284 result(s) have been found!
| Accession | Name | Sequence | Source/Organism | Mechanism | Assay Type | Cell Line | Cancer Type | Activity |
|---|---|---|---|---|---|---|---|---|
| dbacp00039 | Enkephalins7 analogue-8 | YA* | Synthetic Peptide | Apoptosis inducing | MTT/MTS assay | HT-29 | Colon cancer | 9.8% inhibition at 10-6 M |
| dbacp00040 | Enkephalins7 analogue-8 | YA* | Synthetic Peptide | Apoptosis inducing | MTT/MTS assay | HT-29 | Colon cancer | 1.6% inhibition at 10-5 M |
| dbacp00041 | Enkephalins7 analogue-8 | YA* | Synthetic Peptide | Apoptosis inducing | MTT/MTS assay | HT-29 | Colon cancer | 5.4% inhibition at 10-4 M |
| dbacp00042 | Enkephalins7 analogue-8 | YA* | Synthetic Peptide | Apoptosis inducing | MTT/MTS assay | HT-29 | Colon cancer | 26.5% inhibition at 10-3 M |
| dbacp00063 | Enkephalins7 analogue-9 | YSA* | Synthetic Peptide | Apoptosis inducing | MTT/MTS assay | HT-29 | Colon cancer | 4.9% inhibition at 10-6 M |
| dbacp00064 | Enkephalins7 analogue-9 | YSA* | Synthetic Peptide | Apoptosis inducing | MTT/MTS assay | HT-29 | Colon cancer | 8.9% inhibition at 10-5 M |
| dbacp00065 | Enkephalins7 analogue-9 | YSA* | Synthetic Peptide | Apoptosis inducing | MTT/MTS assay | HT-29 | Colon cancer | 3.4% inhibition at 10-4 M |
| dbacp00066 | Enkephalins7 analogue-9 | YSA* | Synthetic Peptide | Apoptosis inducing | MTT/MTS assay | HT-29 | Colon cancer | 20.8% inhibition at 10-3 M |
| dbacp00090 | Enkephalins7 analogue-10 | YSA* | Synthetic Peptide | Apoptosis inducing | MTT/MTS assay | HT-29 | Colon cancer | 0.7% inhibition at 10-6 M |
| dbacp00091 | Enkephalins7 analogue-10 | YSA* | Synthetic Peptide | Apoptosis inducing | MTT/MTS assay | HT-29 | Colon cancer | 8.3% inhibition at 10-5 M |
| dbacp00092 | Enkephalins7 analogue-10 | YSA* | Synthetic Peptide | Apoptosis inducing | MTT/MTS assay | HT-29 | Colon cancer | 10.5% inhibition at 10-4 M |
| dbacp00093 | Enkephalins7 analogue-10 | YSA* | Synthetic Peptide | Apoptosis inducing | MTT/MTS assay | HT-29 | Colon cancer | 21.8% inhibition at 10-3 M |
| dbacp00137 | Enkephalins7 analogue-15 | YSA*G | Synthetic Peptide | Apoptosis inducing | MTT/MTS assay | HT-29 | Colon cancer | 5.4% inhibition at 10-6 M |
| dbacp00138 | Enkephalins7 analogue-15 | YSA*G | Synthetic Peptide | Apoptosis inducing | MTT/MTS assay | HT-29 | Colon cancer | 7.4% inhibition at 10-5 M |
| dbacp00139 | Enkephalins7 analogue-15 | YSA*G | Synthetic Peptide | Apoptosis inducing | MTT/MTS assay | HT-29 | Colon cancer | 9.5% inhibition at 10-4 M |
| dbacp00140 | Enkephalins7 analogue-15 | YSA*G | Synthetic Peptide | Apoptosis inducing | MTT/MTS assay | HT-29 | Colon cancer | 15.7% inhibition at 10-3 M |
| dbacp00170 | Enkephalins7 analogue-16 | YRA*G | Synthetic Peptide | Apoptosis inducing | MTT/MTS assay | HT-29 | Colon cancer | 7.6% inhibition at 10-6 M |
| dbacp00171 | Enkephalins7 analogue-16 | YRA*G | Synthetic Peptide | Apoptosis inducing | MTT/MTS assay | HT-29 | Colon cancer | 3.8% inhibition at 10-5 M |
| dbacp00172 | Enkephalins7 analogue-16 | YRA*G | Synthetic Peptide | Apoptosis inducing | MTT/MTS assay | HT-29 | Colon cancer | 12.4% inhibition at 10-4 M |
| dbacp00173 | Enkephalins7 analogue-16 | YRA*G | Synthetic Peptide | Apoptosis inducing | MTT/MTS assay | HT-29 | Colon cancer | 22.4% inhibition at 10-3 M |
| dbacp00204 | Enkephalins7 analogue-17 | YA*GFM | Synthetic Peptide | Apoptosis inducing | MTT/MTS assay | HT-29 | Colon cancer | 3.3% inhibition at 10-6 M |
| dbacp00205 | Enkephalins7 analogue-17 | YA*GFM | Synthetic Peptide | Apoptosis inducing | MTT/MTS assay | HT-29 | Colon cancer | 11.0% inhibition at 10-5M |
| dbacp00206 | Enkephalins7 analogue-17 | YA*GFM | Synthetic Peptide | Apoptosis inducing | MTT/MTS assay | HT-29 | Colon cancer | 7.9% inhibition at 10-4 M |
| dbacp00207 | Enkephalins7 analogue-17 | YA*GFM | Synthetic Peptide | Apoptosis inducing | MTT/MTS assay | HT-29 | Colon cancer | 23.7% inhibition at 10-3 M |
| dbacp00238 | Enkephalins7 analogue-18 | YA*GFM | Synthetic Peptide | Apoptosis inducing | MTT/MTS assay | HT-29 | Colon cancer | 16.2% inhibition at 10-6 M |
| dbacp00239 | Enkephalins7 analogue-18 | YA*GFM | Synthetic Peptide | Apoptosis inducing | MTT/MTS assay | HT-29 | Colon cancer | 6.6% inhibition at 10-5 M |
| dbacp00240 | Enkephalins7 analogue-18 | YA*GFM | Synthetic Peptide | Apoptosis inducing | MTT/MTS assay | HT-29 | Colon cancer | 5.1% inhibition at 10-4 M |
| dbacp00241 | Enkephalins7 analogue-18 | YA*GFM | Synthetic Peptide | Apoptosis inducing | MTT/MTS assay | HT-29 | Colon cancer | 14.5% inhibition at 10-3 M |
| dbacp00285 | Enkephalins7 analogue-23 | YGGFMA* | Synthetic Peptide | Apoptosis inducing | MTT/MTS assay | HT-29 | Colon cancer | 9.2% inhibition at 10-3 M |
| dbacp00321 | [A18K]OCN-3N | GIFDVLKNLAKGVITSLKS | Derivatives of ocellatin-3N | Membranolytic mechanism | Not specified | HT-29 | Colorectal adenocarcinoma | LC50 : 12-20 μM |
| dbacp00435 | [D4K,A18K]OCN-3N | GIFKVLKNLAKGVITSLKS | Derivatives of ocellatin-3N | Membranolytic mechanism | Not specified | HT-29 | Colorectal adenocarcinoma | LC50 : 12-20 μM |
| dbacp00438 | [D4K]OCN-3N | GIFKVLKNLAKGVITSLAS | Derivatives of ocellatin-3N | Not specified | Lactate dehydrogenase (LDH) assay | HT-29 | Colorectal adenocarcinoma | LC50 : 12-20 μM |
| dbacp00769 | A specific Eps8/EGFR Inhibitor Peptide 327 | EFLDCFQKF | A specific Eps8/EGFR Inhibitor Peptide 327 | Immune response to tumor cell recognition | Lactate dehydrogenase (LDH)-release assay | HT-29 | Colorectal adenocarcinoma | IC50 : 96.00 ± 9.06 μM |
| dbacp01008 | Alyteserin-2 | ILGKLLSTAAGLLSNL | Common midwife toad | Cell penetration | Cytotoxicity assay | HT29 | Colorectal adenocarcinoma | LC50 : 28 µM |
| dbacp01349 | Aurein-2.7 | GLFDIAKKVIGVIGSL | Southern bell frog | Cell membrane disintegration | One-dose and five-dose assay | HT29 | Colon cancer | IC50 : 4-5 μM |
| dbacp01965 | Brevinin-2R | KLKNFAKGVAQSLLNKASCKLSGQC | Skin, Marsh frog, Europe | Activates the lysosomal-mitochondrial death pathway; Involves autophagy-like cell death | MTT-assay | HT29/219 | Colon carcinoma | LD50 : 10 – 15 μg/ml |
| dbacp01966 | Brevinin-2R | KLKNFAKGVAQSLLNKASCKLSGQC | Skin, Marsh frog, Europe | Activates the lysosomal-mitochondrial death pathway; Involves autophagy-like cell death | MTT-assay | HT29/219 | Colon carcinoma | LD50 : 20 – 25 μg/ml |
