dbACP: A Comprehensive Database of Anti-Cancer Peptides

180 result(s) have been found!

Accession Name Sequence Source/Organism Mechanism Assay Type Cell Line Cancer Type Activity
dbacp00814 AAD (or Aa-Pri1) MDSNKDERAYAQWVIIILHNVGSSPFKIANLGLSWGKLYADGNKDKEVYPSDYNGKTVGPDEKIQINSCGRENASSGTEGSFDIVDPNDGNKTIRHFYWECPWGSKRNTWTPSGSNTKWMVEWSGQNLDSGALGTITVDVLRKGN Purified from chestnut mushroom Apoptosis inducing MTT/MTS assay HepG-2 Liver cancer At 2.5 µM concentration,decrease in cell vibility: 35%
dbacp02473 Chickpea peptide ADLPGLK Plant sources Inducing apoptosis SRB assay HepG-2 Human endometrial cancer IC50 : 113.7 ± 0.99 µM
dbacp05946 RGD-La RGDLLRHVVKILEKYL Arg-Gly-Asp(RGD) tripeptide ana temporins Cell membrane disintegration MTT/MTS assay HepG-2 Liver cancer 60.22 Inhibition ratio at 50 µg/ml
dbacp05955 RGD-Las RGDLLRHVVKILSKYL Arg-Gly-Asp(RGD) tripeptide ana temporins Cell membrane disintegration MTT/MTS assay HepG-2 Liver cancer 73.07 Inhibition ratio at 50 µg/ml
dbacp06188 T Peptide TKPRKTKPRKTKPRKTKPR Tuftsin derivative Immune regulation MTT/MTS assay HepG-2 Liver cancer 69.6% maximum inhibitory rate at 8 mg/kg
dbacp06251 Temporin-La LLRHVVKILEKYL Temporins family Cell membrane disintegration MTT/MTS assay HepG-2 Liver cancer 50.90 inhibition ratio at 50 µg/ml
dbacp06260 Temporin-Las LLRHVVKILSKYL Temporins family Cell membrane disintegration MTT/MTS assay HepG-2 Liver cancer 55.98 inhibition ratio at 50 µg/ml
dbacp06755 37-mer peptide TKEQKEQIAKATGLTTKQVRNWYVQLNASIKVCMCSC Synthetic Apoptosis inducing MTT assay HepG-2 Liver Cancer IC50 = 33.65 ± 1.09 μM
dbacp06853 WP1 RLLRLMRLRMLLRM Derived from RLL peptide Apoptosis inducing Cell Viability assay HepG-2 Liver Cancer IC50 = 52.23 ± 0.9 μM
dbacp06857 WP2 RLLRLLRLRRLLRL Derived from RLL peptide Apoptosis inducing Cell Viability assay HepG-2 Liver Cancer IC50 = 34.05 ± 0.53 μM
dbacp06904 LFcin17–30 FKCRRWQWRMKKLG Lectoferrin Peptide Apoptosis inducing MTT assay HepG-2 Liver Cancer cell viability ~ 50% at 1 µM
dbacp06906 LFampin265–284 DLIWKLLSKAQEKFGKNKSR Lectoferrin Peptide Apoptosis inducing MTT assay HepG-2 Liver Cancer cell viability ~ 50% at 1 µM
dbacp06908 LFchimera FKCRRWQWRMKKLG-K-RSKNKGFKEQAKSLLKWILD Synthetic - Lectoferrin chimera Apoptosis inducing MTT assay HepG-2 Liver Cancer cell viability ~ 44% at 10 µM
dbacp06943 HTDT-6-2-3-2 GPLGAGP Enteromorpha prolifera Apoptosis inducing CCK-8 assay HepG-2 Liver Cancer IC50 = 1.2564 ± 0.0548 mg/mL
dbacp06945 LJP-6 FKEHGY Laminaria japonica Inhibition of cell signalling MTT assay HepG-2 Liver Cancer IC50 = 3.06 ± 0.31 mM
dbacp06947 LJP-1 EGFHL Laminaria japonica Inhibition of cell signalling MTT assay HepG-2 Liver Cancer IC50 = 0.45 ± 0.05 mM
dbacp06950 LJP-8 FSHTYV Laminaria japonica Inhibition of cell signalling MTT assay HepG-2 Liver Cancer IC50 = 0.63 ± 0.05 mM
dbacp06953 LJP-2 LWEHSH Laminaria japonica Inhibition of cell signalling MTT assay HepG-2 Liver Cancer IC50 = 1.71 ± 0.13 mM
dbacp06958 LJP-5 FSTHGG Laminaria japonica Inhibition of cell signalling MTT assay HepG-2 Liver Cancer IC50 = 2.78 ± 0.26 mM
dbacp06961 LJP-7 HAGYSWA Laminaria japonica Inhibition of cell signalling MTT assay HepG-2 Liver Cancer IC50 = 1.66 ± 0.11 mM
dbacp06964 LJP-9 FEHSG Laminaria japonica Inhibition of cell signalling MTT assay HepG-2 Liver Cancer IC50 = 0.69 ± 0.08 mM
dbacp06967 LJP-10 HASWEH Laminaria japonica Inhibition of cell signalling MTT assay HepG-2 Liver Cancer IC50 = 2.69 ± 0.22 mM
dbacp06970 LJP-11 YEHSHG Laminaria japonica Inhibition of cell signalling MTT assay HepG-2 Liver Cancer IC50 = 0.61 ± 0.07 mM
dbacp06973 LJP-12 TFKHG Laminaria japonica Inhibition of cell signalling MTT assay HepG-2 Liver Cancer IC50 = 0.60 ± 0.08 mM
dbacp06977 C16-E4Y EEEEY Synthetic Inhibition of cell signalling WST-8 assay HepG-2 Liver Cancer 50 % cell viability at 0.05 wt %
