369 result(s) have been found!
| Accession | Name | Sequence | Source/Organism | Mechanism | Assay Type | Cell Line | Cancer Type | Activity |
|---|---|---|---|---|---|---|---|---|
| dbacp02338 | Cecropin A | KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK | Isolated from the giant silk moth, cecropia moth | Membrane damage; Apoptotic cell death; Necrosis | MTT/MTS assay | SCC12 | Skin cancer | IC50 : 1 µM |
| dbacp02339 | Cecropin A | KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK | Isolated from the giant silk moth, cecropia moth | Membrane damage; Apoptotic cell death; Necrosis | MTT/MTS assay | SCC25 | Skin cancer | IC50 : 2.2 µM |
| dbacp02340 | Cecropin A | KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK | Isolated from the giant silk moth, cecropia moth | Membrane damage; Apoptotic cell death; Necrosis | Cell viability assay | SCC25 | Skin cancer | 0.6 ± 0.6% cell growth inhibition at 10 µM |
| dbacp02341 | Cecropin A | KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK | Isolated from the giant silk moth, cecropia moth | Membrane damage; Apoptotic cell death; Necrosis | Cell viability assay | SCC25 | Skin cancer | 107.0 ± 5.0% cell growth inhibition at 1 µM |
| dbacp03189 | HAL-1 | GMWSKILGHLIR | Sweat bees and their analogs | Cell membrane damage | MTT/MTS assay | HeLa | Cervical cancer | IC50 : 11 ± 2 µM |
| dbacp03190 | HAL-1 | GMWSKILGHLIR | Sweat bees and their analogs | Cell membrane damage | MTT/MTS assay | SW | Colon cancer | IC50 : 44 ± 8 µM |
| dbacp03191 | HAL-1 | GMWSKILGHLIR | Sweat bees and their analogs | Cell membrane damage | MTT/MTS assay | CCRF-CEM | Leukemia cancer | IC50 : 49 ± 9 µM |
| dbacp03192 | HAL-1/10 | GMWKKILGKLIR | Sweat bees and their analogs | Cell membrane damage | MTT/MTS assay | HeLa | Cervical cancer | IC50 : 13 ± 2 µM |
| dbacp03193 | HAL-1/10 | GMWKKILGKLIR | Sweat bees and their analogs | Cell membrane damage | MTT/MTS assay | SW | Colon cancer | IC50 : > 60 µM |
| dbacp03194 | HAL-1/10 | GMWKKILGKLIR | Sweat bees and their analogs | Cell membrane damage | MTT/MTS assay | CCRF-CEM | Leukemia cancer | Not found |
| dbacp03195 | HAL-1/12 | GKWSKILGHLIR | Sweat bees and their analogs | Cell membrane damage | MTT/MTS assay | HeLa | Cervical cancer | IC50 : 43 ± 14 µM |
| dbacp03196 | HAL-1/12 | GKWSKILGHLIR | Sweat bees and their analogs | Cell membrane damage | MTT/MTS assay | SW | Colon cancer | IC50 : > 100 µM |
| dbacp03197 | HAL-1/12 | GKWSKILGHLIR | Sweat bees and their analogs | Cell membrane damage | MTT/MTS assay | CCRF-CEM | Leukemia cancer | IC50 : > 40 µM |
| dbacp03198 | HAL-1/15 | GMWSKLLGHLLR | Sweat bees and their analogs | Cell membrane damage | MTT/MTS assay | HeLa | Cervical cancer | IC50 : 14 ± 2 µM |
| dbacp03199 | HAL-1/15 | GMWSKLLGHLLR | Sweat bees and their analogs | Cell membrane damage | MTT/MTS assay | SW | Colon cancer | IC50 : > 40 µM |