| dbacp01967 | Brevinin-2R | KLKNFAKGVAQSLLNKASCKLSGQC | Skin, Marsh frog, Europe | Activates the lysosomal-mitochondrial death pathway; Involves autophagy-like cell death | MTT-assay | HT29/219 | Colon carcinoma | LD50 : 30 – 40 μg/ml |
| dbacp02042 | Buforin IIb | RAGLQFPVGRLLRRLLRRLLR | Histone H2A | Inducing mitochondria-dependent apoptosis | MTT/MTS assay | HT-29 | Colon cancer | IC50 : 17.6 µg/ml |
| dbacp02099 | Buforin Iib | RAGLQFPVGRLLRRLLRRLLR | Not found | Inducing apoptosis | MTT/MTS assay | HT-29 | Not specified | IC50 : 13.2 µg/ml |
| dbacp02367 | Cecropin B | KWKVFKKIEKMGRNIRNGIVKAGPAIAVLGEAKAL | Silkmoth | Pore formation at the cytoplasmic membrane | MTT/MTS assay | HT-29 | Colon cancer | IC50 : >100 µM |
| dbacp02483 | Chrysophsin-1 | FFGWLIKGAIHAGKAIHGLI | The pyloric caeca and gills; Red sea bream | Disruption of cancer cell membranes; Apoptosis | MTS assay, Lactate dehydrogenase (LDH) detection assay | HT-1080 | Human fibrosarcoma | MIC : 7 µg/ml |
| dbacp02657 | Dermaseptin-B2 | GLWSKIKEVGKEAAKAAAKAAGKAALGAVSEAV | Giant leaf frog | Immunomodulatory properties | Cytotoxicity assays, Cell Titer-Glo Luminescent Cell viability assay | HT-29 | Colorectal adenocarcinoma | LC50 : < 12 μM |
| dbacp02803 | Dolastatin 10 | 2-[[2-(dimethylamino)-3-methylbutanoyl]amino]-N-[3-methoxy-1-[2-[1-methoxy-2-methyl-3-oxo-3-[[2-phenyl-1-(1,3-thiazol-2-yl)ethyl]amino]propyl]pyrrolidin-1-yl]-5-methyl-1-oxoheptan-4-yl]-N,3-dimethylbutaNAmide | Wedge sea hare | Apoptosis inducing | Cell viability assay | HT | Lymphoma cancer | IC50 : 0.0013 - 0.013 nM |
| dbacp02807 | Dolastatin 15 | VV-nMe-VPP-2hydroxyisovaleryl-2-oxo-4-methoxy-5-benzyl-3-pyrroline | Wedge sea hare | Apoptosis inducing | Cell viability assay | HT | Lymphoma cancer | IC50 : 0.0013 - 0.013 nM |
| dbacp02851 | Epinecidin-1 | GFIFHIIKGLFHAGKMIHGLV | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HT-1080 | Fibrosarcoma | 82 % Cytotoxicity at 50 mg/L |
| dbacp02852 | Epinecidin-1 | GFIFHIIKGLFHAGKMIHGLV | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HT-1080 | Fibrosarcoma | 85 % Cytotoxicity at 25 mg/L |
| dbacp02853 | Epinecidin-1 | GFIFHIIKGLFHAGKMIHGLV | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HT-1080 | Fibrosarcoma | 42 % Cytotoxicity at 12.5 mg/L |
| dbacp02854 | Epinecidin-1 | GFIFHIIKGLFHAGKMIHGLV | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HT-1080 | Fibrosarcoma | 41 % Cytotoxicity at 6.25 mg/L |
| dbacp02855 | Epinecidin-1 | GFIFHIIKGLFHAGKMIHGLV | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HT-1080 | Fibrosarcoma | 39 % Cytotoxicity at 3.125 mg/L |
| dbacp02856 | Epinecidin-1 | GFIFHIIKGLFHAGKMIHGLV | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HT-1080 | Fibrosarcoma | 90 % Cytotoxicity at 50 mg/L |
| dbacp02857 | Epinecidin-1 | GFIFHIIKGLFHAGKMIHGLV | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HT-1080 | Fibrosarcoma | 95 % Cytotoxicity at 25 mg/L |
| dbacp02858 | Epinecidin-1 | GFIFHIIKGLFHAGKMIHGLV | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HT-1080 | Fibrosarcoma | 45 % Cytotoxicity at 12.5 mg/L |
| dbacp02859 | Epinecidin-1 | GFIFHIIKGLFHAGKMIHGLV | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HT-1080 | Fibrosarcoma | 25 % Cytotoxicity at 6.25 mg/L |
| dbacp02860 | Epinecidin-1 | GFIFHIIKGLFHAGKMIHGLV | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HT-1080 | Fibrosarcoma | 25 % Cytotoxicity at 3.125 mg/L |
| dbacp02861 | Epinecidin-1 | GFIFHIIKGLFHAGKMIHGLV | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HT-1080 | Fibrosarcoma | 95 % Cytotoxicity at 50 mg/L |
| dbacp02862 | Epinecidin-1 | GFIFHIIKGLFHAGKMIHGLV | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HT-1080 | Fibrosarcoma | 96 % Cytotoxicity at 25 mg/L |
| dbacp02863 | Epinecidin-1 | GFIFHIIKGLFHAGKMIHGLV | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HT-1080 | Fibrosarcoma | 46 % Cytotoxicity at 12.5 mg/L |
| dbacp02864 | Epinecidin-1 | GFIFHIIKGLFHAGKMIHGLV | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HT-1080 | Fibrosarcoma | 30 % Cytotoxicity at 6.25 mg/L |
| dbacp02865 | Epinecidin-1 | GFIFHIIKGLFHAGKMIHGLV | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HT-1080 | Fibrosarcoma | 28 % Cytotoxicity at 3.125 mg/L |
| dbacp02866 | Epinecidin-1 | GFIFHIIKGLFHAGKMIHGLV | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HT-1080 | Fibrosarcoma | 84 % Cytotoxicity at 50 mg/L |
| dbacp02867 | Epinecidin-1 | GFIFHIIKGLFHAGKMIHGLV | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HT-1080 | Fibrosarcoma | 85 % Cytotoxicity at 25 mg/L |
| dbacp02868 | Epinecidin-1 | GFIFHIIKGLFHAGKMIHGLV | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HT-1080 | Fibrosarcoma | 38 % Cytotoxicity at 12.5 mg/L |
| dbacp02869 | Epinecidin-1 | GFIFHIIKGLFHAGKMIHGLV | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HT-1080 | Fibrosarcoma | 30 % Cytotoxicity at 6.25 mg/L |
| dbacp02870 | Epinecidin-1 | GFIFHIIKGLFHAGKMIHGLV | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HT-1080 | Fibrosarcoma | 28 % Cytotoxicity at 3.125 mg/L |
| dbacp02894 | Epinecidin-8 | FIFHIIKGLFHAGKMI | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HT-1080 | Fibrosarcoma | 60 % Cytotoxicity at 50 mg/L |
| dbacp02895 | Epinecidin-8 | FIFHIIKGLFHAGKMI | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HT-1080 | Fibrosarcoma | 50 % Cytotoxicity at 25 mg/L |
| dbacp02896 | Epinecidin-8 | FIFHIIKGLFHAGKMI | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HT-1080 | Fibrosarcoma | 8 % Cytotoxicity at 12.5 mg/L |
| dbacp02897 | Epinecidin-8 | FIFHIIKGLFHAGKMI | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HT-1080 | Fibrosarcoma | 10 % Cytotoxicity at 6.25 mg/L |
| dbacp02898 | Epinecidin-8 | FIFHIIKGLFHAGKMI | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HT-1080 | Fibrosarcoma | 5 % Cytotoxicity at 3.125 mg/L |
| dbacp02899 | Epinecidin-8 | FIFHIIKGLFHAGKMI | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HT-1080 | Fibrosarcoma | 75 % Cytotoxicity at 50 mg/L |
| dbacp02900 | Epinecidin-8 | FIFHIIKGLFHAGKMI | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HT-1080 | Fibrosarcoma | 70 % Cytotoxicity at 25 mg/L |
| dbacp02901 | Epinecidin-8 | FIFHIIKGLFHAGKMI | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HT-1080 | Fibrosarcoma | 5 %Cytotoxicity at 12.5 mg/L |
