetic | Charge-optimized membranolysis induces apoptosis. | MTT assay | HCT-116 | Colorectal Cancer | IC50 = 0.38 μM |
| dbacp07073 | Temporin-PKE-4K | FLPKIIGKLSSKLPKIF | Synthetic | Charge-optimized membranolysis induces apoptosis. | MTT assay | HCT-116 | Colorectal Cancer | IC50 = 99.36 μM |
| dbacp07078 | Temporin-PKE-i | FLPLIIGALSSLLPKiF | Synthetic | Charge-optimized membranolysis induces apoptosis. | MTT assay | HCT-116 | Colorectal Cancer | IC50 = 3.07 μM |
| dbacp07083 | Temporin-PKE-3i | FLPLiiGALSSLLPKiF | Synthetic | Charge-optimized membranolysis induces apoptosis. | MTT assay | HCT-116 | Colorectal Cancer | IC50 = 72.06 μM |
| dbacp07316 | B1OS-L | FLPLIASLAGNVVPKIFCKITKRC | B-1OS | Not Available | MTT assay | HCT-116 | Colon Cancer | IC50 = 11.03 µM |
| dbacp07321 | B1OS-D-L | FlPLIASLAGNVVPKIFCKITKRC | B-1OS | Not Available | MTT assay | HCT-116 | Colon Cancer | IC50 = 3.721 µM |
| dbacp07324 | IK13 | CIIKKIIKKIIKK | Synthetic | Mitochondrial mediated apoptosis | MTT assay | HCT-116 | Colorectal Cancer | IC50 = 29 ± 6 µM |
| dbacp07326 | LK13 | CLLKKLLKKLLKK | Synthetic | Mitochondrial mediated apoptosis | MTT assay | HCT-116 | Colorectal Cancer | IC50 = 23 ± 2 µM |
| dbacp07328 | IR13 | CIIRRIIRRIIRR | Synthetic | Mitochondrial mediated apoptosis | MTT assay | HCT-116 | Colorectal Cancer | IC50 > 100 µM |
| dbacp07330 | LR13 | CLLRRLLRRLLRR | Synthetic | Mitochondrial mediated apoptosis | MTT assay | HCT-116 | Colorectal Cancer | IC50 = 15.6 ± 1.0 µM |
| dbacp07332 | CI-15 | CIIKKIIKKIIKKII | Synthetic | Mitochondrial mediated apoptosis | MTT assay | HCT-116 | Colorectal Cancer | IC50 = 7.7 ± 0.2 µM |
| dbacp07334 | GI-15 | LC-Propargyl-GIIKKIIKKIIKKII | Synthetic | Mitochondrial mediated apoptosis | MTT assay | HCT-116 | Colorectal Cancer | IC50 = 13.6 ± 0.2 µM |
| dbacp07348 | GA - 2 | Structure given in figure | Synthetic (glycyrrhetinic acid (GA)-based peptides) | Apoptosis induction, Bax/p53/caspase activation | MTT assay | HCT-116 | Colon Cancer | IC50 = 70.30 ± 0.9 µg/mL |
| dbacp07350 | GA - 3 | Structure given in figure | Synthetic (glycyrrhetinic acid (GA)-based peptides) | Apoptosis induction, Bax/p53/caspase activation | MTT assay | HCT-116 | Colon Cancer | IC50 = 7.40 ± 0.4 µg/mL |
| dbacp07352 | GA - 4 | Structure given in figure | Synthetic (glycyrrhetinic acid (GA)-based peptides) | Apoptosis induction, Bax/p53/caspase activation | MTT assay | HCT-116 | Colon Cancer | IC50 = 73.0 ± 1.4 µg/mL |
| dbacp07354 | GA - 5 | Structure given in figure | Synthetic (glycyrrhetinic acid (GA)-based peptides) | Apoptosis induction, Bax/p53/caspase activation | MTT assay | HCT-116 | Colon Cancer | IC50 = 5.2 ± 0.8 µg/mL |