dbacp06981 Ponericin-W1 (11-25), At1 KLLPSVVGLFKKKKQ Synthetic Apoptosis inducing MTT assay HepG-2 Liver Cancer IC50 >100 µM
dbacp06983 Ponericin-W1 (11-25) [P4K KLLKKVVKLFKKKKK Synthetic Apoptosis inducing MTT assay HepG-2 Liver Cancer IC50 >100 µM
dbacp06985 Ponericin-W1 (11-25) [P4K KLLKKVVKLFKKLLK Synthetic Apoptosis inducing MTT assay HepG-2 Liver Cancer IC50 = 2.2 µM
dbacp06987 At4 KLLKKLLKLLKKLLK Synthetic Apoptosis inducing MTT assay HepG-2 Liver Cancer IC50 = 2.5 µM
dbacp06989 At5 KIIKKIIKIIKKIIK Synthetic Apoptosis inducing MTT assay HepG-2 Liver Cancer IC50 = 1.5 µM
dbacp06991 At6 KVVKKVVKVVKKVVK Synthetic Apoptosis inducing MTT assay HepG-2 Liver Cancer IC50 = 70.8 µM
dbacp06993 At7 KIIKKIKKKIKKIIK Synthetic Apoptosis inducing MTT assay HepG-2 Liver Cancer IC50 = 8.8 µM
dbacp06995 At8 KLLKKLKKKLKKLLK Synthetic Apoptosis inducing MTT assay HepG-2 Liver Cancer IC50 = 8.9 µM
dbacp06997 At9 KVVKKVKKKVKKVVK Synthetic Apoptosis inducing MTT assay HepG-2 Liver Cancer IC50 = 51.7 µM
dbacp06999 At10 IKKIIKIIKKIIKKI Synthetic Apoptosis inducing MTT assay HepG-2 Liver Cancer IC50 = 3.2 µM
dbacp07001 At11 IIIKKIKKKIKKIII Synthetic Apoptosis inducing MTT assay HepG-2 Liver Cancer IC50 = 7.6 µM
dbacp07003 At12 KIIIKIKKKIKIIIK Synthetic Apoptosis inducing MTT assay HepG-2 Liver Cancer IC50 = 13.4 µM
dbacp07004 Rapeseed peptide NDGNQPL extracted from rapeseed protein Inhibition of cell signalling MTT assay HepG-2 Liver Cancer IC50 = 1.56 mmol/L
dbacp07005 Rapeseed peptide NDGNQPL extracted from rapeseed protein Inhibition of cell signalling Apoptosis assay HepG-2 Liver Cancer 28.39 ± 0.80% apoptosis rate at 0.5 mmol/L
dbacp07024 [G10a]-SHa FLSGIVGMLaKLF Analog of temporin SHa Dendrimerization enhances stability, selectivity, anticancer efficacy Resazurin dye assay HepG-2 Liver Cancer IC50 = 31.63 ± 1.56 µM
dbacp07031 [G10a]2-SHa FLSGIVGMLaKLFKFLKaLMFLSGIVG Analog of temporin SHa Dendrimerization enhances stability, selectivity, anticancer efficacy Resazurin dye assay HepG-2 Liver Cancer IC50 = 14.31 ± 1.37 µM
dbacp07038 [G10a]3-SHa FLSGIVGMLaKLFFLSGIVGMLaKLFFLSGIVGMLaKLFKK Analog of temporin SHa Dendrimerization enhances stability, selectivity, anticancer efficacy Resazurin dye assay HepG-2 Liver Cancer IC50 = 5.49 ± 0.37 µM
dbacp07103 rScyreprocin MKEDSNILDKTAKMTKQNKALLFTAGGAAAFMAGYYYYHCNYRNPAPKKSGSTTSQDKTDAQAVQSIPSPSGNKGKESKDPKVKHHHHHH Recombinant product of Scyreprocin Membrane disruption triggers ROS-mediated apoptosis MTS assay HepG-2 Liver Cancer IC50 = 441.01 µM
dbacp07112 Galaxamide (N-Me-L)L(N-Me-L)LL Galaxaura filamentosa Cell-cycle arrest induces apoptosis MTT assay HepG-2 Liver Cancer IC50 = 5.20 ± 0.52 µg/ml
dbacp07118 Z-1 L(N-Me-L)LPL Synthetic Cell-cycle arrest induces apoptosis MTT assay HepG-2 Liver Cancer IC50 = 7.57 ± 0.17 µg/ml
dbacp07258 trans-Phakellistatin 18 trans(P)PIPYPIF Synthetic Not Available MTT assay HepG-2 Liver Cancer IC50 = 67.5 ± 2.938 µM
dbacp07277 LCP-2 WAHT Laminaria japonica Mitochondrial apoptosis via p53 activation. MTT assay HepG-2 Gastric Cancer IC50 = 96.9 ± 9.91 μM
dbacp07281 LCP-3 WHLV Laminaria japonica Mitochondrial apoptosis via p53 activation. MTT assay HepG-2 Gastric Cancer IC50 = 85.2 ± 9.27 μM
dbacp07357 GA - 7 Structure given in figure Synthetic (glycyrrhetinic acid (GA)-based peptides) Apoptosis induction, Bax/p53/caspase activation MTT assay HepG-2 Liver Cancer IC50 = 3.30 ± 0.1 µg/mL
dbacp07406 LvHemB1 DVNFLLHKIYGNIRY hemocyanin of Litopenaeus vannamei Mitochondrial targeting induces apoptosis MTS assay HepG-2 Liver Cancer 44.2% apoptotic cells at 50 μg/mL
dbacp07472 MzDef MSSSNCANVCQTENFPGGECKAEGATRKCFCKNC Zea mays L. Disulfide-stabilized peptide disrupts pathogens MTT assay HepG-2 Liver Cancer IC50 ~ 22 µg/mL