| dbacp02902 | Epinecidin-8 | FIFHIIKGLFHAGKMI | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HT-1080 | Fibrosarcoma | 7 % Cytotoxicity at 6.25 mg/L |
| dbacp02903 | Epinecidin-8 | FIFHIIKGLFHAGKMI | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HT-1080 | Fibrosarcoma | 10 % Cytotoxicity at 3.125 mg/L |
| dbacp02904 | Epinecidin-8 | FIFHIIKGLFHAGKMI | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HT-1080 | Fibrosarcoma | 76 % Cytotoxicity at 50 mg/L |
| dbacp02905 | Epinecidin-8 | FIFHIIKGLFHAGKMI | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HT-1080 | Fibrosarcoma | 70 % Cytotoxicity at 25 mg/L |
| dbacp02906 | Epinecidin-8 | FIFHIIKGLFHAGKMI | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HT-1080 | Fibrosarcoma | 12 % Cytotoxicity at 12.5 mg/L |
| dbacp02907 | Epinecidin-8 | FIFHIIKGLFHAGKMI | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HT-1080 | Fibrosarcoma | 4 % Cytotoxicity at 6.25 mg/L |
| dbacp02908 | Epinecidin-8 | FIFHIIKGLFHAGKMI | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HT-1080 | Fibrosarcoma | 4 % Cytotoxicity at 3.125 mg/L |
| dbacp02909 | Epinecidin-8 | FIFHIIKGLFHAGKMI | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HT-1080 | Fibrosarcoma | 90 % Cytotoxicity at 50 mg/L |
| dbacp02910 | Epinecidin-8 | FIFHIIKGLFHAGKMI | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HT-1080 | Fibrosarcoma | 75 % Cytotoxicity at 25 mg/L |
| dbacp02911 | Epinecidin-8 | FIFHIIKGLFHAGKMI | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HT-1080 | Fibrosarcoma | 8 % Cytotoxicity at 12.5 mg/L |
| dbacp02912 | Epinecidin-8 | FIFHIIKGLFHAGKMI | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HT-1080 | Fibrosarcoma | 3 % Cytotoxicity at 6.25 mg/L |
| dbacp02913 | Epinecidin-8 | FIFHIIKGLFHAGKMI | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HT-1080 | Fibrosarcoma | 3 % Cytotoxicity at 3.125 mg/L |
| dbacp02957 | Figainin 2BN | FLGVALKLGKVLGKALLPLASSLLHSQ | Norepinephrine-stimulated skin secretion, the Giant Gladiator Treefrog, the Rusty Treefrog, Trinidad, South America | Cell membrane penetration | Not specified | HT-29 | Colon adenocarcinoma | LC50 : 7-14 µM |
| dbacp02960 | Figainin 2PL | FLGTVLKLGKAIAKTVVPMLTNAMQPKQ | Skin secretions, the bananatree dwelling frog, Trinidad, South America | Membrane disruption | Not specified | HT30 | Not found | LC50 : < 30 μM |
| dbacp03351 | Hylin PL | FLGLIPALAGAIGNLIK | Skin secretions, the banana tree dwelling frog, Trinidad, South America | Membrane disruption | Not specified | HT31 | Not found | LC50 : < 30 μM |
| dbacp03354 | Hymenochirin-1B | KLSPETKDNLKKVLKGAIKGAIVAKMV | Zaire dwarf clawed frog | Membrane disruption and cell lysis | Cytotoxicity assay, Cell TiterGlo Luminescent Cell viability assay | HT-29 | Colon cancer | LC50 : 9.7 ± 0.2 μM |
| dbacp03530 | KW5 | KAAKKAAKAAKKAAKAAKKAA | Synthetic peptide | Through interactions with the plasma membrane | MTT/MTS assay | HT-29 | Colon cancer | IC50 : 55 ± 14 µM |
| dbacp03551 | L1 | PEWFKCRRWQWRMKKLGA | Lactoferrin | Cell membrane disintegration | MTT/MTS assay | HT-29 | Colon cancer | IC50 : > 404 µM |
| dbacp03554 | L10 | PAARKAFRWAWRMLKKAA | Lactoferrin | Cell membrane disintegration | MTT/MTS assay | HT-29 | Colon cancer | IC50 : 35 µM |
| dbacp03557 | L11 | PAARKAARWAWRMLKKGA | Lactoferrin | Cell membrane disintegration | MTT/MTS assay | HT-29 | Colon cancer | IC50 : 248 µM |
| dbacp03560 | L12 | PAWRKAFRWAKRMLKKAA | Lactoferrin | Cell membrane disintegration | MTT/MTS assay | HT-29 | Colon cancer | IC50 : 25 µM |
| dbacp03563 | L13 | PAWRKAFRKAWRMLKKAA | Lactoferrin | Cell membrane disintegration | MTT/MTS assay | HT-29 | Colon cancer | IC50 : 29 µM |
| dbacp03566 | L14 | PAWRKARRWAWRMKKLAA | Lactoferrin | Cell membrane disintegration | MTT/MTS assay | HT-29 | Colon cancer | IC50 : 423 µM |
| dbacp03569 | L15 | PAWRKARRWARRMKKLAA | Lactoferrin | Cell membrane disintegration | MTT/MTS assay | HT-29 | Colon cancer | IC50 : 178 µM |
| dbacp03588 | L2 | PAWFKARRWAWRMKKLAA | Lactoferrin | Cell membrane disintegration | MTT/MTS assay | HT-29 | Colon cancer | IC50 : >440 µM |
| dbacp03599 | L3 | PAWRKAFRWAWRMKKLAA | Lactoferrin | Cell membrane disintegration | MTT/MTS assay | HT-29 | Colon cancer | IC50 : 141 µM |
| dbacp03606 | L4 | PAWFKARRWAWRMLKKAA | Lactoferrin | Cell membrane disintegration | MTT/MTS assay | HT-29 | Colon cancer | IC50 : 57 µM |
| dbacp03609 | L5 | PAWRKAFRWAWRMLKKAA | Lactoferrin | Cell membrane disintegration | MTT/MTS assay | HT-29 | Colon cancer | IC50 : 14 µM |
| dbacp03612 | L6 | PAWRKAFRWAARMLKKAA | Lactoferrin | Cell membrane disintegration | MTT/MTS assay | HT-29 | Colon cancer | IC50 : 15 µM |
| dbacp03631 | L7 | PAWRKAFRAAWRMLKKAA | Lactoferrin | Cell membrane disintegration | MTT/MTS assay | HT-29 | Colon cancer | IC50 : 16 µM |
| dbacp03634 | L8 | PAWAKAFRAAARMKLKAA | Lactoferrin | Cell membrane disintegration | MTT/MTS assay | HT-29 | Colon cancer | IC50 : 180 µM |
| dbacp03637 | L9 | PAWRKAARWAWRMLKKAA | Lactoferrin | Cell membrane disintegration | MTT/MTS assay | HT-29 | Colon cancer | IC50 : 52 µM |
| dbacp03730 | LfcinB | FKCRRWQWRMKK | Bovine lactoferrin (Lf-B) | Cell membrane disintegration; Regulation of immune response; Apoptosis | MTT/MTS assay | HT-29 | Colon cancer | IC50 : > 160 µM |
| dbacp03734 | LfcinB | FKCRRWQWRMKK | Bovine lactoferrin (Lf-B) | Cell membrane disintegration; Regulation of immune response; Apoptosis | MTT/MTS assay | HT-29 | Colon cancer | IC50 : 148 ± 8 µM |
| dbacp03747 | LfcinB (Bovine lactoferricin) | FKCRRWQWRM | Not found | Inducing apoptosis | MTT assay | HT-29 | Leukemia | Not found |
| dbacp04296 | LTX-302 | WKKW-Dip-KKWK | Synthetic peptide | Cell membrane disintegration | MTT/MTS assay | HT-29 | Colon cancer | IC50 : 75 ± 5 µM |
| dbacp04299 | LTX-315 | KKWWKKW-Dip-K | Synthetic peptide | Cell membrane disintegration | MTT/MTS assay | HT-29 | Colon cancer | IC50 : 38 ± 3 µM |
| dbacp04305 | LTX-318 | OOW-Dip-OOWWO | Synthetic peptide | Cell membrane disintegration | MTT/MTS assay | HT-29 | Colon cancer | IC50 : 248 ± 5 µM |
| dbacp04312 | Lunasin | SKWQHQQDSCRKQLQGVNLTPCEKHIMEKIQGRGDDDDDDDDD | Soyabean | Apoptosis inducing; Anti-proliferative | MTT/MTS | HT-29 | Not specified | IC50 : 61.7 µM |
| dbacp05089 | P6 | WYIRKIRRFFKWLKKKLKKK | Marine invertebrates | Inducing apoptosis | MTT assay | HT-29 | Colorectal cancer | Not found |
