dbACP: A Comprehensive Database of Anti-Cancer Peptides

284 result(s) have been found!

Accession Name Sequence Source/Organism Mechanism Assay Type Cell Line Cancer Type Activity
dbacp00039 Enkephalins7 analogue-8 YA* Synthetic Peptide Apoptosis inducing MTT/MTS assay HT-29 Colon cancer 9.8% inhibition at 10-6 M
dbacp00040 Enkephalins7 analogue-8 YA* Synthetic Peptide Apoptosis inducing MTT/MTS assay HT-29 Colon cancer 1.6% inhibition at 10-5 M
dbacp00041 Enkephalins7 analogue-8 YA* Synthetic Peptide Apoptosis inducing MTT/MTS assay HT-29 Colon cancer 5.4% inhibition at 10-4 M
dbacp00042 Enkephalins7 analogue-8 YA* Synthetic Peptide Apoptosis inducing MTT/MTS assay HT-29 Colon cancer 26.5% inhibition at 10-3 M
dbacp00063 Enkephalins7 analogue-9 YSA* Synthetic Peptide Apoptosis inducing MTT/MTS assay HT-29 Colon cancer 4.9% inhibition at 10-6 M
dbacp00064 Enkephalins7 analogue-9 YSA* Synthetic Peptide Apoptosis inducing MTT/MTS assay HT-29 Colon cancer 8.9% inhibition at 10-5 M
dbacp00065 Enkephalins7 analogue-9 YSA* Synthetic Peptide Apoptosis inducing MTT/MTS assay HT-29 Colon cancer 3.4% inhibition at 10-4 M
dbacp00066 Enkephalins7 analogue-9 YSA* Synthetic Peptide Apoptosis inducing MTT/MTS assay HT-29 Colon cancer 20.8% inhibition at 10-3 M
dbacp00090 Enkephalins7 analogue-10 YSA* Synthetic Peptide Apoptosis inducing MTT/MTS assay HT-29 Colon cancer 0.7% inhibition at 10-6 M
dbacp00091 Enkephalins7 analogue-10 YSA* Synthetic Peptide Apoptosis inducing MTT/MTS assay HT-29 Colon cancer 8.3% inhibition at 10-5 M
dbacp00092 Enkephalins7 analogue-10 YSA* Synthetic Peptide Apoptosis inducing MTT/MTS assay HT-29 Colon cancer 10.5% inhibition at 10-4 M
dbacp00093 Enkephalins7 analogue-10 YSA* Synthetic Peptide Apoptosis inducing MTT/MTS assay HT-29 Colon cancer 21.8% inhibition at 10-3 M
dbacp00137 Enkephalins7 analogue-15 YSA*G Synthetic Peptide Apoptosis inducing MTT/MTS assay HT-29 Colon cancer 5.4% inhibition at 10-6 M
dbacp00138 Enkephalins7 analogue-15 YSA*G Synthetic Peptide Apoptosis inducing MTT/MTS assay HT-29 Colon cancer 7.4% inhibition at 10-5 M
dbacp00139 Enkephalins7 analogue-15 YSA*G Synthetic Peptide Apoptosis inducing MTT/MTS assay HT-29 Colon cancer 9.5% inhibition at 10-4 M
dbacp00140 Enkephalins7 analogue-15 YSA*G Synthetic Peptide Apoptosis inducing MTT/MTS assay HT-29 Colon cancer 15.7% inhibition at 10-3 M
dbacp00170 Enkephalins7 analogue-16 YRA*G Synthetic Peptide Apoptosis inducing MTT/MTS assay HT-29 Colon cancer 7.6% inhibition at 10-6 M
dbacp00171 Enkephalins7 analogue-16 YRA*G Synthetic Peptide Apoptosis inducing MTT/MTS assay HT-29 Colon cancer 3.8% inhibition at 10-5 M
dbacp00172 Enkephalins7 analogue-16 YRA*G Synthetic Peptide Apoptosis inducing MTT/MTS assay HT-29 Colon cancer 12.4% inhibition at 10-4 M
dbacp00173 Enkephalins7 analogue-16 YRA*G Synthetic Peptide Apoptosis inducing MTT/MTS assay HT-29 Colon cancer 22.4% inhibition at 10-3 M
dbacp00204 Enkephalins7 analogue-17 YA*GFM Synthetic Peptide Apoptosis inducing MTT/MTS assay HT-29 Colon cancer 3.3% inhibition at 10-6 M
dbacp00205 Enkephalins7 analogue-17 YA*GFM Synthetic Peptide Apoptosis inducing MTT/MTS assay HT-29 Colon cancer 11.0% inhibition at 10-5M
dbacp00206 Enkephalins7 analogue-17 YA*GFM Synthetic Peptide Apoptosis inducing MTT/MTS assay HT-29 Colon cancer 7.9% inhibition at 10-4 M
dbacp00207 Enkephalins7 analogue-17 YA*GFM Synthetic Peptide Apoptosis inducing MTT/MTS assay HT-29 Colon cancer 23.7% inhibition at 10-3 M
dbacp00238 Enkephalins7 analogue-18 YA*GFM Synthetic Peptide Apoptosis inducing MTT/MTS assay HT-29 Colon cancer 16.2% inhibition at 10-6 M
dbacp00239 Enkephalins7 analogue-18 YA*GFM Synthetic Peptide Apoptosis inducing MTT/MTS assay HT-29 Colon cancer 6.6% inhibition at 10-5 M
dbacp00240 Enkephalins7 analogue-18 YA*GFM Synthetic Peptide Apoptosis inducing MTT/MTS assay HT-29 Colon cancer 5.1% inhibition at 10-4 M
dbacp00241 Enkephalins7 analogue-18 YA*GFM Synthetic Peptide Apoptosis inducing MTT/MTS assay HT-29 Colon cancer 14.5% inhibition at 10-3 M
dbacp00285 Enkephalins7 analogue-23 YGGFMA* Synthetic Peptide Apoptosis inducing MTT/MTS assay HT-29 Colon cancer 9.2% inhibition at 10-3 M
dbacp00321 [A18K]OCN-3N GIFDVLKNLAKGVITSLKS Derivatives of ocellatin-3N Membranolytic mechanism Not specified HT-29 Colorectal adenocarcinoma LC50 : 12-20 μM
dbacp00435 [D4K,A18K]OCN-3N GIFKVLKNLAKGVITSLKS Derivatives of ocellatin-3N Membranolytic mechanism Not specified HT-29 Colorectal adenocarcinoma LC50 : 12-20 μM
dbacp00438 [D4K]OCN-3N GIFKVLKNLAKGVITSLAS Derivatives of ocellatin-3N Not specified Lactate dehydrogenase (LDH) assay HT-29 Colorectal adenocarcinoma LC50 : 12-20 μM
dbacp00769 A specific Eps8/EGFR Inhibitor Peptide 327 EFLDCFQKF A specific Eps8/EGFR Inhibitor Peptide 327 Immune response to tumor cell recognition Lactate dehydrogenase (LDH)-release assay HT-29 Colorectal adenocarcinoma IC50 : 96.00 ± 9.06 μM
dbacp01008 Alyteserin-2 ILGKLLSTAAGLLSNL Common midwife toad Cell penetration Cytotoxicity assay HT29 Colorectal adenocarcinoma LC50 : 28 µM
dbacp01349 Aurein-2.7 GLFDIAKKVIGVIGSL Southern bell frog Cell membrane disintegration One-dose and five-dose assay HT29 Colon cancer IC50 : 4-5 μM
dbacp01965 Brevinin-2R KLKNFAKGVAQSLLNKASCKLSGQC Skin, Marsh frog, Europe Activates the lysosomal-mitochondrial death pathway; Involves autophagy-like cell death MTT-assay HT29/219 Colon carcinoma LD50 : 10 – 15 μg/ml
dbacp01966 Brevinin-2R KLKNFAKGVAQSLLNKASCKLSGQC Skin, Marsh frog, Europe Activates the lysosomal-mitochondrial death pathway; Involves autophagy-like cell death MTT-assay HT29/219 Colon carcinoma LD50 : 20 – 25 μg/ml