dbacp07553 macrocyclic pyridoheptapeptide derivative 1a Structure given in Scheme 1 Synthetic Macrocyclic peptides disrupt cancer growth MTT assay HepG-2 Liver Cancer IC50 = 6.615 ± 0.353 μM
dbacp07555 macrocyclic pyridoheptapeptide derivative 1b Structure given in Scheme 1 Synthetic Macrocyclic peptides disrupt cancer growth MTT assay HepG-2 Liver Cancer IC50 = 8.724 ± 0.474 μM
dbacp07557 macrocyclic pyridoheptapeptide derivative 1c Structure given in Scheme 1 Synthetic Macrocyclic peptides disrupt cancer growth MTT assay HepG-2 Liver Cancer IC50 = 17.011 ± 0.965 μM
dbacp07558 macrocyclic pyridoheptapeptide derivative 2a Structure given in Scheme 1 Synthetic Macrocyclic peptides disrupt cancer growth MTT assay HepG-2 Liver Cancer IC50 = 17.513 ± 0.876 μM
dbacp07560 macrocyclic pyridoheptapeptide derivative 2b Structure given in Scheme 1 Synthetic Macrocyclic peptides disrupt cancer growth MTT assay HepG-2 Liver Cancer IC50 = 18.681 ± 0.988 μM
dbacp07562 macrocyclic pyridoheptapeptide derivative 2c Structure given in Scheme 1 Synthetic Macrocyclic peptides disrupt cancer growth MTT assay HepG-2 Liver Cancer IC50 = 19.318 ± 1.057 μM
dbacp07564 macrocyclic pyridoheptapeptide derivative 3a Structure given in Scheme 1 Synthetic Macrocyclic peptides disrupt cancer growth MTT assay HepG-2 Liver Cancer IC50 = 8.063 ± 0.863 μM
dbacp07566 macrocyclic pyridoheptapeptide derivative 3b Structure given in Scheme 1 Synthetic Macrocyclic peptides disrupt cancer growth MTT assay HepG-2 Liver Cancer IC50 = 9.66 ± 0.792 μM
dbacp07568 macrocyclic pyridoheptapeptide derivative 3c Structure given in Scheme 1 Synthetic Macrocyclic peptides disrupt cancer growth MTT assay HepG-2 Liver Cancer IC50 = 16.957 ± 1.161 μM
dbacp07570 macrocyclic pyridoheptapeptide derivative 4a Structure given in Scheme 1 Synthetic Macrocyclic peptides disrupt cancer growth MTT assay HepG-2 Liver Cancer IC50 = 7.31 ± 0.595 μM
dbacp07572 macrocyclic pyridoheptapeptide derivative 4b Structure given in Scheme 1 Synthetic Macrocyclic peptides disrupt cancer growth MTT assay HepG-2 Liver Cancer IC50 = 7.166 ± 0.892 μM
dbacp07574 macrocyclic pyridoheptapeptide derivative 4c Structure given in Scheme 1 Synthetic Macrocyclic peptides disrupt cancer growth MTT assay HepG-2 Liver Cancer IC50 = 9.631 ± 0.932 μM
dbacp07575 macrocyclic pyridoheptapeptide derivative 5a Structure given in Scheme 1 Synthetic Macrocyclic peptides disrupt cancer growth MTT assay HepG-2 Liver Cancer IC50 = 7.117 ± 0.790 μM
dbacp07576 macrocyclic pyridoheptapeptide derivative 5b Structure given in Scheme 1 Synthetic Macrocyclic peptides disrupt cancer growth MTT assay HepG-2 Liver Cancer IC50 = 7.088 ± 0.784 μM
dbacp07577 macrocyclic pyridoheptapeptide derivative 5c Structure given in Scheme 1 Synthetic Macrocyclic peptides disrupt cancer growth MTT assay HepG-2 Liver Cancer IC50 = 9.568 ± 1.139 μM
dbacp07668 Longicalycinin A linear analogue 1 GYPFV Synthetic Analogue of Longicalycinin A Cyclization enhances apoptosis via lysosomes MTT assay HepG-2 Liver Cancer IC50 = 9.66 ± 0.0007 µg/ml
dbacp07670 Longicalycinin A linear analogue 1 GYPFV Synthetic Analogue of Longicalycinin A Cyclization enhances apoptosis via lysosomes MTT assay HepG-2 Liver Cancer 13.29% Cell death at 100 µg/ml
dbacp07672 Longicalycinin A Cyclic analogue 1 GYPFV Synthetic Analogue of Longicalycinin A Cyclization enhances apoptosis via lysosomes MTT assay HepG-2 Liver Cancer IC50 = 10.2 ± 0.007 µg/ml
dbacp07674 Longicalycinin A Cyclic analogue 1 GYPFV Synthetic Analogue of Longicalycinin A Cyclization enhances apoptosis via lysosomes MTT assay HepG-2 Liver Cancer 69.73% Cell death at 100 µg/ml
dbacp07676 Longicalycinin A linear analogue 2 LYPFA Synthetic Analogue of Longicalycinin A Cyclization enhances apoptosis via lysosomes MTT assay HepG-2 Liver Cancer IC50 = 8.76 ± 0.0035 µg/ml