| dbacp03200 | HAL-1/15 | GMWSKLLGHLLR | Sweat bees and their analogs | Cell membrane damage | MTT/MTS assay | CCRF-CEM | Leukemia cancer | IC50 : > 40 µM |
| dbacp03201 | HAL-1/17 | KMWSKILGHLIR | Sweat bees and their analogs | Cell membrane damage | MTT/MTS assay | HeLa | Cervical cancer | IC50 : 35 ± 3 µM |
| dbacp03202 | HAL-1/17 | KMWSKILGHLIR | Sweat bees and their analogs | Cell membrane damage | MTT/MTS assay | SW | Colon cancer | IC50 : > 100 µM |
| dbacp03203 | HAL-1/17 | KMWSKILGHLIR | Sweat bees and their analogs | Cell membrane damage | MTT/MTS assay | CCRF-CEM | Leukemia cancer | Not found |
| dbacp03204 | HAL-1/18 | GMWSKILKHLIR | Sweat bees and their analogs | Cell membrane damage | MTT/MTS assay | HeLa | Cervical cancer | IC50 : 4 ± 2 µM |
| dbacp03205 | HAL-1/18 | GMWSKILKHLIR | Sweat bees and their analogs | Cell membrane damage | MTT/MTS assay | SW | Colon cancer | IC50 : 18 ± 2 µM |
| dbacp03206 | HAL-1/18 | GMWSKILKHLIR | Sweat bees and their analogs | Cell membrane damage | MTT/MTS assay | CCRF-CEM | Leukemia cancer | Not found |
| dbacp03207 | HAL-1/19 | GKWKKILGHLIR | Sweat bees and their analogs | Cell membrane damage | MTT/MTS assay | HeLa | Cervical cancer | IC50 : > 100 µM |
| dbacp03208 | HAL-1/19 | GKWKKILGHLIR | Sweat bees and their analogs | Cell membrane damage | MTT/MTS assay | SW | Colon cancer | IC50 : > 100 µM |
| dbacp03209 | HAL-1/19 | GKWKKILGHLIR | Sweat bees and their analogs | Cell membrane damage | MTT/MTS assay | CCRF-CEM | Leukemia cancer | Not found |
| dbacp03210 | HAL-1/20 | GKWSKILGKLIR | Sweat bees and their analogs | Cell membrane damage | MTT/MTS assay | HeLa | Cervical cancer | IC50 : 22 ± 3 µM |
| dbacp03211 | HAL-1/20 | GKWSKILGKLIR | Sweat bees and their analogs | Cell membrane damage | MTT/MTS assay | SW | Colon cancer | IC50 : > 40 µM |
| dbacp03212 | HAL-1/20 | GKWSKILGKLIR | Sweat bees and their analogs | Cell membrane damage | MTT/MTS assay | CCRF-CEM | Leukemia cancer | IC50 : > 40 µM |
| dbacp03213 | HAL-1/21 | GKWKKILGKLIR | Sweat bees and their analogs | Cell membrane damage | MTT/MTS assay | HeLa | Cervical cancer | IC50 : 30 ± 3 µM |
| dbacp03214 | HAL-1/21 | GKWKKILGKLIR | Sweat bees and their analogs | Cell membrane damage | MTT/MTS assay | SW | Colon cancer | IC50 : > 100 µM |
| dbacp03215 | HAL-1/21 | GKWKKILGKLIR | Sweat bees and their analogs | Cell membrane damage | MTT/MTS assay | CCRF-CEM | Leukemia cancer | Not found |
| dbacp03216 | HAL-1/22 | gmwskilghlir | Sweat bees and their analogs | Cell membrane damage | MTT/MTS assay | HeLa | Cervical cancer | IC50 : 15 ±3 µM |
| dbacp03217 | HAL-1/22 | gmwskilghlir | Sweat bees and their analogs | Cell membrane damage | MTT/MTS assay | SW | Colon cancer | IC50 : > 40 µM |
