dbACP: A Comprehensive Database of Anti-Cancer Peptides

110 result(s) have been found!

Accession Name Sequence Source/Organism Mechanism Assay Type Cell Line Cancer Type Activity
dbacp00719 3A LTAEHYAAQATS Not found Cell cycle arrest or apoptosis of cells Immunoprecipitation assay HCT-116-p53+/+ Colon cancer IC50 : >100 µM
dbacp00813 A5 KAQIRAMECNIL Cyclin B (285-296) Apoptosis inducing MTT/MTS assay HCT-116 Colon cancer Not found
dbacp01146 Ansalvamide A NA Marine fungus, Wilt of banana Apoptosis inducing Not specified HCT-116 Colon cancer IC50 : 9.8 µg/mL
dbacp01331 Aurein-2.5 GLFDIVKKVVGAFGSL Green and golden bell frog Cell membrane disintegration One-dose and five-dose assay HCT-116 Colon cancer IC50 : 4-5 μM
dbacp02040 Buforin IIb RAGLQFPVGRLLRRLLRRLLR Histone H2A Inducing mitochondria-dependent apoptosis MTT/MTS assay HCT-116 Colon cancer IC50 : 14.6 µg/ml
dbacp02168 C7A KILRGVAKKIMRTFLRRISKDILTGKK NK-2 peptide based derivatives Apoptosis; Necrosis Cell viability assay HCT-116 Colorectal cancer Cell viability : >50% at 25μM approx.
dbacp02173 C7A KILRGVAKKIMRTFLRRISKDILTGKK NK-2 peptide based derivatives Apoptosis; Necrosis Cell viability assay HCT-116 Colorectal cancer Cell viability : >40% at 12.5μM approx.
dbacp02189 C7A-D21K KILRGVAKKIMRTFLRRISKKILTGKK NK-2 peptide based derivatives Apoptosis; Necrosis Cell viability assay HCT-116 Colorectal cancer Cell viability : 50% at 12.5μM approx.
dbacp02194 C7A-D21K KILRGVAKKIMRTFLRRISKKILTGKK NK-2 peptide based derivatives Apoptosis; Necrosis Cell viability assay HCT-116 Colorectal cancer Cell viability : >40% at 12.5μM approx.
dbacp02209 C7A-Δ KILRGVAKKIMRTFLRRISKDILTGKK NK-2 peptide based derivatives Apoptosis; Necrosis Cell viability assay HCT-116 Colorectal cancer Cell viability : >50% at 12.5μM approx.
dbacp02214 C7A-Δ KILRGVAKKIMRTFLRRISKDILTGKK NK-2 peptide based derivatives Apoptosis; Necrosis Cell viability assay HCT-116 Colorectal cancer Cell viability : >50% at 12.5μM approx.
dbacp02596 Cyclic [W(RW)4 ]-Dox WRWRWRWRW Not found Inhibition of the cell proliferation MTT/MTS assay HCT-116 Colon cancer 50-67% inhibition of cell proliferation at 1 µM
dbacp02746 DI LTFEHYWAQLTS E3 ubiquitin-protein ligase Cell cycle arrest or apoptosis of cells Immunoprecipitation assay HCT-116-p53+/+ Colon cancer IC50 : 0.29 µM
dbacp02747 DI LTFEHYWAQLTS E3 ubiquitin-protein ligase Cell cycle arrest or apoptosis of cells Immunoprecipitation assay HCT-116-p53+/+ Colon cancer IC50 : 1.6 µM
dbacp02974 GA-K3 FLGWLFKWAKK Undecapeptide analogues derived from Brevinin-1EMa Cell membrane disruption MTT/MTS assay HCT-116 Colon cancer IC50 : 27.00 µM
dbacp02981 GA-K3 FLGWLFKWAKK Brevinin-1EMa Cell membrane disruption MTT/MTS assay HCT-116 Colon cancer IC50 : 27.00 µM
dbacp02988 GA-K4 FLKWLFKWAKK Undecapeptide analogues derived from Brevinin-1EMa Cell membrane disruption MTT/MTS assay HCT-116 Colon cancer IC50 : 14.80 µM