dbacp07678 Longicalycinin A linear analogue 2 LYPFA Synthetic Analogue of Longicalycinin A Cyclization enhances apoptosis via lysosomes MTT assay HepG-2 Liver Cancer 71.37% Cell death at 100 µg/ml
dbacp07680 Longicalycinin A FYPFG Dianthus superbus Cyclization enhances apoptosis via lysosomes MTT assay HepG-2 Liver Cancer IC50 = 13.52 µg/ml
dbacp07683 Longicalycinin A FYPFG Synthetic Cyclization enhances apoptosis via lysosomes MTT assay HepG-2 Liver Cancer IC50 = 10.45 ± 0.0042 µg/ml
dbacp07685 Longicalycinin A (Linear) FYPFG Synthetic Cyclization enhances apoptosis via lysosomes MTT assay HepG-2 Liver Cancer IC50 = 9.18 ± 0.0014 µg/ml
dbacp07687 Longicalycinin A linear analogue 14 PYFFL Synthetic Analogue of Longicalycinin A Cyclization enhances apoptosis via lysosomes MTT assay HepG-2 Liver Cancer IC50 = 9.67 ± 0.0007 µg/ml
dbacp07689 Longicalycinin A linear analogue 14 PYFFL Synthetic Analogue of Longicalycinin A Cyclization enhances apoptosis via lysosomes MTT assay HepG-2 Liver Cancer 13.02% Cell death at 100 µg/ml
dbacp07691 Longicalycinin A cyclic analogue 14 PYFFL Synthetic Analogue of Longicalycinin A Cyclization enhances apoptosis via lysosomes MTT assay HepG-2 Liver Cancer IC50 = 10.46 ± 0.0028 µg/ml
dbacp07693 Longicalycinin A cyclic analogue 14 PYFFL Synthetic Analogue of Longicalycinin A Cyclization enhances apoptosis via lysosomes MTT assay HepG-2 Liver Cancer 70.69% Cell death at 100 µg/ml
dbacp07695 Longicalycinin A linear analogue 3 GYPFA Synthetic Analogue of Longicalycinin A Cyclization enhances apoptosis via lysosomes MTT assay HepG-2 Liver Cancer IC50 = 9.77 ± 0.0007 µg/ml
dbacp07697 Longicalycinin A linear analogue 3 GYPFA Synthetic Analogue of Longicalycinin A Cyclization enhances apoptosis via lysosomes MTT assay HepG-2 Liver Cancer 82.33% Cell death at 100 µg/ml
dbacp07699 Longicalycinin A cyclic analogue 3 GYPFA Synthetic Analogue of Longicalycinin A Cyclization enhances apoptosis via lysosomes MTT assay HepG-2 Liver Cancer IC50 = 9.5 ± 0.0056 µg/ml
dbacp07701 Longicalycinin A cyclic analogue 3 GYPFA Synthetic Analogue of Longicalycinin A Cyclization enhances apoptosis via lysosomes MTT assay HepG-2 Liver Cancer 56.72% Cell death at 100 µg/ml
dbacp07703 Longicalycinin A linear analogue 4 AYPFG Synthetic Analogue of Longicalycinin A Cyclization enhances apoptosis via lysosomes MTT assay HepG-2 Liver Cancer IC50 = 9.53 ± 0.0014 µg/ml
dbacp07705 Longicalycinin A linear analogue 4 AYPFG Synthetic Analogue of Longicalycinin A Cyclization enhances apoptosis via lysosomes MTT assay HepG-2 Liver Cancer 27.13% Cell death at 100 µg/ml
dbacp07707 Longicalycinin A cyclic analogue 4 AYPFG Synthetic Analogue of Longicalycinin A Cyclization enhances apoptosis via lysosomes MTT assay HepG-2 Liver Cancer IC50 = 9.77 ± 0.007 µg/ml
dbacp07709 Longicalycinin A cyclic analogue 4 AYPFG Synthetic Analogue of Longicalycinin A Cyclization enhances apoptosis via lysosomes MTT assay HepG-2 Liver Cancer 71.1% Cell death at 100 µg/ml
dbacp07711 Longicalycinin A linear analogue 5 FSPFG Synthetic Analogue of Longicalycinin A Cyclization enhances apoptosis via lysosomes MTT assay HepG-2 Liver Cancer IC50 = 8.99 ± 0.0014 µg/ml
dbacp07713 Longicalycinin A linear analogue 5 FSPFG Synthetic Analogue of Longicalycinin A Cyclization enhances apoptosis via lysosomes MTT assay HepG-2 Liver Cancer 76.72% Cell death at 100 µg/ml
dbacp07715 Longicalycinin A cyclic analogue 5 FSPFG Synthetic Analogue of Longicalycinin A Cyclization enhances apoptosis via lysosomes MTT assay HepG-2 Liver Cancer IC50 = 9.45 ± 0.0056 µg/ml
dbacp07717 Longicalycinin A cyclic analogue 5 FSPFG Synthetic Analogue of Longicalycinin A Cyclization enhances apoptosis via lysosomes MTT assay HepG-2 Liver Cancer 41.37% Cell death at 100 µg/ml