dbacp01967 Brevinin-2R KLKNFAKGVAQSLLNKASCKLSGQC Skin, Marsh frog, Europe Activates the lysosomal-mitochondrial death pathway; Involves autophagy-like cell death MTT-assay HT29/219 Colon carcinoma LD50 : 30 – 40 μg/ml
dbacp02042 Buforin IIb RAGLQFPVGRLLRRLLRRLLR Histone H2A Inducing mitochondria-dependent apoptosis MTT/MTS assay HT-29 Colon cancer IC50 : 17.6 µg/ml
dbacp02099 Buforin Iib RAGLQFPVGRLLRRLLRRLLR Not found Inducing apoptosis MTT/MTS assay HT-29 Not specified IC50 : 13.2 µg/ml
dbacp02367 Cecropin B KWKVFKKIEKMGRNIRNGIVKAGPAIAVLGEAKAL Silkmoth Pore formation at the cytoplasmic membrane MTT/MTS assay HT-29 Colon cancer IC50 : >100 µM
dbacp02483 Chrysophsin-1 FFGWLIKGAIHAGKAIHGLI The pyloric caeca and gills; Red sea bream Disruption of cancer cell membranes; Apoptosis MTS assay, Lactate dehydrogenase (LDH) detection assay HT-1080 Human fibrosarcoma MIC : 7 µg/ml
dbacp02657 Dermaseptin-B2 GLWSKIKEVGKEAAKAAAKAAGKAALGAVSEAV Giant leaf frog Immunomodulatory properties Cytotoxicity assays, Cell Titer-Glo Luminescent Cell viability assay HT-29 Colorectal adenocarcinoma LC50 : < 12 μM
dbacp02803 Dolastatin 10 2-[[2-(dimethylamino)-3-methylbutanoyl]amino]-N-[3-methoxy-1-[2-[1-methoxy-2-methyl-3-oxo-3-[[2-phenyl-1-(1,3-thiazol-2-yl)ethyl]amino]propyl]pyrrolidin-1-yl]-5-methyl-1-oxoheptan-4-yl]-N,3-dimethylbutaNAmide Wedge sea hare Apoptosis inducing Cell viability assay HT Lymphoma cancer IC50 : 0.0013 - 0.013 nM
dbacp02807 Dolastatin 15 VV-nMe-VPP-2hydroxyisovaleryl-2-oxo-4-methoxy-5-benzyl-3-pyrroline Wedge sea hare Apoptosis inducing Cell viability assay HT Lymphoma cancer IC50 : 0.0013 - 0.013 nM
dbacp02851 Epinecidin-1 GFIFHIIKGLFHAGKMIHGLV Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 82 % Cytotoxicity at 50 mg/L
dbacp02852 Epinecidin-1 GFIFHIIKGLFHAGKMIHGLV Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 85 % Cytotoxicity at 25 mg/L
dbacp02853 Epinecidin-1 GFIFHIIKGLFHAGKMIHGLV Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 42 % Cytotoxicity at 12.5 mg/L
dbacp02854 Epinecidin-1 GFIFHIIKGLFHAGKMIHGLV Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 41 % Cytotoxicity at 6.25 mg/L
dbacp02855 Epinecidin-1 GFIFHIIKGLFHAGKMIHGLV Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 39 % Cytotoxicity at 3.125 mg/L
dbacp02856 Epinecidin-1 GFIFHIIKGLFHAGKMIHGLV Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 90 % Cytotoxicity at 50 mg/L
dbacp02857 Epinecidin-1 GFIFHIIKGLFHAGKMIHGLV Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 95 % Cytotoxicity at 25 mg/L
dbacp02858 Epinecidin-1 GFIFHIIKGLFHAGKMIHGLV Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 45 % Cytotoxicity at 12.5 mg/L
dbacp02859 Epinecidin-1 GFIFHIIKGLFHAGKMIHGLV Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 25 % Cytotoxicity at 6.25 mg/L
dbacp02860 Epinecidin-1 GFIFHIIKGLFHAGKMIHGLV Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 25 % Cytotoxicity at 3.125 mg/L
dbacp02861 Epinecidin-1 GFIFHIIKGLFHAGKMIHGLV Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 95 % Cytotoxicity at 50 mg/L
dbacp02862 Epinecidin-1 GFIFHIIKGLFHAGKMIHGLV Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 96 % Cytotoxicity at 25 mg/L
dbacp02863 Epinecidin-1 GFIFHIIKGLFHAGKMIHGLV Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 46 % Cytotoxicity at 12.5 mg/L
dbacp02864 Epinecidin-1 GFIFHIIKGLFHAGKMIHGLV Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 30 % Cytotoxicity at 6.25 mg/L
dbacp02865 Epinecidin-1 GFIFHIIKGLFHAGKMIHGLV Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 28 % Cytotoxicity at 3.125 mg/L
dbacp02866 Epinecidin-1 GFIFHIIKGLFHAGKMIHGLV Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 84 % Cytotoxicity at 50 mg/L
dbacp02867 Epinecidin-1 GFIFHIIKGLFHAGKMIHGLV Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 85 % Cytotoxicity at 25 mg/L
dbacp02868 Epinecidin-1 GFIFHIIKGLFHAGKMIHGLV Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 38 % Cytotoxicity at 12.5 mg/L
dbacp02869 Epinecidin-1 GFIFHIIKGLFHAGKMIHGLV Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 30 % Cytotoxicity at 6.25 mg/L
dbacp02870 Epinecidin-1 GFIFHIIKGLFHAGKMIHGLV Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 28 % Cytotoxicity at 3.125 mg/L
dbacp02894 Epinecidin-8 FIFHIIKGLFHAGKMI Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 60 % Cytotoxicity at 50 mg/L
dbacp02895 Epinecidin-8 FIFHIIKGLFHAGKMI Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 50 % Cytotoxicity at 25 mg/L
dbacp02896 Epinecidin-8 FIFHIIKGLFHAGKMI Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 8 % Cytotoxicity at 12.5 mg/L
dbacp02897 Epinecidin-8 FIFHIIKGLFHAGKMI Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 10 % Cytotoxicity at 6.25 mg/L
dbacp02898 Epinecidin-8 FIFHIIKGLFHAGKMI Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 5 % Cytotoxicity at 3.125 mg/L
dbacp02899 Epinecidin-8 FIFHIIKGLFHAGKMI Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 75 % Cytotoxicity at 50 mg/L
dbacp02900 Epinecidin-8 FIFHIIKGLFHAGKMI Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 70 % Cytotoxicity at 25 mg/L
dbacp02901 Epinecidin-8 FIFHIIKGLFHAGKMI Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 5 %Cytotoxicity at 12.5 mg/L
dbacp02902 Epinecidin-8 FIFHIIKGLFHAGKMI Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 7 % Cytotoxicity at 6.25 mg/L
dbacp02903 Epinecidin-8 FIFHIIKGLFHAGKMI Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 10 % Cytotoxicity at 3.125 mg/L