| dbacp05134 | Pardaxin | GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE | Red sea moses sole | Inducing apoptosis | MTT/MTS assay | HT-1080 | Fibrosarcoma | IC50 : 15.74 µg/ml |
| dbacp05135 | Pardaxin | GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE | Red sea moses sole | Inducing apoptosis | MTT/MTS assay | HT-1080 | Fibrosarcoma | IC50 : 15.40 µg/ml |
| dbacp05136 | Pardaxin | GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE | Red sea moses sole | Inducing apoptosis | MTT/MTS assay | HT-1080 | Fibrosarcoma | IC50 : 14.51 µg/ml |
| dbacp05137 | Pardaxin | GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE | Red sea moses sole | Inducing apoptosis | MTT/MTS assay | HT-1080 | Fibrosarcoma | IC50 : 14.52 µg/ml |
| dbacp05155 | Pardaxin-1 | GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HT-1080 | Fibrosarcoma | 88 % Cytotoxicity at 50 mg/L |
| dbacp05156 | Pardaxin-1 | GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HT-1080 | Fibrosarcoma | 82 % Cytotoxicity at 25 mg/L |
| dbacp05157 | Pardaxin-1 | GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HT-1080 | Fibrosarcoma | 40 % Cytotoxicity at 12.5 mg/L |
| dbacp05158 | Pardaxin-1 | GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HT-1080 | Fibrosarcoma | 35 % Cytotoxicity at 6.25 mg/L |
| dbacp05159 | Pardaxin-1 | GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HT-1080 | Fibrosarcoma | 35 % Cytotoxicity at 3.125 mg/L |
| dbacp05160 | Pardaxin-1 | GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HT-1080 | Fibrosarcoma | 90 % Cytotoxicity at 50 mg/L |
| dbacp05161 | Pardaxin-1 | GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HT-1080 | Fibrosarcoma | 90 % Cytotoxicity at 25 mg/L |
| dbacp05162 | Pardaxin-1 | GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HT-1080 | Fibrosarcoma | 30 % Cytotoxicity at 12.5 mg/L |
| dbacp05163 | Pardaxin-1 | GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HT-1080 | Fibrosarcoma | 30 % Cytotoxicity at 6.25 mg/L |
| dbacp05164 | Pardaxin-1 | GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HT-1080 | Fibrosarcoma | 30 % Cytotoxicity at 3.125 mg/L |
| dbacp05165 | Pardaxin-1 | GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HT-1080 | Fibrosarcoma | 97 % Cytotoxicity at 50 mg/L |
| dbacp05166 | Pardaxin-1 | GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HT-1080 | Fibrosarcoma | 95 % Cytotoxicity at 25 mg/L |
| dbacp05167 | Pardaxin-1 | GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HT-1080 | Fibrosarcoma | 39 % Cytotoxicity at 12.5 mg/L |
| dbacp05168 | Pardaxin-1 | GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HT-1080 | Fibrosarcoma | 28 % Cytotoxicity at 6.25 mg/L |
| dbacp05169 | Pardaxin-1 | GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HT-1080 | Fibrosarcoma | 38 % Cytotoxicity at 3.125 mg/L |
| dbacp05170 | Pardaxin-1 | GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HT-1080 | Fibrosarcoma | 90 % Cytotoxicity at 50 mg/L |
| dbacp05171 | Pardaxin-1 | GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HT-1080 | Fibrosarcoma | 90 % Cytotoxicity at 25 mg/L |
| dbacp05172 | Pardaxin-1 | GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HT-1080 | Fibrosarcoma | 15 % Cytotoxicity at 12.5 mg/L |
| dbacp05173 | Pardaxin-1 | GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HT-1080 | Fibrosarcoma | 5 % Cytotoxicity at 6.25 mg/L |
| dbacp05174 | Pardaxin-1 | GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HT-1080 | Fibrosarcoma | 10 % Cytotoxicity at 3.125 mg/L |
| dbacp05195 | Pardaxin-6 | GFFALIPKIISSPLFKTLLSAVGSALS | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HT-1080 | Fibrosarcoma | 80 % Cytotoxicity at 50 mg/L |
| dbacp05196 | Pardaxin-6 | GFFALIPKIISSPLFKTLLSAVGSALS | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HT-1080 | Fibrosarcoma | 85 % Cytotoxicity at 25 mg/L |
| dbacp05197 | Pardaxin-6 | GFFALIPKIISSPLFKTLLSAVGSALS | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HT-1080 | Fibrosarcoma | 45 % Cytotoxicity at 12.5 mg/L |
| dbacp05198 | Pardaxin-6 | GFFALIPKIISSPLFKTLLSAVGSALS | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HT-1080 | Fibrosarcoma | 30 % Cytotoxicity at 6.25 mg/L |
| dbacp05199 | Pardaxin-6 | GFFALIPKIISSPLFKTLLSAVGSALS | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HT-1080 | Fibrosarcoma | 25 % Cytotoxicity at 3.125 mg/L |
| dbacp05200 | Pardaxin-6 | GFFALIPKIISSPLFKTLLSAVGSALS | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HT-1080 | Fibrosarcoma | 84 % Cytotoxicity at 50 mg/L |
| dbacp05201 | Pardaxin-6 | GFFALIPKIISSPLFKTLLSAVGSALS | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HT-1080 | Fibrosarcoma | 84% Cytotoxicity at 25 mg/L |
| dbacp05202 | Pardaxin-6 | GFFALIPKIISSPLFKTLLSAVGSALS | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HT-1080 | Fibrosarcoma | 48 % Cytotoxicity at 12.5 mg/L |
| dbacp05203 | Pardaxin-6 | GFFALIPKIISSPLFKTLLSAVGSALS | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HT-1080 | Fibrosarcoma | 30 % Cytotoxicity at 6.25 mg/L |
| dbacp05204 | Pardaxin-6 | GFFALIPKIISSPLFKTLLSAVGSALS | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HT-1080 | Fibrosarcoma | 35 % Cytotoxicity at 3.125 mg/L |
| dbacp05205 | Pardaxin-6 | GFFALIPKIISSPLFKTLLSAVGSALS | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HT-1080 | Fibrosarcoma | 90 % Cytotoxicity at 50 mg/L |
| dbacp05206 | Pardaxin-6 | GFFALIPKIISSPLFKTLLSAVGSALS | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HT-1080 | Fibrosarcoma | 85 % Cytotoxicity at 25 mg/L |
| dbacp05207 | Pardaxin-6 | GFFALIPKIISSPLFKTLLSAVGSALS | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HT-1080 | Fibrosarcoma | 30 % Cytotoxicity at 12.5 mg/L |
| dbacp05208 | Pardaxin-6 | GFFALIPKIISSPLFKTLLSAVGSALS | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HT-1080 | Fibrosarcoma | 35 % Cytotoxicity at 6.25 mg/L |
| dbacp05209 | Pardaxin-6 | GFFALIPKIISSPLFKTLLSAVGSALS | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HT-1080 | Fibrosarcoma | 15 % Cytotoxicity at 3.125 mg/L |
| dbacp05210 | Pardaxin-6 | GFFALIPKIISSPLFKTLLSAVGSALS | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HT-1080 | Fibrosarcoma | 90 % Cytotoxicity at 50 mg/L |
| dbacp05211 | Pardaxin-6 | GFFALIPKIISSPLFKTLLSAVGSALS | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HT-1080 | Fibrosarcoma | 90 % Cytotoxicity at 25 mg/L |