dbacp07719 Longicalycinin A linear analogue 6 VYPIA Synthetic Analogue of Longicalycinin A Cyclization enhances apoptosis via lysosomes MTT assay HepG-2 Liver Cancer IC50 = 10.98 ± 0.0014 µg/ml
dbacp07721 Longicalycinin A linear analogue 6 VYPIA Synthetic Analogue of Longicalycinin A Cyclization enhances apoptosis via lysosomes MTT assay HepG-2 Liver Cancer 38.64% Cell death at 100 µg/ml
dbacp07723 Longicalycinin A cyclic analogue 6 VYPIA Synthetic Analogue of Longicalycinin A Cyclization enhances apoptosis via lysosomes MTT assay HepG-2 Liver Cancer IC50 = 17.34 ± 0.0014 µg/ml
dbacp07725 Longicalycinin A cyclic analogue 6 VYPIA Synthetic Analogue of Longicalycinin A Cyclization enhances apoptosis via lysosomes MTT assay HepG-2 Liver Cancer 51.79% Cell death at 100 µg/ml
dbacp07727 Longicalycinin A linear analogue 7 PYVFA Synthetic Analogue of Longicalycinin A Cyclization enhances apoptosis via lysosomes MTT assay HepG-2 Liver Cancer IC50 = 9.6 ± 0.0007 µg/ml
dbacp07729 Longicalycinin A linear analogue 7 PYVFA Synthetic Analogue of Longicalycinin A Cyclization enhances apoptosis via lysosomes MTT assay HepG-2 Liver Cancer 82.33% Cell death at 100 µg/ml
dbacp07731 Longicalycinin A cyclic analogue 7 PYVFA Synthetic Analogue of Longicalycinin A Cyclization enhances apoptosis via lysosomes MTT assay HepG-2 Liver Cancer IC50 = 9.21 ± 0.0056 µg/ml
dbacp07733 Longicalycinin A cyclic analogue 7 PYVFA Synthetic Analogue of Longicalycinin A Cyclization enhances apoptosis via lysosomes MTT assay HepG-2 Liver Cancer 47.68% Cell death at 100 µg/ml
dbacp07735 Longicalycinin A linear analogue 8 FYPVG Synthetic Analogue of Longicalycinin A Cyclization enhances apoptosis via lysosomes MTT assay HepG-2 Liver Cancer IC50 = 10.35 ± 0.0014 µg/ml
dbacp07737 Longicalycinin A linear analogue 8 FYPVG Synthetic Analogue of Longicalycinin A Cyclization enhances apoptosis via lysosomes MTT assay HepG-2 Liver Cancer 15.35% Cell death at 100 µg/ml
dbacp07739 Longicalycinin A cyclic analogue 8 FYPVG Synthetic Analogue of Longicalycinin A Cyclization enhances apoptosis via lysosomes MTT assay HepG-2 Liver Cancer IC50 = 9.12 ± 0.0007 µg/ml
dbacp07741 Longicalycinin A cyclic analogue 8 FYPVG Synthetic Analogue of Longicalycinin A Cyclization enhances apoptosis via lysosomes MTT assay HepG-2 Liver Cancer 36.85% Cell death at 100 µg/ml
dbacp07743 Longicalycinin A linear analogue 9 FYPFV Synthetic Analogue of Longicalycinin A Cyclization enhances apoptosis via lysosomes MTT assay HepG-2 Liver Cancer IC50 = 9.33 ± 0.0007 µg/ml
dbacp07745 Longicalycinin A linear analogue 9 FYPFV Synthetic Analogue of Longicalycinin A Cyclization enhances apoptosis via lysosomes MTT assay HepG-2 Liver Cancer 72.74% Cell death at 100 µg/ml
dbacp07747 Longicalycinin A cyclic analogue 9 FYPFV Synthetic Analogue of Longicalycinin A Cyclization enhances apoptosis via lysosomes MTT assay HepG-2 Liver Cancer IC50 = 10.67 ± 0 µg/ml
dbacp07749 Longicalycinin A cyclic analogue 9 FYPFV Synthetic Analogue of Longicalycinin A Cyclization enhances apoptosis via lysosomes MTT assay HepG-2 Liver Cancer 73.98% Cell death at 100 µg/ml
dbacp07751 Longicalycinin A linear analogue 10 FYPFA Synthetic Analogue of Longicalycinin A Cyclization enhances apoptosis via lysosomes MTT assay HepG-2 Liver Cancer IC50 = 10.5 ± 0.0014 µg/ml
dbacp07753 Longicalycinin A linear analogue 10 FYPFA Synthetic Analogue of Longicalycinin A Cyclization enhances apoptosis via lysosomes MTT assay HepG-2 Liver Cancer 76.72% Cell death at 100 µg/ml
dbacp07755 Longicalycinin A cyclic analogue 10 FYPFA Synthetic Analogue of Longicalycinin A Cyclization enhances apoptosis via lysosomes MTT assay HepG-2 Liver Cancer IC50 = 10.28 ± 0 µg/ml