dbacp02995 GA-K4 FLKWLFKWAKK Brevinin-1EMa Cell membrane disruption MTT/MTS assay HCT-116 Colon cancer IC50 : 14.8 µM
dbacp03002 GA-W3 FLGWLFKWAWK Undecapeptide analogues derived from Brevinin-1EMa Cell membrane disruption MTT/MTS assay HCT-116 Colon cancer IC50 : 24.63 µM
dbacp03009 GA-W3 FLGWLFKWAWK Brevinin-1EMa Cell membrane disruption MTT/MTS assay HCT-116 Colon cancer IC50 : 24.63 µM
dbacp03016 GA-W4 FLWWLFKWAWK Undecapeptide analogues derived from Brevinin-1EMa Cell membrane disruption MTT/MTS assay HCT-116 Colon cancer IC50 : 14.80 µM
dbacp03023 GA-W4 FLWWLFKWAWK Brevinin-1EMa Cell membrane disruption MTT/MTS assay HCT-116 Colon cancer IC50 : 14.80 µM
dbacp03648 Lan-7 fA*YwKA*T Analogue of TT-232 Tubulin depolymerization Sulforhodamine B assay HCT-116 Colon cancer IC50 : 29.97 ± 1.19 µM
dbacp04105 linear (RW)4-Dox RWRWRWRW Doxorubicin (Dox) is a well-known anthracycline which has been conjugated to a CPP Inhibition of the cell proliferation MTT/MTS assay HCT-116 Colon cancer 21-61% anti-proliferative activity at 1 µM
dbacp04310 Lunasin SKWQHQQDSCRKQLQGVNLTPCEKHIMEKIQGRDDDDDDDDDD Plant sources Inducing apoptosis MTT assay HCT-116 parentl Colorectal cancer IC50 : 107.5 ± 1.9 μM
dbacp04313 Lunasin SKWQHQQDSCRKQLQGVNLTPCEKHIMEKIQGRGDDDDDDDDD Soyabean Apoptosis inducing; Anti-proliferative MTT/MTS HCT-116 Not specified IC50 : 31.6 µM
dbacp04685 MIP PRFWEYWLRLME E3 ubiquitin-protein ligase Cell cycle arrest or apoptosis of cells Immunoprecipitation assay HCT-116-p53+/+ Colon cancer IC50 : 0.01 µM
dbacp04686 MIP PRFWEYWLRLME E3 ubiquitin-protein ligase Cell cycle arrest or apoptosis of cells Immunoprecipitation assay HCT-116-p53+/+ Colon cancer IC50 : 0.12 µM
dbacp04687 MIP(F3A) PRAWEYWLRLME E3 ubiquitin-protein ligase Cell cycle arrest or apoptosis of cells Immunoprecipitation assay HCT-116-p53+/+ Colon cancer IC50 : 0.57 µM
dbacp04688 MIP(L10A) PRFWEYWLRAME E3 ubiquitin-protein ligase Cell cycle arrest or apoptosis of cells Immunoprecipitation assay HCT-116-p53+/+ Colon cancer IC50 : 1.14 µM
dbacp04689 MIP(M11A) PRFWEYWLRLAE E3 ubiquitin-protein ligase Cell cycle arrest or apoptosis of cells Immunoprecipitation assay HCT-116-p53+/+ Colon cancer IC50 : 0.4 µM
dbacp04690 MIP(R9A) PRFWEYWLALME E3 ubiquitin-protein ligase Cell cycle arrest or apoptosis of cells Immunoprecipitation assay HCT-116-p53+/+ Colon cancer IC50 : 0.02 µM
dbacp04691 MIP(W7A) PRFWEYALRLME E3 ubiquitin-protein ligase Cell cycle arrest or apoptosis of cells Immunoprecipitation assay HCT-116-p53+/+ Colon cancer IC50 : >100 µM
dbacp04692 MIP(Y6A) PRFWEAWLRLME E3 ubiquitin-protein ligase Cell cycle arrest or apoptosis of cells Immunoprecipitation assay HCT-116-p53+/+ Colon cancer IC50 : >100 µM