| dbacp05212 | Pardaxin-6 | GFFALIPKIISSPLFKTLLSAVGSALS | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HT-1080 | Fibrosarcoma | 20 % Cytotoxicity at 12.5 mg/L |
| dbacp05213 | Pardaxin-6 | GFFALIPKIISSPLFKTLLSAVGSALS | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HT-1080 | Fibrosarcoma | 1 % Cytotoxicity at 6.25 mg/L |
| dbacp05214 | Pardaxin-6 | GFFALIPKIISSPLFKTLLSAVGSALS | Brown-lined reefcod | Inducing membrane permeabilization | MTT/MTS assay | HT-1080 | Fibrosarcoma | 10 % Cytotoxicity at 3.125 mg/L |
| dbacp05510 | Phylloseptin-1.1TR (PLS-1.1TR) | FLSLIPKIAGGIASLVKNL | Trinidad leaf frog | Cytotoxic | Cell viability assay | HT‐29 | Not found | LC50 : 34 μM |
| dbacp05513 | Phylloseptin-1.2TR (PLS-1.2TR) (Phylloseptin-1.3TR) | FLSLIPKIAGGIASLVKDL | Trinidad leaf frog | Cytotoxic | Cell viability assay | HT‐29 | Not found | Not found |
| dbacp05516 | Phylloseptin-2.1TR (PLS-2.1TR) (Phylloseptin-2.2TR) | FLSLIPHIATGIAALAKHL | Trinidad leaf frog | Cytotoxic | Cell viability assay | HT‐29 | Not found | LC50 : 38 μM |
| dbacp05519 | Phylloseptin-3.1TR (PLS-3.1TR) (Phylloseptin-3.3TR) | FFSMIPKIATGIASLVKNL | Trinidad leaf frog | Cytotoxic | Cell viability assay | HT‐29 | Not found | LC50 : 27 μmolL−1 |
| dbacp05522 | Phylloseptin-3.2TR (PLS-3.2TR) | FFSMIPKIATGIASLVKDL | Trinidad leaf frog | Cytotoxic | Cell viability assay | HT‐29 | Not found | Not found |
| dbacp05557 | Picturin 1BN | GIFKDTLKKVVAAVLTTVADNIHPK | Norepinephrine-stimulated skin secretion, the Giant Gladiator Treefrog, the Rusty Treefrog, Trinidad, South America | Cell membrane penetration | Not specified | HT-29 | Colon adenocarcinoma | LC50 : 7 - 14 µM |
| dbacp05560 | Picturin 2BN | GLMDMLKKVGKVALTVAKSALLP | Norepinephrine-stimulated skin secretion, the Giant Gladiator Treefrog, the Rusty Treefrog, Trinidad, South America | Cell membrane penetration | Not specified | HT-29 | Colon adenocarcinoma | LC50 : 7 - 14 µM |
| dbacp05567 | Piscidin-1 | FFHHIFRGIVHVGKTIHRLVTG | Striped bass x White bass | Induce apoptosis; Necrotic activity | MTS assay and soft-agar colony-formation assay | HT1080 | Not specified | MIC : 20 μg/ml |
| dbacp05662 | Protein GPR15LG (Antimicrobial peptide with 57 amino acid residues) (AP-57) (Antimicrobial peptide-57) (Colon-derived SUSD2 binding factor) (CSBF) (Protein GPR15 ligand) (Protein GPR15L) (Secreted protein C10orf99) | MRLLVLSSLLCILLLCFSIFSTEGKRRPAKAWSGRRTRLCCHRVPSPNSTNLKGHHVRLCKPCKLEPEPRLWVVPGALPQV | Human | Cytotoxic effects | SDS-PAGE assay | HT-29 | Colorectal cancer | Not found |
| dbacp05678 | Ps-1Pb | IKIPSFFRNILKKVGKEAVSLIAGALKQS | Merlin's dwarf gray frog | Immunomodulatory properties | Cytotoxicity assays, CellTiter-Glo Luminescent cell viability assay | HT-29 | Colorectal adenocarcinoma | LC50 : < 12 μM |
| dbacp05681 | Ps-2Pa | GIFPIFAKLLGKVIKVASSLISKGRTE | Merlin's dwarf gray frog | Immunomodulatory properties | Cytotoxicity assays, CellTiter-Glo Luminescent cell viability assay | HT-29 | Colorectal adenocarcinoma | LC50 : < 12 μM |
| dbacp05916 | Raniseptin PL | GVFDTVKKIGKAVGKFALGVAKNYLNS | Skin secretions, the banana tree dwelling frog, Trinidad, South America | Membrane disruption | Not specified | HT29 | Not found | LC50 : < 30 μM |
| dbacp06024 | SCAP1 | LANAK | Marine invertebrates | Inducing apoptosis | Not specified | HT-29 | Not specified | IC50 : 90.31 ± 0.45 μM |
| dbacp06025 | SCAP1 | LANAK | Marine invertebrates | Inducing apoptosis | Not specified | HT-29 | Not specified | IC50 : 70.87 ± 0.82 μM |
| dbacp06026 | SCAP1 | LANAK | Marine invertebrates | Inducing apoptosis | Not specified | HT-29 | Not specified | IC50 : 60.21 ± 0.45 μM |
| dbacp06145 | Ss-arasin | MERTLLIVLLVCFLLLAVTAEA | The Indian mud crab | Membrane disruption by pore-formation or by permeating the membrane and acting on intracellular targets | MTT assay | HT-29 | Colon carcinoma | IC 50 : 2.90 μM |
| dbacp06146 | Ss-arasin | SPRVRRRYGRPFGGRPFVGGQFGGRPGCVCIRSPCPCANYG | The Indian mud crab | Membrane disruption by pore-formation or by permeating the membrane and acting on intracellular targets | MTT assay | HT-29 | Human cervical carcinoma | IC 50 : 2.90 μM |
| dbacp06189 | T Peptide | TKPRKTKPRKTKPRKTKPR | Tuftsin derivative | Immune regulation | MTT/MTS assay | HT-29 | Colon cancer | 70% maximum inhibitory rate at 8 mg/kg |
| dbacp06550 | Z1 | KAAKKWAKAAKKWAKAWKKAA | Synthetic | Disruption of cell membrane | MTT/MTS assay | HT-29 | Colon cancer | EC50 : > 211 µM |
| dbacp06553 | Z10 | AAKKWAKAKWAKAKKWAKAA | Synthetic | Disruption of cell membrane | MTT/MTS assay | HT-29 | Colon cancer | EC50 : > 211 µM |
| dbacp06556 | Z2 | KAAKKWAKAWKKAAKAWKKAA | Synthetic | Disruption of cell membrane | MTT/MTS assay | HT-29 | Colon cancer | EC50 : > 211 µM |
| dbacp06569 | Z3 | KAAKKAWKAWKKAAKAAWKKAA | Synthetic | Disruption of cell membrane | MTT/MTS assay | HT-29 | Colon cancer | EC50 : >211 µM |
| dbacp06572 | Z4 | KAAKKAWKAAKKAAKWWKKAA | Synthetic | Disruption of cell membrane | MTT/MTS assay | HT-29 | Colon cancer | EC50 : 173 µM |
| dbacp06585 | Z5 | KAAKKAWKWAKKAAKWAKKAA | Synthetic | Disruption of cell membrane | MTT/MTS assay | HT-29 | Colon cancer | EC50 : 67 µM |
| dbacp06588 | Z6 | KWWKKAAKAAKKAAKAAKKWA | Synthetic | Disruption of cell membrane | MTT/MTS assay | HT-29 | Colon cancer | EC50 : 31 µM |
| dbacp06591 | Z7 | KAAKKAWKAAKKAWKAAKKAA | Synthetic | Disruption of cell membrane | MTT/MTS assay | HT-29 | Colon cancer | EC50 : 21 µM |
| dbacp06594 | Z8 | AWKKWAKAWKWAKAKWWAKAA | Synthetic | Disruption of cell membrane | MTT/MTS assay | HT-29 | Colon cancer | EC50 : 23 µM |
| dbacp06597 | Z9 | AAWKWAWAKKWAKAKKWAKAA | Synthetic | Disruption of cell membrane | MTT/MTS assay | HT-29 | Colon cancer | EC50 : 13 µM |
| dbacp06657 | LfcinB (21-25)Pal | RWQWRWQWR | LfcinB | Apoptosis inducing | MTT assay | HT-29 | Colon Cancer | IC50 = 100 μM |
| dbacp06659 | Ahx-[Pal] | Ahx-RWQWRWQWR | Synthetic | Apoptosis inducing | MTT assay | HT-29 | Colon Cancer | IC50 = 119 μM |
| dbacp06661 | 9[Orn] [Pal] | RWQWRWQWO | Synthetic | Apoptosis inducing | MTT assay | HT-29 | Colon Cancer | IC50 = 109 μM |
| dbacp06738 | Aurein 1.2_mutant (Aurm) | GLFDIIKKIIKSF | Synthetic | Necrotic activity via cell membrane lysis and apoptotic activity through disrupting mitochondrial membrane | MTT assay | HT-29 | Colon Cancer | 66.10% cell viability |