dbacp02904 Epinecidin-8 FIFHIIKGLFHAGKMI Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 76 % Cytotoxicity at 50 mg/L
dbacp02905 Epinecidin-8 FIFHIIKGLFHAGKMI Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 70 % Cytotoxicity at 25 mg/L
dbacp02906 Epinecidin-8 FIFHIIKGLFHAGKMI Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 12 % Cytotoxicity at 12.5 mg/L
dbacp02907 Epinecidin-8 FIFHIIKGLFHAGKMI Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 4 % Cytotoxicity at 6.25 mg/L
dbacp02908 Epinecidin-8 FIFHIIKGLFHAGKMI Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 4 % Cytotoxicity at 3.125 mg/L
dbacp02909 Epinecidin-8 FIFHIIKGLFHAGKMI Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 90 % Cytotoxicity at 50 mg/L
dbacp02910 Epinecidin-8 FIFHIIKGLFHAGKMI Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 75 % Cytotoxicity at 25 mg/L
dbacp02911 Epinecidin-8 FIFHIIKGLFHAGKMI Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 8 % Cytotoxicity at 12.5 mg/L
dbacp02912 Epinecidin-8 FIFHIIKGLFHAGKMI Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 3 % Cytotoxicity at 6.25 mg/L
dbacp02913 Epinecidin-8 FIFHIIKGLFHAGKMI Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 3 % Cytotoxicity at 3.125 mg/L
dbacp02957 Figainin 2BN FLGVALKLGKVLGKALLPLASSLLHSQ Norepinephrine-stimulated skin secretion, the Giant Gladiator Treefrog, the Rusty Treefrog, Trinidad, South America Cell membrane penetration Not specified HT-29 Colon adenocarcinoma LC50 : 7-14 µM
dbacp02960 Figainin 2PL FLGTVLKLGKAIAKTVVPMLTNAMQPKQ Skin secretions, the bananatree dwelling frog, Trinidad, South America Membrane disruption Not specified HT30 Not found LC50 : < 30 μM
dbacp03351 Hylin PL FLGLIPALAGAIGNLIK Skin secretions, the banana tree dwelling frog, Trinidad, South America Membrane disruption Not specified HT31 Not found LC50 : < 30 μM
dbacp03354 Hymenochirin-1B KLSPETKDNLKKVLKGAIKGAIVAKMV Zaire dwarf clawed frog Membrane disruption and cell lysis Cytotoxicity assay, Cell TiterGlo Luminescent Cell viability assay HT-29 Colon cancer LC50 : 9.7 ± 0.2 μM
dbacp03530 KW5 KAAKKAAKAAKKAAKAAKKAA Synthetic peptide Through interactions with the plasma membrane MTT/MTS assay HT-29 Colon cancer IC50 : 55 ± 14 µM
dbacp03551 L1 PEWFKCRRWQWRMKKLGA Lactoferrin Cell membrane disintegration MTT/MTS assay HT-29 Colon cancer IC50 : > 404 µM
dbacp03554 L10 PAARKAFRWAWRMLKKAA Lactoferrin Cell membrane disintegration MTT/MTS assay HT-29 Colon cancer IC50 : 35 µM
dbacp03557 L11 PAARKAARWAWRMLKKGA Lactoferrin Cell membrane disintegration MTT/MTS assay HT-29 Colon cancer IC50 : 248 µM
dbacp03560 L12 PAWRKAFRWAKRMLKKAA Lactoferrin Cell membrane disintegration MTT/MTS assay HT-29 Colon cancer IC50 : 25 µM
dbacp03563 L13 PAWRKAFRKAWRMLKKAA Lactoferrin Cell membrane disintegration MTT/MTS assay HT-29 Colon cancer IC50 : 29 µM
dbacp03566 L14 PAWRKARRWAWRMKKLAA Lactoferrin Cell membrane disintegration MTT/MTS assay HT-29 Colon cancer IC50 : 423 µM
dbacp03569 L15 PAWRKARRWARRMKKLAA Lactoferrin Cell membrane disintegration MTT/MTS assay HT-29 Colon cancer IC50 : 178 µM
dbacp03588 L2 PAWFKARRWAWRMKKLAA Lactoferrin Cell membrane disintegration MTT/MTS assay HT-29 Colon cancer IC50 : >440 µM
dbacp03599 L3 PAWRKAFRWAWRMKKLAA Lactoferrin Cell membrane disintegration MTT/MTS assay HT-29 Colon cancer IC50 : 141 µM
dbacp03606 L4 PAWFKARRWAWRMLKKAA Lactoferrin Cell membrane disintegration MTT/MTS assay HT-29 Colon cancer IC50 : 57 µM
dbacp03609 L5 PAWRKAFRWAWRMLKKAA Lactoferrin Cell membrane disintegration MTT/MTS assay HT-29 Colon cancer IC50 : 14 µM
dbacp03612 L6 PAWRKAFRWAARMLKKAA Lactoferrin Cell membrane disintegration MTT/MTS assay HT-29 Colon cancer IC50 : 15 µM
dbacp03631 L7 PAWRKAFRAAWRMLKKAA Lactoferrin Cell membrane disintegration MTT/MTS assay HT-29 Colon cancer IC50 : 16 µM
dbacp03634 L8 PAWAKAFRAAARMKLKAA Lactoferrin Cell membrane disintegration MTT/MTS assay HT-29 Colon cancer IC50 : 180 µM
dbacp03637 L9 PAWRKAARWAWRMLKKAA Lactoferrin Cell membrane disintegration MTT/MTS assay HT-29 Colon cancer IC50 : 52 µM
dbacp03730 LfcinB FKCRRWQWRMKK Bovine lactoferrin (Lf-B) Cell membrane disintegration; Regulation of immune response; Apoptosis MTT/MTS assay HT-29 Colon cancer IC50 : > 160 µM
dbacp03734 LfcinB FKCRRWQWRMKK Bovine lactoferrin (Lf-B) Cell membrane disintegration; Regulation of immune response; Apoptosis MTT/MTS assay HT-29 Colon cancer IC50 : 148 ± 8 µM
dbacp03747 LfcinB (Bovine lactoferricin) FKCRRWQWRM Not found Inducing apoptosis MTT assay HT-29 Leukemia Not found
dbacp04296 LTX-302 WKKW-Dip-KKWK Synthetic peptide Cell membrane disintegration MTT/MTS assay HT-29 Colon cancer IC50 : 75 ± 5 µM
dbacp04299 LTX-315 KKWWKKW-Dip-K Synthetic peptide Cell membrane disintegration MTT/MTS assay HT-29 Colon cancer IC50 : 38 ± 3 µM
dbacp04305 LTX-318 OOW-Dip-OOWWO Synthetic peptide Cell membrane disintegration MTT/MTS assay HT-29 Colon cancer IC50 : 248 ± 5 µM
dbacp04312 Lunasin SKWQHQQDSCRKQLQGVNLTPCEKHIMEKIQGRGDDDDDDDDD Soyabean Apoptosis inducing; Anti-proliferative MTT/MTS HT-29 Not specified IC50 : 61.7 µM
dbacp05089 P6 WYIRKIRRFFKWLKKKLKKK Marine invertebrates Inducing apoptosis MTT assay HT-29 Colorectal cancer Not found
dbacp05134 Pardaxin GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE Red sea moses sole Inducing apoptosis MTT/MTS assay HT-1080 Fibrosarcoma IC50 : 15.74 µg/ml
dbacp05135 Pardaxin GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE Red sea moses sole Inducing apoptosis MTT/MTS assay HT-1080 Fibrosarcoma IC50 : 15.40 µg/ml