| dbacp03218 | HAL-1/22 | gmwskilghlir | Sweat bees and their analogs | Cell membrane damage | MTT/MTS assay | CCRF-CEM | Leukemia cancer | Not found |
| dbacp03219 | HAL-1/29 | GMWSKILGHLIR | Sweat bees and their analogs | Cell membrane damage | MTT/MTS assay | HeLa | Cervical cancer | IC50 : > 100 µM |
| dbacp03220 | HAL-1/29 | GMWSKILGHLIR | Sweat bees and their analogs | Cell membrane damage | MTT/MTS assay | SW | Colon cancer | Not found |
| dbacp03221 | HAL-1/29 | GMWSKILGHLIR | Sweat bees and their analogs | Cell membrane damage | MTT/MTS assay | CCRF-CEM | Leukemia cancer | Not found |
| dbacp03222 | HAL-1/4 | GMWSKILGHLKR | Sweat bees and their analogs | Cell membrane damage | MTT/MTS assay | HeLa | Cervical cancer | IC50 : > 100 µM |
| dbacp03223 | HAL-1/4 | GMWSKILGHLKR | Sweat bees and their analogs | Cell membrane damage | MTT/MTS assay | SW | Colon cancer | Not found |
| dbacp03224 | HAL-1/4 | GMWSKILGHLKR | Sweat bees and their analogs | Cell membrane damage | MTT/MTS assay | CCRF-CEM | Leukemia cancer | Not found |
| dbacp03225 | HAL-1/5 | GMWKKILGHLIR | Sweat bees and their analogs | Cell membrane damage | MTT/MTS assay | HeLa | Cervical cancer | IC50 : 9 ± 1 µM |
| dbacp03226 | HAL-1/5 | GMWKKILGHLIR | Sweat bees and their analogs | Cell membrane damage | MTT/MTS assay | SW | Colon cancer | IC50 : 44 ± 5 µM |
| dbacp03227 | HAL-1/5 | GMWKKILGHLIR | Sweat bees and their analogs | Cell membrane damage | MTT/MTS assay | CCRF-CEM | Leukemia cancer | IC50 : > 40 µM |
| dbacp03228 | HAL-1/6 | GMWSKILGHLIK | Sweat bees and their analogs | Cell membrane damage | MTT/MTS assay | HeLa | Cervical cancer | IC50 : 15 ± 1 µM |
| dbacp03229 | HAL-1/6 | GMWSKILGHLIK | Sweat bees and their analogs | Cell membrane damage | MTT/MTS assay | SW | Colon cancer | IC50 : > 100 µM |
| dbacp03230 | HAL-1/6 | GMWSKILGHLIK | Sweat bees and their analogs | Cell membrane damage | MTT/MTS assay | CCRF-CEM | Leukemia cancer | Not found |
| dbacp03231 | HAL-1/9 | GMWSKILGKLIR | Sweat bees and their analogs | Cell membrane damage | MTT/MTS assay | HeLa | Cervical cancer | IC50 : 9 ± 1 µM |
| dbacp03232 | HAL-1/9 | GMWSKILGKLIR | Sweat bees and their analogs | Cell membrane damage | MTT/MTS assay | SW | Colon cancer | IC50 : > 50 µM |
| dbacp03233 | HAL-1/9 | GMWSKILGKLIR | Sweat bees and their analogs | Cell membrane damage | MTT/MTS assay | CCRF-CEM | Leukemia cancer | IC50 : 30 ± 10 µM |
| dbacp03234 | HAL-2 | GKWMSLLKHILK | Sweat bees and their analogs | Cell membrane damage | MTT/MTS assay | HeLa | Cervical cancer | IC50 : 12 ± 1 µM |
| dbacp03235 | HAL-2 | GKWMSLLKHILK | Sweat bees and their analogs | Cell membrane damage | MTT/MTS assay | SW | Colon cancer | IC50 : 35 ± 3 µM |
| dbacp03236 | HAL-2 | GKWMSLLKHILK | Sweat bees and their analogs | Cell membrane damage | MTT/MTS assay | CCRF-CEM | Leukemia cancer | IC50 : 34 µM |