dbacp07757 Longicalycinin A cyclic analogue 10 FYPFA Synthetic Analogue of Longicalycinin A Cyclization enhances apoptosis via lysosomes MTT assay HepG-2 Liver Cancer 72.06% Cell death at 100 µg/ml
dbacp07759 Longicalycinin A linear analogue 11 TVPFA Synthetic Analogue of Longicalycinin A Cyclization enhances apoptosis via lysosomes MTT assay HepG-2 Liver Cancer IC50 = 9.56 ± 0.0021 µg/ml
dbacp07761 Longicalycinin A linear analogue 11 TVPFA Synthetic Analogue of Longicalycinin A Cyclization enhances apoptosis via lysosomes MTT assay HepG-2 Liver Cancer 70.28% Cell death at 100 µg/ml
dbacp07763 Longicalycinin A cyclic analogue 11 TVPFA Synthetic Analogue of Longicalycinin A Cyclization enhances apoptosis via lysosomes MTT assay HepG-2 Liver Cancer IC50 = 10.36 ± 0 µg/ml
dbacp07765 Longicalycinin A cyclic analogue 11 TVPFA Synthetic Analogue of Longicalycinin A Cyclization enhances apoptosis via lysosomes MTT assay HepG-2 Liver Cancer 72.06% Cell death at 100 µg/ml
dbacp07767 Longicalycinin A linear analogue 12 FYPFI Synthetic Analogue of Longicalycinin A Cyclization enhances apoptosis via lysosomes MTT assay HepG-2 Liver Cancer IC50 = 11.32 ± 0.0014 µg/ml
dbacp07769 Longicalycinin A linear analogue 12 FYPFI Synthetic Analogue of Longicalycinin A Cyclization enhances apoptosis via lysosomes MTT assay HepG-2 Liver Cancer 12.06% Cell death at 100 µg/ml
dbacp07771 Longicalycinin A cyclic analogue 12 FYPFI Synthetic Analogue of Longicalycinin A Cyclization enhances apoptosis via lysosomes MTT assay HepG-2 Liver Cancer IC50 = 12.37 ± 0.0014 µg/ml
dbacp07773 Longicalycinin A cyclic analogue 12 FYPFI Synthetic Analogue of Longicalycinin A Cyclization enhances apoptosis via lysosomes MTT assay HepG-2 Liver Cancer 63.84% Cell death at 100 µg/ml
dbacp07775 Longicalycinin A cyclic analogue 15 PYGFV Synthetic Analogue of Longicalycinin A Cyclization enhances apoptosis via lysosomes MTT assay HepG-2 Liver Cancer IC50 = 10.33 ± 0 µg/ml
dbacp07777 Longicalycinin A cyclic analogue 15 PYGFV Synthetic Analogue of Longicalycinin A Cyclization enhances apoptosis via lysosomes MTT assay HepG-2 Liver Cancer 52.33% Cell death at 100 µg/ml
dbacp07779 Longicalycinin A linear analogue 16 FTPFV Synthetic Analogue of Longicalycinin A Cyclization enhances apoptosis via lysosomes MTT assay HepG-2 Liver Cancer IC50 = 11.1 ± 0.0007 µg/ml
dbacp07781 Longicalycinin A linear analogue 16 FTPFV Synthetic Analogue of Longicalycinin A Cyclization enhances apoptosis via lysosomes MTT assay HepG-2 Liver Cancer 15.76% Cell death at 100 µg/ml
dbacp07783 Longicalycinin A cyclic analogue 16 FTPFV Synthetic Analogue of Longicalycinin A Cyclization enhances apoptosis via lysosomes MTT assay HepG-2 Liver Cancer IC50 = 12.1 ± 0.0007 µg/ml
dbacp07785 Longicalycinin A cyclic analogue 16 FTPFV Synthetic Analogue of Longicalycinin A Cyclization enhances apoptosis via lysosomes MTT assay HepG-2 Liver Cancer 42.33% Cell death at 100 µg/ml
dbacp07787 Longicalycinin A linear analogue 17 FSPFA Synthetic Analogue of Longicalycinin A Cyclization enhances apoptosis via lysosomes MTT assay HepG-2 Liver Cancer IC50 = 9.33 ± 0.0007 µg/ml
dbacp07789 Longicalycinin A linear analogue 17 FSPFA Synthetic Analogue of Longicalycinin A Cyclization enhances apoptosis via lysosomes MTT assay HepG-2 Liver Cancer 27.54% Cell death at 100 µg/ml
dbacp07791 Longicalycinin A cyclic analogue 17 FSPFA Synthetic Analogue of Longicalycinin A Cyclization enhances apoptosis via lysosomes MTT assay HepG-2 Liver Cancer IC50 = 9.4 ± 0.0014 µg/ml
dbacp07793 Longicalycinin A cyclic analogue 17 FSPFA Synthetic Analogue of Longicalycinin A Cyclization enhances apoptosis via lysosomes MTT assay HepG-2 Liver Cancer 74.53% Cell death at 100 µg/ml