dbacp05082 P5317-28 QETFSDLWKLLP E3 ubiquitin-protein ligase Cell cycle arrest or apoptosis of cells Immunoprecipitation assay HCT-116-p53+/+ Colon cancer IC50 : 4.7 µM
dbacp05083 P5317-28 QETFSDLWKLLP E3 ubiquitin-protein ligase Cell cycle arrest or apoptosis of cells Immunoprecipitation assay HCT-116-p53+/+ Colon cancer IC50 : 30 µM
dbacp06022 San A-amide NA Marine fungus, Wilt of banana Apoptosis induction Not specified HCT-116 Colon cancer MIC : 0.98 µg/mL
dbacp06165 Styelin D GW*LR**K**AAK**SVGK**FY*Y*K**HK*Y*Y*IK*AAWQIGKHAL-NH2 Asian sea squirt Disruption of cellular membranes MTT assay HCT-116 Human melanoma cancer IC50 : 10.1 mg/ml
dbacp06195 Tat RKKRRQRRR HIV-Tat (49-57) Apoptosis inducing MTT/MTS assay HCT-116 Colon cancer ~10% cytotoxicity at 100 µM
dbacp06199 Tat-a5 KAQIRAMECNILGRKKRRQRRR HIV-Tat (49-57) Apoptosis inducing MTT/MTS assay HCT-116 Colon cancer ~80% cytotoxicity at 100 µM
dbacp06672 Crabrolin FLPLILRKIVTAL European hornet (Vespa crabro) Not available MTT assay HCT-116 Colon Cancer IC50 = 8.539 μM
dbacp06677 Crabrolin-4R FLPRILRKIVTAL Synthetic Analog of Crabrolin Not available MTT assay HCT-116 Colon Cancer IC50 = 47.02 μM
dbacp06682 Crabrolin-4K FLPKILRKIVTAL Synthetic Analog of Crabrolin Not available MTT assay HCT-116 Colon Cancer IC50 = 42.88 μM
dbacp06687 Crabrolin-TR FLPRILRKIVRAL Synthetic Analog of Crabrolin Not available MTT assay HCT-116 Colon Cancer IC50 = 2.810 μM
dbacp06692 Crabrolin-FR RLPRILRKIVRAL Synthetic Analog of Crabrolin Not available MTT assay HCT-116 Colon Cancer IC50 = 30.29 μM
dbacp06697 Crabrolin-AR RLPRILRKIVRRL Synthetic Analog of Crabrolin Not available MTT assay HCT-116 Colon Cancer IC50 = 29.90 μM
dbacp06702 Crabrolin-PR RLRRILRKIVRRL Synthetic Analog of Crabrolin Not available MTT assay HCT-116 Colon Cancer IC50 = 16.29 μM
dbacp06767 M1-21 rrrqrrkkrg-QTQPRLGPPQTPAGGCSILIF Synthetic FOXM1 inhibitor Cell Viability assay HCT-116 Colon Cancer IC50 = 9.08 µM
dbacp06777 BK-1 rRP-Hyp-G-Thi-S-Apc-Thi-R Synthetic analogue of Bradykinin Not available MTS assay HCT-116 Colorectal Cancer Not Available
dbacp06778 BK-2 rRP-Hyp-G-Thi-S-f-Apc-R Synthetic analogue of Bradykinin Not available MTS assay HCT-116 Colorectal Cancer Not Available
dbacp06779 BK-3 Aaa-rRP-Hyp-G-Thi-S-Acc-Thi-R Synthetic analogue of Bradykinin Not available MTS assay HCT-116 Colorectal Cancer Not Available
dbacp06780 BK-4 Aaa-rRP-Hyp-G-Thi-S-f-Acc-R Synthetic analogue of Bradykinin Not available MTS assay HCT-116 Colorectal Cancer Not Available
dbacp06781 BK-5 rRP-Hyp-G-Thi-S-f-(L)Pip-R Synthetic analogue of Bradykinin Not available MTS assay HCT-116 Colorectal Cancer Not Available
dbacp06782 BK-6 Aaa-rRP-Hyp-G-Thi-S-(D)Pip-(L)Pip-R Synthetic analogue of Bradykinin Not available MTS assay HCT-116 Colorectal Cancer Not Available
dbacp06783 BK-7 rRP-Hyp-G-Thi-S-(D)Pip-Thi-R Synthetic analogue of Bradykinin Not available MTS assay HCT-116 Colorectal Cancer Not Available