| dbacp03237 | HAL-2/1 | GKWKSLLKHILK | Sweat bees and their analogs | Cell membrane damage | MTT/MTS assay | HeLa | Cervical cancer | IC50 : 14 ± 2 µM |
| dbacp03238 | HAL-2/1 | GKWKSLLKHILK | Sweat bees and their analogs | Cell membrane damage | MTT/MTS assay | SW | Colon cancer | IC50 : > 100 µM |
| dbacp03239 | HAL-2/1 | GKWKSLLKHILK | Sweat bees and their analogs | Cell membrane damage | MTT/MTS assay | CCRF-CEM | Leukemia cancer | IC50 : > 40 µM |
| dbacp03240 | HAL-2/11 | GKWLSLLKHILK | Sweat bees and their analogs | Cell membrane damage | MTT/MTS assay | HeLa | Cervical cancer | IC50 : 14 ± 3 µM |
| dbacp03241 | HAL-2/11 | GKWLSLLKHILK | Sweat bees and their analogs | Cell membrane damage | MTT/MTS assay | SW | Colon cancer | IC50 : 40 µM |
| dbacp03242 | HAL-2/11 | GKWLSLLKHILK | Sweat bees and their analogs | Cell membrane damage | MTT/MTS assay | CCRF-CEM | Leukemia cancer | Not found |
| dbacp03243 | HAL-2/13 | GKWMTLLKHILK | Sweat bees and their analogs | Cell membrane damage | MTT/MTS assay | HeLa | Cervical cancer | IC50 : 13 ± 3 µM |
| dbacp03244 | HAL-2/13 | GKWMTLLKHILK | Sweat bees and their analogs | Cell membrane damage | MTT/MTS assay | SW | Colon cancer | IC50 : > 60 µM |
| dbacp03245 | HAL-2/13 | GKWMTLLKHILK | Sweat bees and their analogs | Cell membrane damage | MTT/MTS assay | CCRF-CEM | Leukemia cancer | Not found |
| dbacp03246 | HAL-2/18 | GKWMSLLKHIWK | Sweat bees and their analogs | Cell membrane damage | MTT/MTS assay | HeLa | Cervical cancer | IC50 : 14 ± 2 µM |
| dbacp03247 | HAL-2/18 | GKWMSLLKHIWK | Sweat bees and their analogs | Cell membrane damage | MTT/MTS assay | SW | Colon cancer | IC50 : > 40 µM |
| dbacp03248 | HAL-2/18 | GKWMSLLKHIWK | Sweat bees and their analogs | Cell membrane damage | MTT/MTS assay | CCRF-CEM | Leukemia cancer | Not found |
| dbacp03249 | HAL-2/19 | GKWMSLLKHWLK | Sweat bees and their analogs | Cell membrane damage | MTT/MTS assay | HeLa | Cervical cancer | IC50 : 16 ± 4 µM |
| dbacp03250 | HAL-2/19 | GKWMSLLKHWLK | Sweat bees and their analogs | Cell membrane damage | MTT/MTS assay | SW | Colon cancer | IC50 : > 40 µM |
| dbacp03251 | HAL-2/19 | GKWMSLLKHWLK | Sweat bees and their analogs | Cell membrane damage | MTT/MTS assay | CCRF-CEM | Leukemia cancer | Not found |
| dbacp03252 | HAL-2/2 | GKWMKLLKHILK | Sweat bees and their analogs | Cell membrane damage | MTT/MTS assay | HeLa | Cervical cancer | IC50 : 6 ± 1 µM |
| dbacp03253 | HAL-2/2 | GKWMKLLKHILK | Sweat bees and their analogs | Cell membrane damage | MTT/MTS assay | SW | Colon cancer | IC50 : 35 ± 5 µM |
| dbacp03254 | HAL-2/2 | GKWMKLLKHILK | Sweat bees and their analogs | Cell membrane damage | MTT/MTS assay | CCRF-CEM | Leukemia cancer | IC50 : > 40 µM |
| dbacp03255 | HAL-2/20 | GKWMSLWKHILK | Sweat bees and their analogs | Cell membrane damage | MTT/MTS assay | HeLa | Cervical cancer | IC50 : 30 ± 5 µM |