dbacp05136 Pardaxin GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE Red sea moses sole Inducing apoptosis MTT/MTS assay HT-1080 Fibrosarcoma IC50 : 14.51 µg/ml
dbacp05137 Pardaxin GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE Red sea moses sole Inducing apoptosis MTT/MTS assay HT-1080 Fibrosarcoma IC50 : 14.52 µg/ml
dbacp05155 Pardaxin-1 GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 88 % Cytotoxicity at 50 mg/L
dbacp05156 Pardaxin-1 GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 82 % Cytotoxicity at 25 mg/L
dbacp05157 Pardaxin-1 GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 40 % Cytotoxicity at 12.5 mg/L
dbacp05158 Pardaxin-1 GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 35 % Cytotoxicity at 6.25 mg/L
dbacp05159 Pardaxin-1 GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 35 % Cytotoxicity at 3.125 mg/L
dbacp05160 Pardaxin-1 GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 90 % Cytotoxicity at 50 mg/L
dbacp05161 Pardaxin-1 GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 90 % Cytotoxicity at 25 mg/L
dbacp05162 Pardaxin-1 GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 30 % Cytotoxicity at 12.5 mg/L
dbacp05163 Pardaxin-1 GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 30 % Cytotoxicity at 6.25 mg/L
dbacp05164 Pardaxin-1 GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 30 % Cytotoxicity at 3.125 mg/L
dbacp05165 Pardaxin-1 GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 97 % Cytotoxicity at 50 mg/L
dbacp05166 Pardaxin-1 GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 95 % Cytotoxicity at 25 mg/L
dbacp05167 Pardaxin-1 GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 39 % Cytotoxicity at 12.5 mg/L
dbacp05168 Pardaxin-1 GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 28 % Cytotoxicity at 6.25 mg/L
dbacp05169 Pardaxin-1 GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 38 % Cytotoxicity at 3.125 mg/L
dbacp05170 Pardaxin-1 GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 90 % Cytotoxicity at 50 mg/L
dbacp05171 Pardaxin-1 GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 90 % Cytotoxicity at 25 mg/L
dbacp05172 Pardaxin-1 GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 15 % Cytotoxicity at 12.5 mg/L
dbacp05173 Pardaxin-1 GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 5 % Cytotoxicity at 6.25 mg/L
dbacp05174 Pardaxin-1 GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 10 % Cytotoxicity at 3.125 mg/L
dbacp05195 Pardaxin-6 GFFALIPKIISSPLFKTLLSAVGSALS Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 80 % Cytotoxicity at 50 mg/L
dbacp05196 Pardaxin-6 GFFALIPKIISSPLFKTLLSAVGSALS Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 85 % Cytotoxicity at 25 mg/L
dbacp05197 Pardaxin-6 GFFALIPKIISSPLFKTLLSAVGSALS Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 45 % Cytotoxicity at 12.5 mg/L
dbacp05198 Pardaxin-6 GFFALIPKIISSPLFKTLLSAVGSALS Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 30 % Cytotoxicity at 6.25 mg/L
dbacp05199 Pardaxin-6 GFFALIPKIISSPLFKTLLSAVGSALS Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 25 % Cytotoxicity at 3.125 mg/L
dbacp05200 Pardaxin-6 GFFALIPKIISSPLFKTLLSAVGSALS Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 84 % Cytotoxicity at 50 mg/L
dbacp05201 Pardaxin-6 GFFALIPKIISSPLFKTLLSAVGSALS Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 84% Cytotoxicity at 25 mg/L
dbacp05202 Pardaxin-6 GFFALIPKIISSPLFKTLLSAVGSALS Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 48 % Cytotoxicity at 12.5 mg/L
dbacp05203 Pardaxin-6 GFFALIPKIISSPLFKTLLSAVGSALS Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 30 % Cytotoxicity at 6.25 mg/L
dbacp05204 Pardaxin-6 GFFALIPKIISSPLFKTLLSAVGSALS Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 35 % Cytotoxicity at 3.125 mg/L
dbacp05205 Pardaxin-6 GFFALIPKIISSPLFKTLLSAVGSALS Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 90 % Cytotoxicity at 50 mg/L
dbacp05206 Pardaxin-6 GFFALIPKIISSPLFKTLLSAVGSALS Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 85 % Cytotoxicity at 25 mg/L
dbacp05207 Pardaxin-6 GFFALIPKIISSPLFKTLLSAVGSALS Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 30 % Cytotoxicity at 12.5 mg/L
dbacp05208 Pardaxin-6 GFFALIPKIISSPLFKTLLSAVGSALS Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 35 % Cytotoxicity at 6.25 mg/L
dbacp05209 Pardaxin-6 GFFALIPKIISSPLFKTLLSAVGSALS Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 15 % Cytotoxicity at 3.125 mg/L
dbacp05210 Pardaxin-6 GFFALIPKIISSPLFKTLLSAVGSALS Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 90 % Cytotoxicity at 50 mg/L
dbacp05211 Pardaxin-6 GFFALIPKIISSPLFKTLLSAVGSALS Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 90 % Cytotoxicity at 25 mg/L
dbacp05212 Pardaxin-6 GFFALIPKIISSPLFKTLLSAVGSALS Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 20 % Cytotoxicity at 12.5 mg/L
dbacp05213 Pardaxin-6 GFFALIPKIISSPLFKTLLSAVGSALS Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 1 % Cytotoxicity at 6.25 mg/L
dbacp05214 Pardaxin-6 GFFALIPKIISSPLFKTLLSAVGSALS Brown-lined reefcod Inducing membrane permeabilization MTT/MTS assay HT-1080 Fibrosarcoma 10 % Cytotoxicity at 3.125 mg/L
dbacp05510 Phylloseptin-1.1TR (PLS-1.1TR) FLSLIPKIAGGIASLVKNL Trinidad leaf frog Cytotoxic Cell viability assay HT‐29 Not found LC50 : 34 μM
dbacp05513 Phylloseptin-1.2TR (PLS-1.2TR) (Phylloseptin-1.3TR) FLSLIPKIAGGIASLVKDL Trinidad leaf frog Cytotoxic Cell viability assay HT‐29 Not found Not found