dbacp06784 BK-8 Aaa-rRP-Hyp-G-Thi-S-(D)Pip-Thi-R Synthetic analogue of Bradykinin Not available MTS assay HCT-116 Colorectal Cancer Not Available
dbacp06785 NT-9 RRPYIL Synthetic analogue of Neurotensin Not available MTS assay HCT-116 Colorectal Cancer Not Available
dbacp06786 NT-10 RRPAIL Synthetic analogue of Neurotensin Not available MTS assay HCT-116 Colorectal Cancer Not Available
dbacp06787 NT-11 RRPYAL Synthetic analogue of Neurotensin Not available MTS assay HCT-116 Colorectal Cancer Not Available
dbacp06788 NT-12 PEGRKPY-Tle-L Synthetic analogue of Neurotensin Not available MTS assay HCT-116 Colorectal Cancer Not Available
dbacp06789 NT-12 PEGKRPY-Tle-L Synthetic analogue of Neurotensin Not available MTS assay HCT-116 Colorectal Cancer Not Available
dbacp06790 NT-12 PEGKKPY-Tle-L Synthetic analogue of Neurotensin Not available MTS assay HCT-116 Colorectal Cancer Not Available
dbacp07012 Sansalvimide A LXVLF Fusarium sp. Not Available Not Available HCT-116 Colon Cancer IC50 = 9.8 µg/ml
dbacp07053 Temporin-PKE FLPLIIGALSSLLPKIF skin secretion of Pelophylax kl. esculentus Charge-optimized membranolysis induces apoptosis. MTT assay HCT-116 Colorectal Cancer IC50 = 21.31 μM
dbacp07058 Temporin-PKE-2K FLPLIIGKLSSLLPKIF Synthetic Charge-optimized membranolysis induces apoptosis. MTT assay HCT-116 Colorectal Cancer IC50 = 2.84 μM
dbacp07063 Temporin-PKE-K12 FLPLIIGALSSKLPKIF Synthetic Charge-optimized membranolysis induces apoptosis. MTT assay HCT-116 Colorectal Cancer IC50 = 22.09 μM
dbacp07068 Temporin-PKE-3K FLPKIIGKLSSLLPKIF Synthetic Charge-optimized membranolysis induces apoptosis. MTT assay HCT-116 Colorectal Cancer IC50 = 0.38 μM
dbacp07073 Temporin-PKE-4K FLPKIIGKLSSKLPKIF Synthetic Charge-optimized membranolysis induces apoptosis. MTT assay HCT-116 Colorectal Cancer IC50 = 99.36 μM
dbacp07078 Temporin-PKE-i FLPLIIGALSSLLPKiF Synthetic Charge-optimized membranolysis induces apoptosis. MTT assay HCT-116 Colorectal Cancer IC50 = 3.07 μM
dbacp07083 Temporin-PKE-3i FLPLiiGALSSLLPKiF Synthetic Charge-optimized membranolysis induces apoptosis. MTT assay HCT-116 Colorectal Cancer IC50 = 72.06 μM
dbacp07316 B1OS-L FLPLIASLAGNVVPKIFCKITKRC B-1OS Not Available MTT assay HCT-116 Colon Cancer IC50 = 11.03 µM
dbacp07321 B1OS-D-L FlPLIASLAGNVVPKIFCKITKRC B-1OS Not Available MTT assay HCT-116 Colon Cancer IC50 = 3.721 µM
dbacp07324 IK13 CIIKKIIKKIIKK Synthetic Mitochondrial mediated apoptosis MTT assay HCT-116 Colorectal Cancer IC50 = 29 ± 6 µM
dbacp07326 LK13 CLLKKLLKKLLKK Synthetic Mitochondrial mediated apoptosis MTT assay HCT-116 Colorectal Cancer IC50 = 23 ± 2 µM
dbacp07328 IR13 CIIRRIIRRIIRR Synthetic Mitochondrial mediated apoptosis MTT assay HCT-116 Colorectal Cancer IC50 > 100 µM