| dbacp07356 | GA - 7 | Structure given in figure | Synthetic (glycyrrhetinic acid (GA)-based peptides) | Apoptosis induction, Bax/p53/caspase activation | MTT assay | HCT-116 | Colon Cancer | IC50 = 3.0 ± 1.1 µg/mL |
| dbacp07359 | GA - 8 | Structure given in figure | Synthetic (glycyrrhetinic acid (GA)-based peptides) | Apoptosis induction, Bax/p53/caspase activation | MTT assay | HCT-116 | Colon Cancer | IC50 = 60.70 ± 0.6 µg/mL |
| dbacp07469 | Protonectin | ILGTILGLLKGL | Parachartergus fraternus | Cell penetration without toxic accumulation | Resazurin dye assay | HCT-116 | Colon Cancer | CC50 = 8.0 ± 0.5 µM |
| dbacp07471 | Protonectin-F | IFGTILGFLKGL | Protonoectin | Cell penetration without toxic accumulation | Resazurin dye assay | HCT-116 | Colon Cancer | CC50 = 9.8 ± 1.2 µM |
| dbacp07474 | MzDef | MSSSNCANVCQTENFPGGECKAEGATRKCFCKNC | Zea mays L. | Disulfide-stabilized peptide disrupts pathogens | MTT assay | HCT-116 | Colon Cancer | IC50 = 29.85 µg/mL |
| dbacp07478 | (LLKK)4 linear peptide | LLKKLLKKLLKKLLKK | Synthetic | Apoptosis, drug-resistance reversal, tumor suppression | MTT assay | HCT-116 | Colon Cancer | Cell Viability (%) ~ 10.73 ± 2.4 at 30 µg/mL |
| dbacp07482 | 2-arm branched peptide | [LLKKLLKK]2kC | Synthetic | Apoptosis, drug-resistance reversal, tumor suppression | MTT assay | HCT-116 | Colon Cancer | Cell Viability (%) ~ 78.6 ± 10.5 at 30 µg/mL |
| dbacp07486 | 4-arm branched peptide | {[LLKKLLKK]2kC}2 | Synthetic | Apoptosis, drug-resistance reversal, tumor suppression | MTT assay | HCT-116 | Colon Cancer | Cell Viability (%) ~ 67.6 ± 5.8 at 30 µg/mL |
| dbacp07504 | Brevinin-1Ha | FALGAVTCLIRTKCKVLPKLF | Analogue of Brevinin-1H | α-helix enhances antimicrobial, anticancer activity | MTT assay | HCT-116 | Colon Cancer | IC50 = 342.8 µM |
| dbacp07508 | Brevinin-1HY | FALGAVTKVLYKLFCLITRKC | Analogue of Brevinin-1H | α-helix enhances antimicrobial, anticancer activity | MTT assay | HCT-116 | Colon Cancer | IC50 = 3.583 µM |
| dbacp07546 | Sur-X | YGRKKRRQRRRKDHRISTFKNWPFLEGCACTPERM | Synthetic | Disrupts XIAP-survivin, induces apoptosis/necroptosis | MTT assay | HCT-116 | Colon Cancer | 20% cell viability at at 20 μM |
| dbacp07890 | H-58 | IKLSKKTKKNLKKVLKGS5IKGS5IAVAKMV | Synthetic | Cell entry, DNA damage, apoptosis. | MTT assay | HCT-116 | Colon Cancer | IC50 = 1.29 ± 0.08 μM |
| dbacp07893 | H-57 | IKLSKKTKKNLKKVLKGS5IKGS5IAVAKMV | Synthetic | Cell entry, DNA damage, apoptosis. | MTT assay | HCT-116 | Colon Cancer | IC50 = 1.29 ± 0.08 μM |