| dbacp03256 | HAL-2/20 | GKWMSLWKHILK | Sweat bees and their analogs | Cell membrane damage | MTT/MTS assay | SW | Colon cancer | IC50 : > 40 µM |
| dbacp03257 | HAL-2/20 | GKWMSLWKHILK | Sweat bees and their analogs | Cell membrane damage | MTT/MTS assay | CCRF-CEM | Leukemia cancer | Not found |
| dbacp03258 | HAL-2/22 | gkwmsllkhilk | Sweat bees and their analogs | Cell membrane damage | MTT/MTS assay | HeLa | Cervical cancer | IC50 : 12 µM |
| dbacp03259 | HAL-2/22 | gkwmsllkhilk | Sweat bees and their analogs | Cell membrane damage | MTT/MTS assay | SW | Colon cancer | IC50 : > 100 µM |
| dbacp03260 | HAL-2/22 | gkwmsllkhilk | Sweat bees and their analogs | Cell membrane damage | MTT/MTS assay | CCRF-CEM | Leukemia cancer | Not found |
| dbacp03261 | HAL-2/24 | GKFMSLLKHILK | Sweat bees and their analogs | Cell membrane damage | MTT/MTS assay | HeLa | Cervical cancer | IC50 : 34 µM |
| dbacp03262 | HAL-2/24 | GKFMSLLKHILK | Sweat bees and their analogs | Cell membrane damage | MTT/MTS assay | SW | Colon cancer | IC50 : > 40 µM |
| dbacp03263 | HAL-2/24 | GKFMSLLKHILK | Sweat bees and their analogs | Cell membrane damage | MTT/MTS assay | CCRF-CEM | Leukemia cancer | Not found |
| dbacp03264 | HAL-2/4 | GKWMSLLKKILK | Sweat bees and their analogs | Cell membrane damage | MTT/MTS assay | HeLa | Cervical cancer | IC50 : > 40 µM |
| dbacp03265 | HAL-2/4 | GKWMSLLKKILK | Sweat bees and their analogs | Cell membrane damage | MTT/MTS assay | SW | Colon cancer | IC50 : 38 ± 6 µM |
| dbacp03266 | HAL-2/4 | GKWMSLLKKILK | Sweat bees and their analogs | Cell membrane damage | MTT/MTS assay | CCRF-CEM | Leukemia cancer | Not found |
| dbacp03267 | HAL-2/6 | GKWMSFLKHILK | Sweat bees and their analogs | Cell membrane damage | MTT/MTS assay | HeLa | Cervical cancer | IC50 : 23 ± 3 µM |
| dbacp03268 | HAL-2/6 | GKWMSFLKHILK | Sweat bees and their analogs | Cell membrane damage | MTT/MTS assay | SW | Colon cancer | IC50 : > 40 µM |
| dbacp03269 | HAL-2/6 | GKWMSFLKHILK | Sweat bees and their analogs | Cell membrane damage | MTT/MTS assay | CCRF-CEM | Leukemia cancer | Not found |
| dbacp03270 | HAL-2/8 | GKWMSLLKHILK | Sweat bees and their analogs | Cell membrane damage | MTT/MTS assay | HeLa | Cervical cancer | IC50 : 15 ± 3 µM |
| dbacp03271 | HAL-2/8 | GKWMSLLKHILK | Sweat bees and their analogs | Cell membrane damage | MTT/MTS assay | SW | Colon cancer | IC50 : > 40 µM |
| dbacp03272 | HAL-2/8 | GKWMSLLKHILK | Sweat bees and their analogs | Cell membrane damage | MTT/MTS assay | CCRF-CEM | Leukemia cancer | Not found |
| dbacp04180 | LL-III | VNWKKILGKIIKVVK | Lasioglossin III and its analogs | Cell membrane damage | MTT/MTS assay | HeLa | Cervical cancer | IC50 : 4 ± 1 µM |
| dbacp04181 | LL-III | VNWKKILGKIIKVVK | Lasioglossin III and its analogs | Cell membrane damage | MTT/MTS assay | SW | Colon cancer | IC50 : 18 ±4 µM |