dbacp07330 LR13 CLLRRLLRRLLRR Synthetic Mitochondrial mediated apoptosis MTT assay HCT-116 Colorectal Cancer IC50 = 15.6 ± 1.0 µM
dbacp07332 CI-15 CIIKKIIKKIIKKII Synthetic Mitochondrial mediated apoptosis MTT assay HCT-116 Colorectal Cancer IC50 = 7.7 ± 0.2 µM
dbacp07334 GI-15 LC-Propargyl-GIIKKIIKKIIKKII Synthetic Mitochondrial mediated apoptosis MTT assay HCT-116 Colorectal Cancer IC50 = 13.6 ± 0.2 µM
dbacp07348 GA - 2 Structure given in figure Synthetic (glycyrrhetinic acid (GA)-based peptides) Apoptosis induction, Bax/p53/caspase activation MTT assay HCT-116 Colon Cancer IC50 = 70.30 ± 0.9 µg/mL
dbacp07350 GA - 3 Structure given in figure Synthetic (glycyrrhetinic acid (GA)-based peptides) Apoptosis induction, Bax/p53/caspase activation MTT assay HCT-116 Colon Cancer IC50 = 7.40 ± 0.4 µg/mL
dbacp07352 GA - 4 Structure given in figure Synthetic (glycyrrhetinic acid (GA)-based peptides) Apoptosis induction, Bax/p53/caspase activation MTT assay HCT-116 Colon Cancer IC50 = 73.0 ± 1.4 µg/mL
dbacp07354 GA - 5 Structure given in figure Synthetic (glycyrrhetinic acid (GA)-based peptides) Apoptosis induction, Bax/p53/caspase activation MTT assay HCT-116 Colon Cancer IC50 = 5.2 ± 0.8 µg/mL
dbacp07356 GA - 7 Structure given in figure Synthetic (glycyrrhetinic acid (GA)-based peptides) Apoptosis induction, Bax/p53/caspase activation MTT assay HCT-116 Colon Cancer IC50 = 3.0 ± 1.1 µg/mL
dbacp07359 GA - 8 Structure given in figure Synthetic (glycyrrhetinic acid (GA)-based peptides) Apoptosis induction, Bax/p53/caspase activation MTT assay HCT-116 Colon Cancer IC50 = 60.70 ± 0.6 µg/mL
dbacp07469 Protonectin ILGTILGLLKGL Parachartergus fraternus Cell penetration without toxic accumulation Resazurin dye assay HCT-116 Colon Cancer CC50 = 8.0 ± 0.5 µM
dbacp07471 Protonectin-F IFGTILGFLKGL Protonoectin Cell penetration without toxic accumulation Resazurin dye assay HCT-116 Colon Cancer CC50 = 9.8 ± 1.2 µM
dbacp07474 MzDef MSSSNCANVCQTENFPGGECKAEGATRKCFCKNC Zea mays L. Disulfide-stabilized peptide disrupts pathogens MTT assay HCT-116 Colon Cancer IC50 = 29.85 µg/mL
dbacp07478 (LLKK)4 linear peptide LLKKLLKKLLKKLLKK Synthetic Apoptosis, drug-resistance reversal, tumor suppression MTT assay HCT-116 Colon Cancer Cell Viability (%) ~ 10.73 ± 2.4 at 30 µg/mL
dbacp07482 2-arm branched peptide [LLKKLLKK]2kC Synthetic Apoptosis, drug-resistance reversal, tumor suppression MTT assay HCT-116 Colon Cancer Cell Viability (%) ~ 78.6 ± 10.5 at 30 µg/mL
dbacp07486 4-arm branched peptide {[LLKKLLKK]2kC}2 Synthetic Apoptosis, drug-resistance reversal, tumor suppression MTT assay HCT-116 Colon Cancer Cell Viability (%) ~ 67.6 ± 5.8 at 30 µg/mL
dbacp07504 Brevinin-1Ha FALGAVTCLIRTKCKVLPKLF Analogue of Brevinin-1H α-helix enhances antimicrobial, anticancer activity MTT assay HCT-116 Colon Cancer IC50 = 342.8 µM