dbacp05516 Phylloseptin-2.1TR (PLS-2.1TR) (Phylloseptin-2.2TR) FLSLIPHIATGIAALAKHL Trinidad leaf frog Cytotoxic Cell viability assay HT‐29 Not found LC50 : 38 μM
dbacp05519 Phylloseptin-3.1TR (PLS-3.1TR) (Phylloseptin-3.3TR) FFSMIPKIATGIASLVKNL Trinidad leaf frog Cytotoxic Cell viability assay HT‐29 Not found LC50 : 27 μmolL−1
dbacp05522 Phylloseptin-3.2TR (PLS-3.2TR) FFSMIPKIATGIASLVKDL Trinidad leaf frog Cytotoxic Cell viability assay HT‐29 Not found Not found
dbacp05557 Picturin 1BN GIFKDTLKKVVAAVLTTVADNIHPK Norepinephrine-stimulated skin secretion, the Giant Gladiator Treefrog, the Rusty Treefrog, Trinidad, South America Cell membrane penetration Not specified HT-29 Colon adenocarcinoma LC50 : 7 - 14 µM
dbacp05560 Picturin 2BN GLMDMLKKVGKVALTVAKSALLP Norepinephrine-stimulated skin secretion, the Giant Gladiator Treefrog, the Rusty Treefrog, Trinidad, South America Cell membrane penetration Not specified HT-29 Colon adenocarcinoma LC50 : 7 - 14 µM
dbacp05567 Piscidin-1 FFHHIFRGIVHVGKTIHRLVTG Striped bass x White bass Induce apoptosis; Necrotic activity MTS assay and soft-agar colony-formation assay HT1080 Not specified MIC : 20 μg/ml
dbacp05662 Protein GPR15LG (Antimicrobial peptide with 57 amino acid residues) (AP-57) (Antimicrobial peptide-57) (Colon-derived SUSD2 binding factor) (CSBF) (Protein GPR15 ligand) (Protein GPR15L) (Secreted protein C10orf99) MRLLVLSSLLCILLLCFSIFSTEGKRRPAKAWSGRRTRLCCHRVPSPNSTNLKGHHVRLCKPCKLEPEPRLWVVPGALPQV Human Cytotoxic effects SDS-PAGE assay HT-29 Colorectal cancer Not found
dbacp05678 Ps-1Pb IKIPSFFRNILKKVGKEAVSLIAGALKQS Merlin's dwarf gray frog Immunomodulatory properties Cytotoxicity assays, CellTiter-Glo Luminescent cell viability assay HT-29 Colorectal adenocarcinoma LC50 : < 12 μM
dbacp05681 Ps-2Pa GIFPIFAKLLGKVIKVASSLISKGRTE Merlin's dwarf gray frog Immunomodulatory properties Cytotoxicity assays, CellTiter-Glo Luminescent cell viability assay HT-29 Colorectal adenocarcinoma LC50 : < 12 μM
dbacp05916 Raniseptin PL GVFDTVKKIGKAVGKFALGVAKNYLNS Skin secretions, the banana tree dwelling frog, Trinidad, South America Membrane disruption Not specified HT29 Not found LC50 : < 30 μM
dbacp06024 SCAP1 LANAK Marine invertebrates Inducing apoptosis Not specified HT-29 Not specified IC50 : 90.31 ± 0.45 μM
dbacp06025 SCAP1 LANAK Marine invertebrates Inducing apoptosis Not specified HT-29 Not specified IC50 : 70.87 ± 0.82 μM
dbacp06026 SCAP1 LANAK Marine invertebrates Inducing apoptosis Not specified HT-29 Not specified IC50 : 60.21 ± 0.45 μM
dbacp06145 Ss-arasin MERTLLIVLLVCFLLLAVTAEA The Indian mud crab Membrane disruption by pore-formation or by permeating the membrane and acting on intracellular targets MTT assay HT-29 Colon carcinoma IC 50 : 2.90 μM
dbacp06146 Ss-arasin SPRVRRRYGRPFGGRPFVGGQFGGRPGCVCIRSPCPCANYG The Indian mud crab Membrane disruption by pore-formation or by permeating the membrane and acting on intracellular targets MTT assay HT-29 Human cervical carcinoma IC 50 : 2.90 μM
dbacp06189 T Peptide TKPRKTKPRKTKPRKTKPR Tuftsin derivative Immune regulation MTT/MTS assay HT-29 Colon cancer 70% maximum inhibitory rate at 8 mg/kg
dbacp06550 Z1 KAAKKWAKAAKKWAKAWKKAA Synthetic Disruption of cell membrane MTT/MTS assay HT-29 Colon cancer EC50 : > 211 µM
dbacp06553 Z10 AAKKWAKAKWAKAKKWAKAA Synthetic Disruption of cell membrane MTT/MTS assay HT-29 Colon cancer EC50 : > 211 µM
dbacp06556 Z2 KAAKKWAKAWKKAAKAWKKAA Synthetic Disruption of cell membrane MTT/MTS assay HT-29 Colon cancer EC50 : > 211 µM
dbacp06569 Z3 KAAKKAWKAWKKAAKAAWKKAA Synthetic Disruption of cell membrane MTT/MTS assay HT-29 Colon cancer EC50 : >211 µM
dbacp06572 Z4 KAAKKAWKAAKKAAKWWKKAA Synthetic Disruption of cell membrane MTT/MTS assay HT-29 Colon cancer EC50 : 173 µM
dbacp06585 Z5 KAAKKAWKWAKKAAKWAKKAA Synthetic Disruption of cell membrane MTT/MTS assay HT-29 Colon cancer EC50 : 67 µM
dbacp06588 Z6 KWWKKAAKAAKKAAKAAKKWA Synthetic Disruption of cell membrane MTT/MTS assay HT-29 Colon cancer EC50 : 31 µM
dbacp06591 Z7 KAAKKAWKAAKKAWKAAKKAA Synthetic Disruption of cell membrane MTT/MTS assay HT-29 Colon cancer EC50 : 21 µM
dbacp06594 Z8 AWKKWAKAWKWAKAKWWAKAA Synthetic Disruption of cell membrane MTT/MTS assay HT-29 Colon cancer EC50 : 23 µM
dbacp06597 Z9 AAWKWAWAKKWAKAKKWAKAA Synthetic Disruption of cell membrane MTT/MTS assay HT-29 Colon cancer EC50 : 13 µM
dbacp06657 LfcinB (21-25)Pal RWQWRWQWR LfcinB Apoptosis inducing MTT assay HT-29 Colon Cancer IC50 = 100 μM
dbacp06659 Ahx-[Pal] Ahx-RWQWRWQWR Synthetic Apoptosis inducing MTT assay HT-29 Colon Cancer IC50 = 119 μM
dbacp06661 9[Orn] [Pal] RWQWRWQWO Synthetic Apoptosis inducing MTT assay HT-29 Colon Cancer IC50 = 109 μM
dbacp06738 Aurein 1.2_mutant (Aurm) GLFDIIKKIIKSF Synthetic Necrotic activity via cell membrane lysis and apoptotic activity through disrupting mitochondrial membrane MTT assay HT-29 Colon Cancer 66.10% cell viability
dbacp06740 Aurein 1.2_R5 (R5-Aur) RRRRRGLFDIIKKIAESF Synthetic Necrotic activity via cell membrane lysis and apoptotic activity through disrupting mitochondrial membrane MTT assay HT-29 Colon Cancer 61.56% cell viability
dbacp06742 Aurein 1.2_mutant_R5 (R5-Aurm) RRRRRGLFDIIKKIIKSF Synthetic Necrotic activity via cell membrane lysis and apoptotic activity through disrupting mitochondrial membrane MTT assay HT-29 Colon Cancer 54.22% cell viability
dbacp06759 p28 LSTAADMQGVVTDGMASGLDKDYLKPDD Pseudomonas aeruginosa Apoptosis inducing MTT assay HT-29 Colon Cancer IC50 ~ 200 μg/ml
dbacp06854 WP1 RLLRLMRLRMLLRM Derived from RLL peptide Apoptosis inducing Cell Viability assay HT-29 Colon Cancer IC50 = 54.6 ± 2.1 μM