dbacp07795 Longicalycinin A linear analogue 18 FSPAG Synthetic Analogue of Longicalycinin A Cyclization enhances apoptosis via lysosomes MTT assay HepG-2 Liver Cancer IC50 = 10.33 ± 0.0007 µg/ml
dbacp07797 Longicalycinin A linear analogue 18 FSPAG Synthetic Analogue of Longicalycinin A Cyclization enhances apoptosis via lysosomes MTT assay HepG-2 Liver Cancer 15.55% Cell death at 100 µg/ml
dbacp07799 Longicalycinin A cyclic analogue 18 FSPAG Synthetic Analogue of Longicalycinin A Cyclization enhances apoptosis via lysosomes MTT assay HepG-2 Liver Cancer IC50 = 9.68 ± 0.0014 µg/ml
dbacp07801 Longicalycinin A cyclic analogue 18 FSPAG Synthetic Analogue of Longicalycinin A Cyclization enhances apoptosis via lysosomes MTT assay HepG-2 Liver Cancer 46.58% Cell death at 100 µg/ml
dbacp07891 H-58 IKLSKKTKKNLKKVLKGS5IKGS5IAVAKMV Synthetic Cell entry, DNA damage, apoptosis. MTT assay HepG-2 Liver Cancer IC50 = 2.13 ± 0.07 μM
dbacp07894 H-57 IKLSKKTKKNLKKVLKGS5IKGS5IAVAKMV Synthetic Cell entry, DNA damage, apoptosis. MTT assay HepG-2 Liver Cancer IC50 = 2.13 ± 0.07 μM
dbacp07897 H-18 IKLSKKTKKNLKKVLKGS5IKGS5IAVAKMV Synthetic Cell entry, DNA damage, apoptosis. MTT assay HepG-2 Liver Cancer IC50 = 1.61 ± 0.21 μM
dbacp07900 H-21 IKLSKS5TKKS5LKKVLKGS5IKGS5IAVAKMV Synthetic Cell entry, DNA damage, apoptosis. MTT assay HepG-2 Liver Cancer IC50 = 1.50 ± 0.28 μM
dbacp07903 H-20 IKLSPS5TKKS5LKKVLKGS5IKGS5IAVAKMV Synthetic Cell entry, DNA damage, apoptosis. MTT assay HepG-2 Liver Cancer IC50 = 4.93 ± 0.53 μM
dbacp07906 H-19 IKLSKETKKNLKKVLKGS5IKGS5IAVAKMV Synthetic Cell entry, DNA damage, apoptosis. MTT assay HepG-2 Liver Cancer IC50 = 1.64 ± 0.36 μM
dbacp07909 H-17 IKLSKS5TKKS5LKKVLKGAIKGAIAVAKMV Synthetic Cell entry, DNA damage, apoptosis. MTT assay HepG-2 Liver Cancer IC50 = 1.64 ± 0.47 μM
dbacp07912 H-16 IKLSPS5TKKS5LKKVLKGAIKGAIAVAKMV Synthetic Cell entry, DNA damage, apoptosis. MTT assay HepG-2 Liver Cancer IC50 = 3.14 ± 0.46 μM
dbacp07915 H-15 IKLSKS5TKDS5LKKVLKGAIKGAIAVAKMV Synthetic Cell entry, DNA damage, apoptosis. MTT assay HepG-2 Liver Cancer IC50 = 2.20 ± 0.27 μM
dbacp07918 H-10 IKLSPS5TKDS5LKKVLKGS5IKGS5IAVAKMV Synthetic Cell entry, DNA damage, apoptosis. MTT assay HepG-2 Liver Cancer IC50 = 1.50 ± 0.21 μM
dbacp07921 H-5 IKLSPETKDNLKKVLKGS5IKGS5IAVAKMV Synthetic Cell entry, DNA damage, apoptosis. MTT assay HepG-2 Liver Cancer IC50 = 2.82 ± 0.23 μM
dbacp07924 H-2 IKLSPS5TKDS5LKKVLKGAIKGAIAVAKMV Synthetic Cell entry, DNA damage, apoptosis. MTT assay HepG-2 Liver Cancer IC50 = 1.60 ± 0.24 μM
dbacp07929 B11 RIRDAIAHGYIVDKV Litopenaeus vannamei hemocyanin-derived peptide Mitochondrial dysfunction, caspase-dependent apoptosis MTS assay HepG-2 Liver Cancer Decreased cell viability by 23% at 50 μg/mL
dbacp07945 Emericellipsin A (3-MeP)-(AHMOD)-A-Aib-IV-beta-A-N-(2-Hydroxyethyl)-1,2-propanediamine Emericellopsis alkalina Membrane disruption, antifungal, antibacterial, anticancer MTT assay HepG-2 Liver Cancer EC50 = 2.8 uM
dbacp07959 Compound 2a Structure in scheme 1 Synthetic 5c inhibits cancer via kinase blockade Not Available HepG-2 Liver Cancer IC50 = 20.37 ± 1.36 µM
dbacp07961 Compound 2b Structure in scheme 1 Synthetic 5c inhibits cancer via kinase blockade Not Available HepG-2 Liver Cancer IC50 = 15.80 ± 1.66 µM
dbacp07962 Compound 2c Structure in scheme 1 Synthetic 5c inhibits cancer via kinase blockade Not Available HepG-2 Liver Cancer IC50 = 35.52 ± 1.83 µM
dbacp07963 Compound 3a Structure in scheme 2 Synthetic 5c inhibits cancer via kinase blockade Not Available HepG-2 Liver Cancer IC50 = 26.01 ± 2.35 µM
dbacp07965 Compound 3b Structure in scheme 2 Synthetic 5c inhibits cancer via kinase blockade Not Available HepG-2 Liver Cancer IC50 = 13.54 ± 1.45 µM
dbacp07967 Compound 3c Structure in scheme 2 Synthetic 5c inhibits cancer via kinase blockade Not Available HepG-2 Liver Cancer IC50 = 26.64 ± 1.85 µM