| dbacp04182 | LL-III | VNWKKILGKIIKVVK | Lasioglossin III and its analogs | Cell membrane damage | MTT/MTS assay | CCRF-CEM | Leukemia cancer | IC50 : 5 ± 3 µM |
| dbacp04183 | LL-III/1 | VNWKKILAKIIKVVK | Lasioglossin III and its analogs | Cell membrane damage | MTT/MTS assay | HeLa | Cervical cancer | IC50 : 3 ± 1 µM |
| dbacp04184 | LL-III/1 | VNWKKILAKIIKVVK | Lasioglossin III and its analogs | Cell membrane damage | MTT/MTS assay | SW | Colon cancer | IC50 : 12 ± 3 µM |
| dbacp04185 | LL-III/1 | VNWKKILAKIIKVVK | Lasioglossin III and its analogs | Cell membrane damage | MTT/MTS assay | CCRF-CEM | Leukemia cancer | IC50 : 3 ± 1 µM |
| dbacp04186 | LL-III/10 | KNWKKILGKIIKVVK | Lasioglossin III and its analogs | Cell membrane damage | MTT/MTS assay | HeLa | Cervical cancer | IC50 : 9 ± 4 µM |
| dbacp04187 | LL-III/10 | KNWKKILGKIIKVVK | Lasioglossin III and its analogs | Cell membrane damage | MTT/MTS assay | SW | Colon cancer | Not found |
| dbacp04188 | LL-III/10 | KNWKKILGKIIKVVK | Lasioglossin III and its analogs | Cell membrane damage | MTT/MTS assay | CCRF-CEM | Leukemia cancer | IC50 : 9 µM |
| dbacp04189 | LL-III/11 | VNWKKIILGKIIKVVK | Lasioglossin III and its analogs | Cell membrane damage | MTT/MTS assay | HeLa | Cervical cancer | IC50 : 8 ± 1 µM |
| dbacp04190 | LL-III/11 | VNWKKIILGKIIKVVK | Lasioglossin III and its analogs | Cell membrane damage | MTT/MTS assay | SW | Colon cancer | IC50 : 48 µM |
| dbacp04191 | LL-III/11 | VNWKKIILGKIIKVVK | Lasioglossin III and its analogs | Cell membrane damage | MTT/MTS assay | CCRF-CEM | Leukemia cancer | IC50 : 4 ± 1 µM |
| dbacp04192 | LL-III/12 | vnwkkilgkiikvvk | Lasioglossin III and its analogs | Cell membrane damage | MTT/MTS assay | HeLa | Cervical cancer | IC50 : 6 ± 2 µM |
| dbacp04193 | LL-III/12 | vnwkkilgkiikvvk | Lasioglossin III and its analogs | Cell membrane damage | MTT/MTS assay | SW | Colon cancer | IC50 : 20 µM |
| dbacp04194 | LL-III/12 | vnwkkilgkiikvvk | Lasioglossin III and its analogs | Cell membrane damage | MTT/MTS assay | CCRF-CEM | Leukemia cancer | IC50 : 5 ± 2 µM |
| dbacp04195 | LL-III/15 | VNFKKLLGKLLKVVK | Lasioglossin III and its analogs | Cell membrane damage | MTT/MTS assay | HeLa | Cervical cancer | IC50 : 7 ± 1 µM |
| dbacp04196 | LL-III/15 | VNFKKLLGKLLKVVK | Lasioglossin III and its analogs | Cell membrane damage | MTT/MTS assay | SW | Colon cancer | IC50 : 42 µM |
| dbacp04197 | LL-III/15 | VNFKKLLGKLLKVVK | Lasioglossin III and its analogs | Cell membrane damage | MTT/MTS assay | CCRF-CEM | Leukemia cancer | IC50 : 9 ± 3 µM |
| dbacp04198 | LL-III/16 | VN-NAl-KKLLGKLLKVVK | Lasioglossin III and its analogs | Cell membrane damage | MTT/MTS assay | HeLa | Cervical cancer | IC50 : 6 ± 1 µM |