dbacp07508 Brevinin-1HY FALGAVTKVLYKLFCLITRKC Analogue of Brevinin-1H α-helix enhances antimicrobial, anticancer activity MTT assay HCT-116 Colon Cancer IC50 = 3.583 µM
dbacp07546 Sur-X YGRKKRRQRRRKDHRISTFKNWPFLEGCACTPERM Synthetic Disrupts XIAP-survivin, induces apoptosis/necroptosis MTT assay HCT-116 Colon Cancer 20% cell viability at at 20 μM
dbacp07890 H-58 IKLSKKTKKNLKKVLKGS5IKGS5IAVAKMV Synthetic Cell entry, DNA damage, apoptosis. MTT assay HCT-116 Colon Cancer IC50 = 1.29 ± 0.08 μM
dbacp07893 H-57 IKLSKKTKKNLKKVLKGS5IKGS5IAVAKMV Synthetic Cell entry, DNA damage, apoptosis. MTT assay HCT-116 Colon Cancer IC50 = 1.29 ± 0.08 μM
dbacp07896 H-18 IKLSKKTKKNLKKVLKGS5IKGS5IAVAKMV Synthetic Cell entry, DNA damage, apoptosis. MTT assay HCT-116 Colon Cancer IC50 = 1.11 ± 0.21 μM
dbacp07899 H-21 IKLSKS5TKKS5LKKVLKGS5IKGS5IAVAKMV Synthetic Cell entry, DNA damage, apoptosis. MTT assay HCT-116 Colon Cancer IC50 = 3.05 ± 0.21 μM
dbacp07902 H-20 IKLSPS5TKKS5LKKVLKGS5IKGS5IAVAKMV Synthetic Cell entry, DNA damage, apoptosis. MTT assay HCT-116 Colon Cancer IC50 = 2.63 ± 0.35 μM
dbacp07905 H-19 IKLSKETKKNLKKVLKGS5IKGS5IAVAKMV Synthetic Cell entry, DNA damage, apoptosis. MTT assay HCT-116 Colon Cancer IC50 = 1.78 ± 0.35 μM
dbacp07908 H-17 IKLSKS5TKKS5LKKVLKGAIKGAIAVAKMV Synthetic Cell entry, DNA damage, apoptosis. MTT assay HCT-116 Colon Cancer IC50 = 1.49 ± 0.45 μM
dbacp07911 H-16 IKLSPS5TKKS5LKKVLKGAIKGAIAVAKMV Synthetic Cell entry, DNA damage, apoptosis. MTT assay HCT-116 Colon Cancer IC50 = 2.65 ± 0.35 μM
dbacp07914 H-15 IKLSKS5TKDS5LKKVLKGAIKGAIAVAKMV Synthetic Cell entry, DNA damage, apoptosis. MTT assay HCT-116 Colon Cancer IC50 = 2.95 ± 0.25 μM
dbacp07917 H-10 IKLSPS5TKDS5LKKVLKGS5IKGS5IAVAKMV Synthetic Cell entry, DNA damage, apoptosis. MTT assay HCT-116 Colon Cancer IC50 = 3.51 ± 0.37 μM
dbacp07920 H-5 IKLSPETKDNLKKVLKGS5IKGS5IAVAKMV Synthetic Cell entry, DNA damage, apoptosis. MTT assay HCT-116 Colon Cancer IC50 = 4.16 ± 0.21 μM
dbacp07923 H-2 IKLSPS5TKDS5LKKVLKGAIKGAIAVAKMV Synthetic Cell entry, DNA damage, apoptosis. MTT assay HCT-116 Colon Cancer IC50 = 3.54 ± 0.72 μM
dbacp08018 Peptide4 Gonearrestide ADAPGNYPLDARGKSYYC Androctonus australis Gonearrestide induces G1 cell-cycle arrest MTT assay HCT-116 Colon Cancer Not Available
dbacp08023 Peptide6 Gonearrestide KLSAIISKIRDE Androctonus australis Gonearrestide induces G1 cell-cycle arrest MTT assay HCT-116 Colon Cancer Not Available
dbacp08028 Peptide10 Gonearrestide NDADKDEMQSVYRGKANDDNSRGSKTNHRF Androctonus mauritanicus Gonearrestide induces G1 cell-cycle arrest MTT assay HCT-116 Colon Cancer Not Available
dbacp08033 Peptide13 Gonearrestide WCYKLPDRVSIKEKGRCN Androctonus mauritanicus Gonearrestide induces G1 cell-cycle arrest MTT assay HCT-116 Colon Cancer IC50 ~ 100 μM/L
dbacp08168 Bmattacin2 Not Available silkworm Bombyx mori Not Available MTS assay HCT-116 Colorectal Cancer IC50 = 1.70 μM