dbacp07968 Compound 4a Structure in scheme 2 Synthetic 5c inhibits cancer via kinase blockade Not Available HepG-2 Liver Cancer IC50 = 11.59 ± 2.70 µM
dbacp07970 Compound 4b Structure in scheme 2 Synthetic 5c inhibits cancer via kinase blockade Not Available HepG-2 Liver Cancer IC50 = 10.25 ± 2.20 µM
dbacp07972 Compound 4c Structure in scheme 2 Synthetic 5c inhibits cancer via kinase blockade Not Available HepG-2 Liver Cancer IC50 = 18.84 ± 1.47 µM
dbacp07974 Compound 5a Structure in scheme 2 Synthetic 5c inhibits cancer via kinase blockade Not Available HepG-2 Liver Cancer IC50 = 11.19 ± 1.95 µM
dbacp07976 Compound 5b Structure in scheme 2 Synthetic 5c inhibits cancer via kinase blockade Not Available HepG-2 Liver Cancer IC50 = 10.09 ± 2.05 µM
dbacp07978 Compound 5c Structure in scheme 2 Synthetic 5c inhibits cancer via kinase blockade Not Available HepG-2 Liver Cancer IC50 = 7.53 ± 1.33 µM
dbacp07980 Compound 6a Structure in scheme 2 Synthetic 5c inhibits cancer via kinase blockade Not Available HepG-2 Liver Cancer IC50 = 12.44 ± 1.3 µM
dbacp07982 Compound 6b Structure in scheme 2 Synthetic 5c inhibits cancer via kinase blockade Not Available HepG-2 Liver Cancer IC50 = 11.53 ± 1.70 µM
dbacp07983 Compound 6c Structure in scheme 2 Synthetic 5c inhibits cancer via kinase blockade Not Available HepG-2 Liver Cancer IC50 = 12.07 ± 1.68 µM
dbacp08047 R11-NLS-pep8 RRRRRRRRRRRIKKKRKWEASALVCIRLVTSSKPRTVa NKp44 derived synthetic peptide NKp44-pep8 inhibits PCNA function PrestoBlue assay HepG-2 Liver Cancer ED50 = 5.9 μM
dbacp08059 TAT-327 RKKRRQRRREFLDCFQKF Peptide-327 Peptide 327 blocks Eps8–EGFR CCK-8 assay HepG-2 Liver Cancer EC50 = 68.52 ± 2.96 μM
dbacp08082 Peptide 3a YD Synthetic Inhibit COX-2 enzyme MTT assay HepG-2 Liver Cancer IC50 = 4.8 ± 0.12 µM
dbacp08084 Peptide 3b YD Synthetic Inhibit COX-2 enzyme MTT assay HepG-2 Liver Cancer IC50 = 62.3 ± 0.02 µM
dbacp08115 FR-15 FRRFFKWFRRFFKFF Synthetic Proline-substituted AMP triggers mitochondrial apoptosis MTT assay HepG-2 Liver Cancer IC50 = 2.5 μM
dbacp08119 FR4P FRRPFKWFRRFFKFF Analogue of FR-15 Proline-substituted AMP triggers mitochondrial apoptosis MTT assay HepG-2 Liver Cancer IC50 = 2.5 μM
dbacp08123 FR8P FRRFFKWPRRFFKFF Analogue of FR-15 Proline-substituted AMP triggers mitochondrial apoptosis MTT assay HepG-2 Liver Cancer IC50 = 4.2 μM
dbacp08127 FR11P FRRFFKWFRRPFKFF Analogue of FR-15 Proline-substituted AMP triggers mitochondrial apoptosis MTT assay HepG-2 Liver Cancer IC50 = 4.8 μM
dbacp08131 FR4,8P FRRPFKWPRRFFKFF Analogue of FR-15 Proline-substituted AMP triggers mitochondrial apoptosis MTT assay HepG-2 Liver Cancer IC50 = 5 μM
dbacp08135 FR8,11P FRRFFKWPRRPFKFF Analogue of FR-15 Proline-substituted AMP triggers mitochondrial apoptosis MTT assay HepG-2 Liver Cancer IC50 = 15 μM
dbacp08255 Tr1 Not Available Protein extraction from Spirulina platensis Not Available MTT assay HepG-2 Liver Cancer IC50 = 147.03 μg/mL
dbacp08257 Tr2 Not Available Protein extraction from Spirulina platensis Not Available MTT assay HepG-2 Liver Cancer IC50 = 36.42 μg/mL
dbacp08261 Tr4 Not Available Protein extraction from Spirulina platensis Not Available MTT assay HepG-2 Liver Cancer IC50 = 176.37 μg/mL
dbacp08263 HR HVLSRAPR Fraction identified from Tr1 Not Available MTT assay HepG-2 Liver Cancer 22% inhibition at 500 μg/mL
dbacp08268 ZXR-2 FKIGGFIKKLWRSLLA Synthetic Not Available MTT assay HepG-2 Liver Cancer IC50 = 7.5 ± 1.2 μM
dbacp08297 DN1 ILGKIVKKLVSDF Synthetic Not Available MTT assay HepG-2 Liver Cancer 152.17 ± 7.73 μM
dbacp08298 DN4 ILGKIWKGIVSDF Synthetic Not Available MTT assay HepG-2 Liver Cancer 191.67 ± 12.02 μM
dbacp08421 5-2C NYPQRPCRGDKGPDC Synthetic Not Available MTT assay HepG-2 Liver Cancer IC50 = 3.064 μM