| dbacp06740 | Aurein 1.2_R5 (R5-Aur) | RRRRRGLFDIIKKIAESF | Synthetic | Necrotic activity via cell membrane lysis and apoptotic activity through disrupting mitochondrial membrane | MTT assay | HT-29 | Colon Cancer | 61.56% cell viability |
| dbacp06742 | Aurein 1.2_mutant_R5 (R5-Aurm) | RRRRRGLFDIIKKIIKSF | Synthetic | Necrotic activity via cell membrane lysis and apoptotic activity through disrupting mitochondrial membrane | MTT assay | HT-29 | Colon Cancer | 54.22% cell viability |
| dbacp06759 | p28 | LSTAADMQGVVTDGMASGLDKDYLKPDD | Pseudomonas aeruginosa | Apoptosis inducing | MTT assay | HT-29 | Colon Cancer | IC50 ~ 200 μg/ml |
| dbacp06854 | WP1 | RLLRLMRLRMLLRM | Derived from RLL peptide | Apoptosis inducing | Cell Viability assay | HT-29 | Colon Cancer | IC50 = 54.6 ± 2.1 μM |
| dbacp06858 | WP2 | RLLRLLRLRRLLRL | Derived from RLL peptide | Apoptosis inducing | Cell Viability assay | HT-29 | Colon Cancer | IC50 = 42.6 ± 4.0 μM |
| dbacp06860 | ALA-A2 | KLWCKSSQVPQSR | Alpha-Lactalbumin | Not available | MTT assay | HT-29 | Colon Cancer | ~50% cell viability |
| dbacp06923 | Ocellatin-3N | GIFDVLKNLAKGVITSLAS | Leptodactylus nesiotus | Not available | CellTiter-Glo assay | HT-29 | Colorectal Cancer | LC50 = 69 ± 10 μM |
| dbacp07087 | HB43 | FAKLLAKLAKKLL | Synthetic | Motif-driven membrane insertion triggers cytotoxicity | AlamarBlue assay | HT-29 | Colon Cancer | IC50 = 11 ± 1 μM |
| dbacp07091 | HB43-mut2 | FAKLLAKLAKLLK | Synthetic | Motif-driven membrane insertion triggers cytotoxicity | AlamarBlue assay | HT-29 | Colon Cancer | IC50 = 50 ± 3 μM |
| dbacp07095 | HB43-mut3 | FAKLLAKLARRLL | Synthetic | Motif-driven membrane insertion triggers cytotoxicity | AlamarBlue assay | HT-29 | Colon Cancer | IC50 = 9 ± 1 μM |
| dbacp07365 | Piscidin 3 | FIHHIFRGIVHAGRSIGRFLTG | Morone chrysops x Morone saxatilis | Cu²⁺-mediated membrane lipid oxidation | MTT assay | HT-1080 | Fibrosarcoma | IC50 = 26.01 µM |
| dbacp07366 | Piscidin 3 | FIHHIFRGIVHAGRSIGRFLTG | Morone chrysops x Morone saxatilis | Cu²⁺-mediated membrane lipid oxidation | MTT assay | HT-1080 | Fibrosarcoma | IC50 = 5.52 µM |
| dbacp07374 | HPRP-A1 | FKKLKKLFSKLWNWK | N-terminal region of Helicobacter pylori ribosomal protein L1 | Apoptosis induction, p53-mediated cell cycle arrest | MTT assay | HT-29 | Colon Cancer | IC50 ~ 0.5 µg/mL |
| dbacp07511 | YT12 | YFYPKDFTPGCT | Arthrospira platensis | ROS scavenging induces cancer cell death | MTT assay | HT-29 | Colon Cancer | IC50 = 12.5 μM |
| dbacp07549 | Sur-X | YGRKKRRQRRRKDHRISTFKNWPFLEGCACTPERM | Synthetic | Disrupts XIAP-survivin, induces apoptosis/necroptosis | MTT assay | HT-29 | Colon Cancer | Not Available |
| dbacp07551 | NMANF2 | KAIGLVIPEIDGKLDGGAQRV | Staphylococcus hominis strain MANF2 | GAPDH-like protein disrupts survival | MTT assay | HT-29 | Colon Cancer | IC50 = 48.9 µg/mL |
| dbacp07669 | Longicalycinin A linear analogue 1 | GYPFV | Synthetic Analogue of Longicalycinin A | Cyclization enhances apoptosis via lysosomes | MTT assay | HT-29 | Colorectal Cancer | IC50 = 10.45 ± 0.0042 µg/ml |
| dbacp07671 | Longicalycinin A linear analogue 1 | GYPFV | Synthetic Analogue of Longicalycinin A | Cyclization enhances apoptosis via lysosomes | MTT assay | HT-29 | Colorectal Cancer | 83.02% Cell death at 100 µg/ml |
| dbacp07673 | Longicalycinin A Cyclic analogue 1 | GYPFV | Synthetic Analogue of Longicalycinin A | Cyclization enhances apoptosis via lysosomes | MTT assay | HT-29 | Colorectal Cancer | IC50 = 11.4 ± 0.0028 µg/ml |
| dbacp07675 | Longicalycinin A Cyclic analogue 1 | GYPFV | Synthetic Analogue of Longicalycinin A | Cyclization enhances apoptosis via lysosomes | MTT assay | HT-29 | Colorectal Cancer | 71.5% Cell death at 100 µg/ml |
| dbacp07677 | Longicalycinin A linear analogue 2 | LYPFA | Synthetic Analogue of Longicalycinin A | Cyclization enhances apoptosis via lysosomes | MTT assay | HT-29 | Colorectal Cancer | IC50 = 12.33 ± 0 µg/ml |
| dbacp07679 | Longicalycinin A linear analogue 2 | LYPFA | Synthetic Analogue of Longicalycinin A | Cyclization enhances apoptosis via lysosomes | MTT assay | HT-29 | Colorectal Cancer | 88.47% Cell death at 100 µg/ml |
| dbacp07684 | Longicalycinin A | FYPFG | Synthetic | Cyclization enhances apoptosis via lysosomes | MTT assay | HT-29 | Colorectal Cancer | IC50 = 11.87 ± 0.0021 µg/ml |
| dbacp07686 | Longicalycinin A (Linear) | FYPFG | Synthetic | Cyclization enhances apoptosis via lysosomes | MTT assay | HT-29 | Colorectal Cancer | IC50 = 9.61 ± 0.0007 µg/ml |
| dbacp07688 | Longicalycinin A linear analogue 14 | PYFFL | Synthetic Analogue of Longicalycinin A | Cyclization enhances apoptosis via lysosomes | MTT assay | HT-29 | Colorectal Cancer | IC50 = 9.12 ± 0.0042 µg/ml |
| dbacp07690 | Longicalycinin A linear analogue 14 | PYFFL | Synthetic Analogue of Longicalycinin A | Cyclization enhances apoptosis via lysosomes | MTT assay | HT-29 | Colorectal Cancer | 82.36% Cell death at 100 µg/ml |
| dbacp07692 | Longicalycinin A cyclic analogue 14 | PYFFL | Synthetic Analogue of Longicalycinin A | Cyclization enhances apoptosis via lysosomes | MTT assay | HT-29 | Colorectal Cancer | IC50 = 10.92 ± 0.0021 µg/ml |
| dbacp07694 | Longicalycinin A cyclic analogue 14 | PYFFL | Synthetic Analogue of Longicalycinin A | Cyclization enhances apoptosis via lysosomes | MTT assay | HT-29 | Colorectal Cancer | 52.38% Cell death at 100 µg/ml |
| dbacp07696 | Longicalycinin A linear analogue 3 | GYPFA | Synthetic Analogue of Longicalycinin A | Cyclization enhances apoptosis via lysosomes | MTT assay | HT-29 | Colorectal Cancer | IC50 = 11.4 ± 0 µg/ml |
| dbacp07698 | Longicalycinin A linear analogue 3 | GYPFA | Synthetic Analogue of Longicalycinin A | Cyclization enhances apoptosis via lysosomes | MTT assay | HT-29 | Colorectal Cancer | 87.56% Cell death at 100 µg/ml |
| dbacp07700 | Longicalycinin A cyclic analogue 3 | GYPFA | Synthetic Analogue of Longicalycinin A | Cyclization enhances apoptosis via lysosomes | MTT assay | HT-29 | Colorectal Cancer | IC50 = 11.28 ± 0.0063 µg/ml |
| dbacp07702 | Longicalycinin A cyclic analogue 3 | GYPFA | Synthetic Analogue of Longicalycinin A | Cyclization enhances apoptosis via lysosomes | MTT assay | HT-29 | Colorectal Cancer | 28.51% Cell death at 100 µg/ml |
| dbacp07704 | Longicalycinin A linear analogue 4 | AYPFG | Synthetic Analogue of Longicalycinin A | Cyclization enhances apoptosis via lysosomes | MTT assay | HT-29 | Colorectal Cancer | IC50 = 10.78 ± 0.0021 µg/ml |