dbacp06858 WP2 RLLRLLRLRRLLRL Derived from RLL peptide Apoptosis inducing Cell Viability assay HT-29 Colon Cancer IC50 = 42.6 ± 4.0 μM
dbacp06860 ALA-A2 KLWCKSSQVPQSR Alpha-Lactalbumin Not available MTT assay HT-29 Colon Cancer ~50% cell viability
dbacp06923 Ocellatin-3N GIFDVLKNLAKGVITSLAS Leptodactylus nesiotus Not available CellTiter-Glo assay HT-29 Colorectal Cancer LC50 = 69 ± 10 μM
dbacp07087 HB43 FAKLLAKLAKKLL Synthetic Motif-driven membrane insertion triggers cytotoxicity AlamarBlue assay HT-29 Colon Cancer IC50 = 11 ± 1 μM
dbacp07091 HB43-mut2 FAKLLAKLAKLLK Synthetic Motif-driven membrane insertion triggers cytotoxicity AlamarBlue assay HT-29 Colon Cancer IC50 = 50 ± 3 μM
dbacp07095 HB43-mut3 FAKLLAKLARRLL Synthetic Motif-driven membrane insertion triggers cytotoxicity AlamarBlue assay HT-29 Colon Cancer IC50 = 9 ± 1 μM
dbacp07365 Piscidin 3 FIHHIFRGIVHAGRSIGRFLTG Morone chrysops x Morone saxatilis Cu²⁺-mediated membrane lipid oxidation MTT assay HT-1080 Fibrosarcoma IC50 = 26.01 µM
dbacp07366 Piscidin 3 FIHHIFRGIVHAGRSIGRFLTG Morone chrysops x Morone saxatilis Cu²⁺-mediated membrane lipid oxidation MTT assay HT-1080 Fibrosarcoma IC50 = 5.52 µM
dbacp07374 HPRP-A1 FKKLKKLFSKLWNWK N-terminal region of Helicobacter pylori ribosomal protein L1 Apoptosis induction, p53-mediated cell cycle arrest MTT assay HT-29 Colon Cancer IC50 ~ 0.5 µg/mL
dbacp07511 YT12 YFYPKDFTPGCT Arthrospira platensis ROS scavenging induces cancer cell death MTT assay HT-29 Colon Cancer IC50 = 12.5 μM
dbacp07549 Sur-X YGRKKRRQRRRKDHRISTFKNWPFLEGCACTPERM Synthetic Disrupts XIAP-survivin, induces apoptosis/necroptosis MTT assay HT-29 Colon Cancer Not Available
dbacp07551 NMANF2 KAIGLVIPEIDGKLDGGAQRV Staphylococcus hominis strain MANF2 GAPDH-like protein disrupts survival MTT assay HT-29 Colon Cancer IC50 = 48.9 µg/mL
dbacp07669 Longicalycinin A linear analogue 1 GYPFV Synthetic Analogue of Longicalycinin A Cyclization enhances apoptosis via lysosomes MTT assay HT-29 Colorectal Cancer IC50 = 10.45 ± 0.0042 µg/ml
dbacp07671 Longicalycinin A linear analogue 1 GYPFV Synthetic Analogue of Longicalycinin A Cyclization enhances apoptosis via lysosomes MTT assay HT-29 Colorectal Cancer 83.02% Cell death at 100 µg/ml
dbacp07673 Longicalycinin A Cyclic analogue 1 GYPFV Synthetic Analogue of Longicalycinin A Cyclization enhances apoptosis via lysosomes MTT assay HT-29 Colorectal Cancer IC50 = 11.4 ± 0.0028 µg/ml
dbacp07675 Longicalycinin A Cyclic analogue 1 GYPFV Synthetic Analogue of Longicalycinin A Cyclization enhances apoptosis via lysosomes MTT assay HT-29 Colorectal Cancer 71.5% Cell death at 100 µg/ml
dbacp07677 Longicalycinin A linear analogue 2 LYPFA Synthetic Analogue of Longicalycinin A Cyclization enhances apoptosis via lysosomes MTT assay HT-29 Colorectal Cancer IC50 = 12.33 ± 0 µg/ml
dbacp07679 Longicalycinin A linear analogue 2 LYPFA Synthetic Analogue of Longicalycinin A Cyclization enhances apoptosis via lysosomes MTT assay HT-29 Colorectal Cancer 88.47% Cell death at 100 µg/ml
dbacp07684 Longicalycinin A FYPFG Synthetic Cyclization enhances apoptosis via lysosomes MTT assay HT-29 Colorectal Cancer IC50 = 11.87 ± 0.0021 µg/ml
dbacp07686 Longicalycinin A (Linear) FYPFG Synthetic Cyclization enhances apoptosis via lysosomes MTT assay HT-29 Colorectal Cancer IC50 = 9.61 ± 0.0007 µg/ml
dbacp07688 Longicalycinin A linear analogue 14 PYFFL Synthetic Analogue of Longicalycinin A Cyclization enhances apoptosis via lysosomes MTT assay HT-29 Colorectal Cancer IC50 = 9.12 ± 0.0042 µg/ml
dbacp07690 Longicalycinin A linear analogue 14 PYFFL Synthetic Analogue of Longicalycinin A Cyclization enhances apoptosis via lysosomes MTT assay HT-29 Colorectal Cancer 82.36% Cell death at 100 µg/ml
dbacp07692 Longicalycinin A cyclic analogue 14 PYFFL Synthetic Analogue of Longicalycinin A Cyclization enhances apoptosis via lysosomes MTT assay HT-29 Colorectal Cancer IC50 = 10.92 ± 0.0021 µg/ml
dbacp07694 Longicalycinin A cyclic analogue 14 PYFFL Synthetic Analogue of Longicalycinin A Cyclization enhances apoptosis via lysosomes MTT assay HT-29 Colorectal Cancer 52.38% Cell death at 100 µg/ml
dbacp07696 Longicalycinin A linear analogue 3 GYPFA Synthetic Analogue of Longicalycinin A Cyclization enhances apoptosis via lysosomes MTT assay HT-29 Colorectal Cancer IC50 = 11.4 ± 0 µg/ml
dbacp07698 Longicalycinin A linear analogue 3 GYPFA Synthetic Analogue of Longicalycinin A Cyclization enhances apoptosis via lysosomes MTT assay HT-29 Colorectal Cancer 87.56% Cell death at 100 µg/ml
dbacp07700 Longicalycinin A cyclic analogue 3 GYPFA Synthetic Analogue of Longicalycinin A Cyclization enhances apoptosis via lysosomes MTT assay HT-29 Colorectal Cancer IC50 = 11.28 ± 0.0063 µg/ml
dbacp07702 Longicalycinin A cyclic analogue 3 GYPFA Synthetic Analogue of Longicalycinin A Cyclization enhances apoptosis via lysosomes MTT assay HT-29 Colorectal Cancer 28.51% Cell death at 100 µg/ml
dbacp07704 Longicalycinin A linear analogue 4 AYPFG Synthetic Analogue of Longicalycinin A Cyclization enhances apoptosis via lysosomes MTT assay HT-29 Colorectal Cancer IC50 = 10.78 ± 0.0021 µg/ml
dbacp07706 Longicalycinin A linear analogue 4 AYPFG Synthetic Analogue of Longicalycinin A Cyclization enhances apoptosis via lysosomes MTT assay HT-29 Colorectal Cancer 75.91% Cell death at 100 µg/ml
dbacp07708 Longicalycinin A cyclic analogue 4 AYPFG Synthetic Analogue of Longicalycinin A Cyclization enhances apoptosis via lysosomes MTT assay HT-29 Colorectal Cancer IC50 = 11.33 ± 0.0035 µg/ml