| dbacp07896 | H-18 | IKLSKKTKKNLKKVLKGS5IKGS5IAVAKMV | Synthetic | Cell entry, DNA damage, apoptosis. | MTT assay | HCT-116 | Colon Cancer | IC50 = 1.11 ± 0.21 μM |
| dbacp07899 | H-21 | IKLSKS5TKKS5LKKVLKGS5IKGS5IAVAKMV | Synthetic | Cell entry, DNA damage, apoptosis. | MTT assay | HCT-116 | Colon Cancer | IC50 = 3.05 ± 0.21 μM |
| dbacp07902 | H-20 | IKLSPS5TKKS5LKKVLKGS5IKGS5IAVAKMV | Synthetic | Cell entry, DNA damage, apoptosis. | MTT assay | HCT-116 | Colon Cancer | IC50 = 2.63 ± 0.35 μM |
| dbacp07905 | H-19 | IKLSKETKKNLKKVLKGS5IKGS5IAVAKMV | Synthetic | Cell entry, DNA damage, apoptosis. | MTT assay | HCT-116 | Colon Cancer | IC50 = 1.78 ± 0.35 μM |
| dbacp07908 | H-17 | IKLSKS5TKKS5LKKVLKGAIKGAIAVAKMV | Synthetic | Cell entry, DNA damage, apoptosis. | MTT assay | HCT-116 | Colon Cancer | IC50 = 1.49 ± 0.45 μM |
| dbacp07911 | H-16 | IKLSPS5TKKS5LKKVLKGAIKGAIAVAKMV | Synthetic | Cell entry, DNA damage, apoptosis. | MTT assay | HCT-116 | Colon Cancer | IC50 = 2.65 ± 0.35 μM |
| dbacp07914 | H-15 | IKLSKS5TKDS5LKKVLKGAIKGAIAVAKMV | Synthetic | Cell entry, DNA damage, apoptosis. | MTT assay | HCT-116 | Colon Cancer | IC50 = 2.95 ± 0.25 μM |
| dbacp07917 | H-10 | IKLSPS5TKDS5LKKVLKGS5IKGS5IAVAKMV | Synthetic | Cell entry, DNA damage, apoptosis. | MTT assay | HCT-116 | Colon Cancer | IC50 = 3.51 ± 0.37 μM |
| dbacp07920 | H-5 | IKLSPETKDNLKKVLKGS5IKGS5IAVAKMV | Synthetic | Cell entry, DNA damage, apoptosis. | MTT assay | HCT-116 | Colon Cancer | IC50 = 4.16 ± 0.21 μM |
| dbacp07923 | H-2 | IKLSPS5TKDS5LKKVLKGAIKGAIAVAKMV | Synthetic | Cell entry, DNA damage, apoptosis. | MTT assay | HCT-116 | Colon Cancer | IC50 = 3.54 ± 0.72 μM |
| dbacp08018 | Peptide4 Gonearrestide | ADAPGNYPLDARGKSYYC | Androctonus australis | Gonearrestide induces G1 cell-cycle arrest | MTT assay | HCT-116 | Colon Cancer | Not Available |
| dbacp08023 | Peptide6 Gonearrestide | KLSAIISKIRDE | Androctonus australis | Gonearrestide induces G1 cell-cycle arrest | MTT assay | HCT-116 | Colon Cancer | Not Available |
| dbacp08028 | Peptide10 Gonearrestide | NDADKDEMQSVYRGKANDDNSRGSKTNHRF | Androctonus mauritanicus | Gonearrestide induces G1 cell-cycle arrest | MTT assay | HCT-116 | Colon Cancer | Not Available |
| dbacp08033 | Peptide13 Gonearrestide | WCYKLPDRVSIKEKGRCN | Androctonus mauritanicus | Gonearrestide induces G1 cell-cycle arrest | MTT assay | HCT-116 | Colon Cancer | IC50 ~ 100 μM/L |
| dbacp08168 | Bmattacin2 | Not Available | silkworm Bombyx mori | Not Available | MTS assay | HCT-116 | Colorectal Cancer | IC50 = 1.70 μM |