| dbacp07706 | Longicalycinin A linear analogue 4 | AYPFG | Synthetic Analogue of Longicalycinin A | Cyclization enhances apoptosis via lysosomes | MTT assay | HT-29 | Colorectal Cancer | 75.91% Cell death at 100 µg/ml |
| dbacp07708 | Longicalycinin A cyclic analogue 4 | AYPFG | Synthetic Analogue of Longicalycinin A | Cyclization enhances apoptosis via lysosomes | MTT assay | HT-29 | Colorectal Cancer | IC50 = 11.33 ± 0.0035 µg/ml |
| dbacp07710 | Longicalycinin A cyclic analogue 4 | AYPFG | Synthetic Analogue of Longicalycinin A | Cyclization enhances apoptosis via lysosomes | MTT assay | HT-29 | Colorectal Cancer | 52.49% Cell death at 100 µg/ml |
| dbacp07712 | Longicalycinin A linear analogue 5 | FSPFG | Synthetic Analogue of Longicalycinin A | Cyclization enhances apoptosis via lysosomes | MTT assay | HT-29 | Colorectal Cancer | IC50 = 10.97 ± 0.0049 µg/ml |
| dbacp07714 | Longicalycinin A linear analogue 5 | FSPFG | Synthetic Analogue of Longicalycinin A | Cyclization enhances apoptosis via lysosomes | MTT assay | HT-29 | Colorectal Cancer | 91.52% Cell death at 100 µg/ml |
| dbacp07716 | Longicalycinin A cyclic analogue 5 | FSPFG | Synthetic Analogue of Longicalycinin A | Cyclization enhances apoptosis via lysosomes | MTT assay | HT-29 | Colorectal Cancer | IC50 = 9.98 ± 0.4256 µg/ml |
| dbacp07718 | Longicalycinin A cyclic analogue 5 | FSPFG | Synthetic Analogue of Longicalycinin A | Cyclization enhances apoptosis via lysosomes | MTT assay | HT-29 | Colorectal Cancer | 97.74% Cell death at 100 µg/ml |
| dbacp07720 | Longicalycinin A linear analogue 6 | VYPIA | Synthetic Analogue of Longicalycinin A | Cyclization enhances apoptosis via lysosomes | MTT assay | HT-29 | Colorectal Cancer | IC50 = 12.31 ± 0.0063 µg/ml |
| dbacp07722 | Longicalycinin A linear analogue 6 | VYPIA | Synthetic Analogue of Longicalycinin A | Cyclization enhances apoptosis via lysosomes | MTT assay | HT-29 | Colorectal Cancer | 49.33% Cell death at 100 µg/ml |
| dbacp07724 | Longicalycinin A cyclic analogue 6 | VYPIA | Synthetic Analogue of Longicalycinin A | Cyclization enhances apoptosis via lysosomes | MTT assay | HT-29 | Colorectal Cancer | IC50 = 10.2 ± 0.0021 µg/ml |
| dbacp07726 | Longicalycinin A cyclic analogue 6 | VYPIA | Synthetic Analogue of Longicalycinin A | Cyclization enhances apoptosis via lysosomes | MTT assay | HT-29 | Colorectal Cancer | 27.61% Cell death at 100 µg/ml |
| dbacp07728 | Longicalycinin A linear analogue 7 | PYVFA | Synthetic Analogue of Longicalycinin A | Cyclization enhances apoptosis via lysosomes | MTT assay | HT-29 | Colorectal Cancer | IC50 = 9.78 ± 0.0212 µg/ml |
| dbacp07730 | Longicalycinin A linear analogue 7 | PYVFA | Synthetic Analogue of Longicalycinin A | Cyclization enhances apoptosis via lysosomes | MTT assay | HT-29 | Colorectal Cancer | 84.17% Cell death at 100 µg/ml |
| dbacp07732 | Longicalycinin A cyclic analogue 7 | PYVFA | Synthetic Analogue of Longicalycinin A | Cyclization enhances apoptosis via lysosomes | MTT assay | HT-29 | Colorectal Cancer | IC50 = 12.11 ± 0.0035 µg/ml |
| dbacp07734 | Longicalycinin A cyclic analogue 7 | PYVFA | Synthetic Analogue of Longicalycinin A | Cyclization enhances apoptosis via lysosomes | MTT assay | HT-29 | Colorectal Cancer | 22.86% Cell death at 100 µg/ml |
| dbacp07736 | Longicalycinin A linear analogue 8 | FYPVG | Synthetic Analogue of Longicalycinin A | Cyclization enhances apoptosis via lysosomes | MTT assay | HT-29 | Colorectal Cancer | IC50 = 12.88 ± 0.0014 µg/ml |
| dbacp07738 | Longicalycinin A linear analogue 8 | FYPVG | Synthetic Analogue of Longicalycinin A | Cyclization enhances apoptosis via lysosomes | MTT assay | HT-29 | Colorectal Cancer | 88.01% Cell death at 100 µg/ml |
| dbacp07740 | Longicalycinin A cyclic analogue 8 | FYPVG | Synthetic Analogue of Longicalycinin A | Cyclization enhances apoptosis via lysosomes | MTT assay | HT-29 | Colorectal Cancer | IC50 = 12.67 ± 0.0028 µg/ml |
| dbacp07742 | Longicalycinin A cyclic analogue 8 | FYPVG | Synthetic Analogue of Longicalycinin A | Cyclization enhances apoptosis via lysosomes | MTT assay | HT-29 | Colorectal Cancer | 29.87% Cell death at 100 µg/ml |
| dbacp07744 | Longicalycinin A linear analogue 9 | FYPFV | Synthetic Analogue of Longicalycinin A | Cyclization enhances apoptosis via lysosomes | MTT assay | HT-29 | Colorectal Cancer | IC50 = 10.44 ± 0.5536 µg/ml |
| dbacp07746 | Longicalycinin A linear analogue 9 | FYPFV | Synthetic Analogue of Longicalycinin A | Cyclization enhances apoptosis via lysosomes | MTT assay | HT-29 | Colorectal Cancer | 1.59% Cell death at 100 µg/ml |
| dbacp07748 | Longicalycinin A cyclic analogue 9 | FYPFV | Synthetic Analogue of Longicalycinin A | Cyclization enhances apoptosis via lysosomes | MTT assay | HT-29 | Colorectal Cancer | IC50 = 10.7 ± 0.0056 µg/ml |
| dbacp07750 | Longicalycinin A cyclic analogue 9 | FYPFV | Synthetic Analogue of Longicalycinin A | Cyclization enhances apoptosis via lysosomes | MTT assay | HT-29 | Colorectal Cancer | 76.25% Cell death at 100 µg/ml |
| dbacp07752 | Longicalycinin A linear analogue 10 | FYPFA | Synthetic Analogue of Longicalycinin A | Cyclization enhances apoptosis via lysosomes | MTT assay | HT-29 | Colorectal Cancer | IC50 = 10.5 ± 0.0007 µg/ml |
| dbacp07754 | Longicalycinin A linear analogue 10 | FYPFA | Synthetic Analogue of Longicalycinin A | Cyclization enhances apoptosis via lysosomes | MTT assay | HT-29 | Colorectal Cancer | 92.09% Cell death at 100 µg/ml |
| dbacp07756 | Longicalycinin A cyclic analogue 10 | FYPFA | Synthetic Analogue of Longicalycinin A | Cyclization enhances apoptosis via lysosomes | MTT assay | HT-29 | Colorectal Cancer | IC50 = 11.56 ± 0.0028 µg/ml |
| dbacp07758 | Longicalycinin A cyclic analogue 10 | FYPFA | Synthetic Analogue of Longicalycinin A | Cyclization enhances apoptosis via lysosomes | MTT assay | HT-29 | Colorectal Cancer | 71.27% Cell death at 100 µg/ml |
| dbacp07760 | Longicalycinin A linear analogue 11 | TVPFA | Synthetic Analogue of Longicalycinin A | Cyclization enhances apoptosis via lysosomes | MTT assay | HT-29 | Colorectal Cancer | IC50 = 11.67 ± 0.0014 µg/ml |
| dbacp07762 | Longicalycinin A linear analogue 11 | TVPFA | Synthetic Analogue of Longicalycinin A | Cyclization enhances apoptosis via lysosomes | MTT assay | HT-29 | Colorectal Cancer | 88.47% Cell death at 100 µg/ml |