dbacp07710 Longicalycinin A cyclic analogue 4 AYPFG Synthetic Analogue of Longicalycinin A Cyclization enhances apoptosis via lysosomes MTT assay HT-29 Colorectal Cancer 52.49% Cell death at 100 µg/ml
dbacp07712 Longicalycinin A linear analogue 5 FSPFG Synthetic Analogue of Longicalycinin A Cyclization enhances apoptosis via lysosomes MTT assay HT-29 Colorectal Cancer IC50 = 10.97 ± 0.0049 µg/ml
dbacp07714 Longicalycinin A linear analogue 5 FSPFG Synthetic Analogue of Longicalycinin A Cyclization enhances apoptosis via lysosomes MTT assay HT-29 Colorectal Cancer 91.52% Cell death at 100 µg/ml
dbacp07716 Longicalycinin A cyclic analogue 5 FSPFG Synthetic Analogue of Longicalycinin A Cyclization enhances apoptosis via lysosomes MTT assay HT-29 Colorectal Cancer IC50 = 9.98 ± 0.4256 µg/ml
dbacp07718 Longicalycinin A cyclic analogue 5 FSPFG Synthetic Analogue of Longicalycinin A Cyclization enhances apoptosis via lysosomes MTT assay HT-29 Colorectal Cancer 97.74% Cell death at 100 µg/ml
dbacp07720 Longicalycinin A linear analogue 6 VYPIA Synthetic Analogue of Longicalycinin A Cyclization enhances apoptosis via lysosomes MTT assay HT-29 Colorectal Cancer IC50 = 12.31 ± 0.0063 µg/ml
dbacp07722 Longicalycinin A linear analogue 6 VYPIA Synthetic Analogue of Longicalycinin A Cyclization enhances apoptosis via lysosomes MTT assay HT-29 Colorectal Cancer 49.33% Cell death at 100 µg/ml
dbacp07724 Longicalycinin A cyclic analogue 6 VYPIA Synthetic Analogue of Longicalycinin A Cyclization enhances apoptosis via lysosomes MTT assay HT-29 Colorectal Cancer IC50 = 10.2 ± 0.0021 µg/ml
dbacp07726 Longicalycinin A cyclic analogue 6 VYPIA Synthetic Analogue of Longicalycinin A Cyclization enhances apoptosis via lysosomes MTT assay HT-29 Colorectal Cancer 27.61% Cell death at 100 µg/ml
dbacp07728 Longicalycinin A linear analogue 7 PYVFA Synthetic Analogue of Longicalycinin A Cyclization enhances apoptosis via lysosomes MTT assay HT-29 Colorectal Cancer IC50 = 9.78 ± 0.0212 µg/ml
dbacp07730 Longicalycinin A linear analogue 7 PYVFA Synthetic Analogue of Longicalycinin A Cyclization enhances apoptosis via lysosomes MTT assay HT-29 Colorectal Cancer 84.17% Cell death at 100 µg/ml
dbacp07732 Longicalycinin A cyclic analogue 7 PYVFA Synthetic Analogue of Longicalycinin A Cyclization enhances apoptosis via lysosomes MTT assay HT-29 Colorectal Cancer IC50 = 12.11 ± 0.0035 µg/ml
dbacp07734 Longicalycinin A cyclic analogue 7 PYVFA Synthetic Analogue of Longicalycinin A Cyclization enhances apoptosis via lysosomes MTT assay HT-29 Colorectal Cancer 22.86% Cell death at 100 µg/ml
dbacp07736 Longicalycinin A linear analogue 8 FYPVG Synthetic Analogue of Longicalycinin A Cyclization enhances apoptosis via lysosomes MTT assay HT-29 Colorectal Cancer IC50 = 12.88 ± 0.0014 µg/ml
dbacp07738 Longicalycinin A linear analogue 8 FYPVG Synthetic Analogue of Longicalycinin A Cyclization enhances apoptosis via lysosomes MTT assay HT-29 Colorectal Cancer 88.01% Cell death at 100 µg/ml
dbacp07740 Longicalycinin A cyclic analogue 8 FYPVG Synthetic Analogue of Longicalycinin A Cyclization enhances apoptosis via lysosomes MTT assay HT-29 Colorectal Cancer IC50 = 12.67 ± 0.0028 µg/ml
dbacp07742 Longicalycinin A cyclic analogue 8 FYPVG Synthetic Analogue of Longicalycinin A Cyclization enhances apoptosis via lysosomes MTT assay HT-29 Colorectal Cancer 29.87% Cell death at 100 µg/ml
dbacp07744 Longicalycinin A linear analogue 9 FYPFV Synthetic Analogue of Longicalycinin A Cyclization enhances apoptosis via lysosomes MTT assay HT-29 Colorectal Cancer IC50 = 10.44 ± 0.5536 µg/ml
dbacp07746 Longicalycinin A linear analogue 9 FYPFV Synthetic Analogue of Longicalycinin A Cyclization enhances apoptosis via lysosomes MTT assay HT-29 Colorectal Cancer 1.59% Cell death at 100 µg/ml
dbacp07748 Longicalycinin A cyclic analogue 9 FYPFV Synthetic Analogue of Longicalycinin A Cyclization enhances apoptosis via lysosomes MTT assay HT-29 Colorectal Cancer IC50 = 10.7 ± 0.0056 µg/ml
dbacp07750 Longicalycinin A cyclic analogue 9 FYPFV Synthetic Analogue of Longicalycinin A Cyclization enhances apoptosis via lysosomes MTT assay HT-29 Colorectal Cancer 76.25% Cell death at 100 µg/ml
dbacp07752 Longicalycinin A linear analogue 10 FYPFA Synthetic Analogue of Longicalycinin A Cyclization enhances apoptosis via lysosomes MTT assay HT-29 Colorectal Cancer IC50 = 10.5 ± 0.0007 µg/ml
dbacp07754 Longicalycinin A linear analogue 10 FYPFA Synthetic Analogue of Longicalycinin A Cyclization enhances apoptosis via lysosomes MTT assay HT-29 Colorectal Cancer 92.09% Cell death at 100 µg/ml
dbacp07756 Longicalycinin A cyclic analogue 10 FYPFA Synthetic Analogue of Longicalycinin A Cyclization enhances apoptosis via lysosomes MTT assay HT-29 Colorectal Cancer IC50 = 11.56 ± 0.0028 µg/ml
dbacp07758 Longicalycinin A cyclic analogue 10 FYPFA Synthetic Analogue of Longicalycinin A Cyclization enhances apoptosis via lysosomes MTT assay HT-29 Colorectal Cancer 71.27% Cell death at 100 µg/ml
dbacp07760 Longicalycinin A linear analogue 11 TVPFA Synthetic Analogue of Longicalycinin A Cyclization enhances apoptosis via lysosomes MTT assay HT-29 Colorectal Cancer IC50 = 11.67 ± 0.0014 µg/ml
dbacp07762 Longicalycinin A linear analogue 11 TVPFA Synthetic Analogue of Longicalycinin A Cyclization enhances apoptosis via lysosomes MTT assay HT-29 Colorectal Cancer 88.47% Cell death at 100 µg/ml
dbacp07764 Longicalycinin A cyclic analogue 11 TVPFA Synthetic Analogue of Longicalycinin A Cyclization enhances apoptosis via lysosomes MTT assay HT-29 Colorectal Cancer IC50 = 10.61 ± 0.0007 µg/ml