| dbacp07764 | Longicalycinin A cyclic analogue 11 | TVPFA | Synthetic Analogue of Longicalycinin A | Cyclization enhances apoptosis via lysosomes | MTT assay | HT-29 | Colorectal Cancer | IC50 = 10.61 ± 0.0007 µg/ml |
| dbacp07766 | Longicalycinin A cyclic analogue 11 | TVPFA | Synthetic Analogue of Longicalycinin A | Cyclization enhances apoptosis via lysosomes | MTT assay | HT-29 | Colorectal Cancer | 74.89% Cell death at 100 µg/ml |
| dbacp07768 | Longicalycinin A linear analogue 12 | FYPFI | Synthetic Analogue of Longicalycinin A | Cyclization enhances apoptosis via lysosomes | MTT assay | HT-29 | Colorectal Cancer | IC50 = 14.2 ± 0.0014 µg/ml |
| dbacp07770 | Longicalycinin A linear analogue 12 | FYPFI | Synthetic Analogue of Longicalycinin A | Cyclization enhances apoptosis via lysosomes | MTT assay | HT-29 | Colorectal Cancer | 81.34% Cell death at 100 µg/ml |
| dbacp07772 | Longicalycinin A cyclic analogue 12 | FYPFI | Synthetic Analogue of Longicalycinin A | Cyclization enhances apoptosis via lysosomes | MTT assay | HT-29 | Colorectal Cancer | IC50 = 13.2 ± 0 µg/ml |
| dbacp07774 | Longicalycinin A cyclic analogue 12 | FYPFI | Synthetic Analogue of Longicalycinin A | Cyclization enhances apoptosis via lysosomes | MTT assay | HT-29 | Colorectal Cancer | 52.72% Cell death at 100 µg/ml |
| dbacp07776 | Longicalycinin A cyclic analogue 15 | PYGFV | Synthetic Analogue of Longicalycinin A | Cyclization enhances apoptosis via lysosomes | MTT assay | HT-29 | Colorectal Cancer | IC50 = 11.23 ± 0.0007 µg/ml |
| dbacp07778 | Longicalycinin A cyclic analogue 15 | PYGFV | Synthetic Analogue of Longicalycinin A | Cyclization enhances apoptosis via lysosomes | MTT assay | HT-29 | Colorectal Cancer | 27.43% Cell death at 100 µg/ml |
| dbacp07780 | Longicalycinin A linear analogue 16 | FTPFV | Synthetic Analogue of Longicalycinin A | Cyclization enhances apoptosis via lysosomes | MTT assay | HT-29 | Colorectal Cancer | IC50 = 12.11 ± 0.0056 µg/ml |
| dbacp07782 | Longicalycinin A linear analogue 16 | FTPFV | Synthetic Analogue of Longicalycinin A | Cyclization enhances apoptosis via lysosomes | MTT assay | HT-29 | Colorectal Cancer | 88.24% Cell death at 100 µg/ml |
| dbacp07784 | Longicalycinin A cyclic analogue 16 | FTPFV | Synthetic Analogue of Longicalycinin A | Cyclization enhances apoptosis via lysosomes | MTT assay | HT-29 | Colorectal Cancer | IC50 = 10.4 ± 0.0028 µg/ml |
| dbacp07786 | Longicalycinin A cyclic analogue 16 | FTPFV | Synthetic Analogue of Longicalycinin A | Cyclization enhances apoptosis via lysosomes | MTT assay | HT-29 | Colorectal Cancer | 29.87% Cell death at 100 µg/ml |
| dbacp07788 | Longicalycinin A linear analogue 17 | FSPFA | Synthetic Analogue of Longicalycinin A | Cyclization enhances apoptosis via lysosomes | MTT assay | HT-29 | Colorectal Cancer | IC50 = 11.33 ± 0.0035 µg/ml |
| dbacp07790 | Longicalycinin A linear analogue 17 | FSPFA | Synthetic Analogue of Longicalycinin A | Cyclization enhances apoptosis via lysosomes | MTT assay | HT-29 | Colorectal Cancer | 75.68% Cell death at 100 µg/ml |
| dbacp07792 | Longicalycinin A cyclic analogue 17 | FSPFA | Synthetic Analogue of Longicalycinin A | Cyclization enhances apoptosis via lysosomes | MTT assay | HT-29 | Colorectal Cancer | IC50 = 11.2 ± 0.0007 µg/ml |
| dbacp07794 | Longicalycinin A cyclic analogue 17 | FSPFA | Synthetic Analogue of Longicalycinin A | Cyclization enhances apoptosis via lysosomes | MTT assay | HT-29 | Colorectal Cancer | 76.14% Cell death at 100 µg/ml |
| dbacp07796 | Longicalycinin A linear analogue 18 | FSPAG | Synthetic Analogue of Longicalycinin A | Cyclization enhances apoptosis via lysosomes | MTT assay | HT-29 | Colorectal Cancer | IC50 = 10.2 ± 0.0014 µg/ml |
| dbacp07798 | Longicalycinin A linear analogue 18 | FSPAG | Synthetic Analogue of Longicalycinin A | Cyclization enhances apoptosis via lysosomes | MTT assay | HT-29 | Colorectal Cancer | 56.51% Cell death at 100 µg/ml |
| dbacp07800 | Longicalycinin A cyclic analogue 18 | FSPAG | Synthetic Analogue of Longicalycinin A | Cyclization enhances apoptosis via lysosomes | MTT assay | HT-29 | Colorectal Cancer | IC50 = 9.06 ± 0.0014 µg/ml |
| dbacp07802 | Longicalycinin A cyclic analogue 18 | FSPAG | Synthetic Analogue of Longicalycinin A | Cyclization enhances apoptosis via lysosomes | MTT assay | HT-29 | Colon Cancer | 22.8% Cell death at 100 µg/ml |
| dbacp07804 | cT1 | KWCFRVCYRGICYRRCRG | Synthetic | Not Available | Resazurin dye assay | HT-144 | Skin Cancer | CC50 = 1.4 ± 0.1 µM |
| dbacp07815 | [W2S]cT1 | KSCFRVCYRGICYRRCRG | Synthetic | Not Available | Resazurin dye assay | HT-144 | Skin Cancer | CC50 = 3.0 ± 0.2 µM |
| dbacp07821 | [Y8S-I11S]cT1 | KWCFRVCSRGSCYRRCRG | Synthetic | Not Available | Resazurin dye assay | HT-144 | Skin Cancer | CC50 = 27.8 ± 2.2 µM |
| dbacp07826 | [R14S]cT1 | KWCFRVCYRGICYSRCRG | Synthetic | Not Available | Resazurin dye assay | HT-144 | Skin Cancer | CC50 = 2.3 ± 0.2 µM |
| dbacp07831 | [R17S]cT1 | KWCFRVCYRGICYRRCSG | Synthetic | Not Available | Resazurin dye assay | HT-144 | Skin Cancer | CC50 = 1.2 ± 0.1 µM |
| dbacp07835 | [R9S-R14S-R17S]cT1 | KWCFRVCYSGICYSRCSG | Synthetic | Not Available | Resazurin dye assay | HT-144 | Skin Cancer | CC50 = 11.8 ± 0.9 µM |
| dbacp07839 | [G18K]cT1 | KWCFRVCYRGICYRRCRK | Synthetic | Not Available | Resazurin dye assay | HT-144 | Skin Cancer | CC50 = 3.2 ± 0.1 µM |
| dbacp07844 | [I11F-G18K]cT1 | KWCFRVCYRGFCYRRCRK | Synthetic | Not Available | Resazurin dye assay | HT-144 | Skin Cancer | CC50 = 3.2 ± 0.1 µM |
| dbacp08043 | Silk Fibroin peptide | Not Available | Silkworm Cocoons | SFP induces S-phase cell-cycle arrest | MTT assay | HT-29 | Colon Cancer | IC50 = 11.55 ± 3.33 mg/ml |
| dbacp08061 | TAT-327 | RKKRRQRRREFLDCFQKF | Peptide-327 | Peptide 327 blocks Eps8–EGFR | CCK-8 assay | HT-29 | Colon Cancer | EC50 = 74.08 ± 0.63 μM |
| dbacp08139 | Laterosporulin10 (LS10) | ACVNQCPDAIDRFIVKDKGCHGVEKKYYKQVYVACMNGQHLYCRTEGGPCQL | Brevibacillus sp. strain SKDU10 | Apoptosis inducing | MTT assay | HT-1080 | Fibrosarcoma | 20% cytotoxicity 5 μM concentration |
| dbacp08259 | Tr3 | Not Available | Protein extraction from Spirulina platensis | Not Available | MTT assay | HT-29 | Colon Cancer | IC50 = 112.89 μg/mL |
| dbacp08262 | HR | HVLSRAPR | Fraction identified from Tr1 | Not Available | MTT assay | HT-29 | Colon Cancer | IC50 = 99.88 μg/mL |