dbacp07766 Longicalycinin A cyclic analogue 11 TVPFA Synthetic Analogue of Longicalycinin A Cyclization enhances apoptosis via lysosomes MTT assay HT-29 Colorectal Cancer 74.89% Cell death at 100 µg/ml
dbacp07768 Longicalycinin A linear analogue 12 FYPFI Synthetic Analogue of Longicalycinin A Cyclization enhances apoptosis via lysosomes MTT assay HT-29 Colorectal Cancer IC50 = 14.2 ± 0.0014 µg/ml
dbacp07770 Longicalycinin A linear analogue 12 FYPFI Synthetic Analogue of Longicalycinin A Cyclization enhances apoptosis via lysosomes MTT assay HT-29 Colorectal Cancer 81.34% Cell death at 100 µg/ml
dbacp07772 Longicalycinin A cyclic analogue 12 FYPFI Synthetic Analogue of Longicalycinin A Cyclization enhances apoptosis via lysosomes MTT assay HT-29 Colorectal Cancer IC50 = 13.2 ± 0 µg/ml
dbacp07774 Longicalycinin A cyclic analogue 12 FYPFI Synthetic Analogue of Longicalycinin A Cyclization enhances apoptosis via lysosomes MTT assay HT-29 Colorectal Cancer 52.72% Cell death at 100 µg/ml
dbacp07776 Longicalycinin A cyclic analogue 15 PYGFV Synthetic Analogue of Longicalycinin A Cyclization enhances apoptosis via lysosomes MTT assay HT-29 Colorectal Cancer IC50 = 11.23 ± 0.0007 µg/ml
dbacp07778 Longicalycinin A cyclic analogue 15 PYGFV Synthetic Analogue of Longicalycinin A Cyclization enhances apoptosis via lysosomes MTT assay HT-29 Colorectal Cancer 27.43% Cell death at 100 µg/ml
dbacp07780 Longicalycinin A linear analogue 16 FTPFV Synthetic Analogue of Longicalycinin A Cyclization enhances apoptosis via lysosomes MTT assay HT-29 Colorectal Cancer IC50 = 12.11 ± 0.0056 µg/ml
dbacp07782 Longicalycinin A linear analogue 16 FTPFV Synthetic Analogue of Longicalycinin A Cyclization enhances apoptosis via lysosomes MTT assay HT-29 Colorectal Cancer 88.24% Cell death at 100 µg/ml
dbacp07784 Longicalycinin A cyclic analogue 16 FTPFV Synthetic Analogue of Longicalycinin A Cyclization enhances apoptosis via lysosomes MTT assay HT-29 Colorectal Cancer IC50 = 10.4 ± 0.0028 µg/ml
dbacp07786 Longicalycinin A cyclic analogue 16 FTPFV Synthetic Analogue of Longicalycinin A Cyclization enhances apoptosis via lysosomes MTT assay HT-29 Colorectal Cancer 29.87% Cell death at 100 µg/ml
dbacp07788 Longicalycinin A linear analogue 17 FSPFA Synthetic Analogue of Longicalycinin A Cyclization enhances apoptosis via lysosomes MTT assay HT-29 Colorectal Cancer IC50 = 11.33 ± 0.0035 µg/ml
dbacp07790 Longicalycinin A linear analogue 17 FSPFA Synthetic Analogue of Longicalycinin A Cyclization enhances apoptosis via lysosomes MTT assay HT-29 Colorectal Cancer 75.68% Cell death at 100 µg/ml
dbacp07792 Longicalycinin A cyclic analogue 17 FSPFA Synthetic Analogue of Longicalycinin A Cyclization enhances apoptosis via lysosomes MTT assay HT-29 Colorectal Cancer IC50 = 11.2 ± 0.0007 µg/ml
dbacp07794 Longicalycinin A cyclic analogue 17 FSPFA Synthetic Analogue of Longicalycinin A Cyclization enhances apoptosis via lysosomes MTT assay HT-29 Colorectal Cancer 76.14% Cell death at 100 µg/ml
dbacp07796 Longicalycinin A linear analogue 18 FSPAG Synthetic Analogue of Longicalycinin A Cyclization enhances apoptosis via lysosomes MTT assay HT-29 Colorectal Cancer IC50 = 10.2 ± 0.0014 µg/ml
dbacp07798 Longicalycinin A linear analogue 18 FSPAG Synthetic Analogue of Longicalycinin A Cyclization enhances apoptosis via lysosomes MTT assay HT-29 Colorectal Cancer 56.51% Cell death at 100 µg/ml
dbacp07800 Longicalycinin A cyclic analogue 18 FSPAG Synthetic Analogue of Longicalycinin A Cyclization enhances apoptosis via lysosomes MTT assay HT-29 Colorectal Cancer IC50 = 9.06 ± 0.0014 µg/ml
dbacp07802 Longicalycinin A cyclic analogue 18 FSPAG Synthetic Analogue of Longicalycinin A Cyclization enhances apoptosis via lysosomes MTT assay HT-29 Colon Cancer 22.8% Cell death at 100 µg/ml
dbacp07804 cT1 KWCFRVCYRGICYRRCRG Synthetic Not Available Resazurin dye assay HT-144 Skin Cancer CC50 = 1.4 ± 0.1 µM
dbacp07815 [W2S]cT1 KSCFRVCYRGICYRRCRG Synthetic Not Available Resazurin dye assay HT-144 Skin Cancer CC50 = 3.0 ± 0.2 µM
dbacp07821 [Y8S-I11S]cT1 KWCFRVCSRGSCYRRCRG Synthetic Not Available Resazurin dye assay HT-144 Skin Cancer CC50 = 27.8 ± 2.2 µM
dbacp07826 [R14S]cT1 KWCFRVCYRGICYSRCRG Synthetic Not Available Resazurin dye assay HT-144 Skin Cancer CC50 = 2.3 ± 0.2 µM
dbacp07831 [R17S]cT1 KWCFRVCYRGICYRRCSG Synthetic Not Available Resazurin dye assay HT-144 Skin Cancer CC50 = 1.2 ± 0.1 µM
dbacp07835 [R9S-R14S-R17S]cT1 KWCFRVCYSGICYSRCSG Synthetic Not Available Resazurin dye assay HT-144 Skin Cancer CC50 = 11.8 ± 0.9 µM
dbacp07839 [G18K]cT1 KWCFRVCYRGICYRRCRK Synthetic Not Available Resazurin dye assay HT-144 Skin Cancer CC50 = 3.2 ± 0.1 µM
dbacp07844 [I11F-G18K]cT1 KWCFRVCYRGFCYRRCRK Synthetic Not Available Resazurin dye assay HT-144 Skin Cancer CC50 = 3.2 ± 0.1 µM
dbacp08043 Silk Fibroin peptide Not Available Silkworm Cocoons SFP induces S-phase cell-cycle arrest MTT assay HT-29 Colon Cancer IC50 = 11.55 ± 3.33 mg/ml
dbacp08061 TAT-327 RKKRRQRRREFLDCFQKF Peptide-327 Peptide 327 blocks Eps8–EGFR CCK-8 assay HT-29 Colon Cancer EC50 = 74.08 ± 0.63 μM
dbacp08139 Laterosporulin10 (LS10) ACVNQCPDAIDRFIVKDKGCHGVEKKYYKQVYVACMNGQHLYCRTEGGPCQL Brevibacillus sp. strain SKDU10 Apoptosis inducing MTT assay HT-1080 Fibrosarcoma 20% cytotoxicity 5 μM concentration
dbacp08259 Tr3 Not Available Protein extraction from Spirulina platensis Not Available MTT assay HT-29 Colon Cancer IC50 = 112.89 μg/mL
dbacp08262 HR HVLSRAPR Fraction identified from Tr1 Not Available MTT assay HT-29 Colon Cancer IC50 = 99.88 μg/mL