| dbacp04199 | LL-III/16 | VN-NAl-KKLLGKLLKVVK | Lasioglossin III and its analogs | Cell membrane damage | MTT/MTS assay | SW | Colon cancer | Not found |
| dbacp04200 | LL-III/16 | VN-NAl-KKLLGKLLKVVK | Lasioglossin III and its analogs | Cell membrane damage | MTT/MTS assay | CCRF-CEM | Leukemia cancer | Not found |
| dbacp04201 | LL-III/17 | VNWRRILGRIIRVVR | Lasioglossin III and its analogs | Cell membrane damage | MTT/MTS assay | HeLa | Cervical cancer | IC50 : 9 µM |
| dbacp04202 | LL-III/17 | VNWRRILGRIIRVVR | Lasioglossin III and its analogs | Cell membrane damage | MTT/MTS assay | SW | Colon cancer | Not found |
| dbacp04203 | LL-III/17 | VNWRRILGRIIRVVR | Lasioglossin III and its analogs | Cell membrane damage | MTT/MTS assay | CCRF-CEM | Leukemia cancer | Not found |
| dbacp04204 | LL-III/18 | KNWKKILKKIIKVVK | Lasioglossin III and its analogs | Cell membrane damage | MTT/MTS assay | HeLa | Cervical cancer | IC50 : 3 µM |
| dbacp04205 | LL-III/18 | KNWKKILKKIIKVVK | Lasioglossin III and its analogs | Cell membrane damage | MTT/MTS assay | SW | Colon cancer | Not found |
| dbacp04206 | LL-III/18 | KNWKKILKKIIKVVK | Lasioglossin III and its analogs | Cell membrane damage | MTT/MTS assay | CCRF-CEM | Leukemia cancer | IC50 : 7 ± 2 µM |
| dbacp04207 | LL-III/19 | VNWKK-Aib-LGK-Aib-IK-Aib-VK | Lasioglossin III and its analogs | Cell membrane damage | MTT/MTS assay | HeLa | Cervical cancer | IC50 : 3 ± 1 µM |
| dbacp04208 | LL-III/19 | VNWKK-Aib-LGK-Aib-IK-Aib-VK | Lasioglossin III and its analogs | Cell membrane damage | MTT/MTS assay | SW | Colon cancer | IC50 : 28 µM |
| dbacp04209 | LL-III/19 | VNWKK-Aib-LGK-Aib-IK-Aib-VK | Lasioglossin III and its analogs | Cell membrane damage | MTT/MTS assay | CCRF-CEM | Leukemia cancer | IC50 : 8 ± 2 µM |
| dbacp04210 | LL-III/2 | NVWKKILGKIIKVVK | Lasioglossin III and its analogs | Cell membrane damage | MTT/MTS assay | HeLa | Cervical cancer | Not found |
| dbacp04211 | LL-III/2 | NVWKKILGKIIKVVK | Lasioglossin III and its analogs | Cell membrane damage | MTT/MTS assay | SW | Colon cancer | IC50 : 11 µM |
| dbacp04212 | LL-III/2 | NVWKKILGKIIKVVK | Lasioglossin III and its analogs | Cell membrane damage | MTT/MTS assay | CCRF-CEM | Leukemia cancer | IC50 : 7 ± 2 µM |
| dbacp04213 | LL-III/22 | KNWKK-Aib-LKK-Aib-IK-Aib-VK | Lasioglossin III and its analogs | Cell membrane damage | MTT/MTS assay | HeLa | Cervical cancer | IC50 : 11 ± 7 µM |
| dbacp04214 | LL-III/22 | KNWKK-Aib-LKK-Aib-IK-Aib-VK | Lasioglossin III and its analogs | Cell membrane damage | MTT/MTS assay | SW | Colon cancer | IC50 : > 100 µM |
| dbacp04215 | LL-III/22 | KNWKK-Aib-LKK-Aib-IK-Aib-VK | Lasioglossin III and its analogs | Cell membrane damage | MTT/MTS assay | CCRF-CEM | Leukemia cancer | IC50 : 25 ± 4 µM |
| dbacp04216 | LL-III/23 | VNWKKLLGKLLKVVK | Lasioglossin III and its analogs | Cell membrane damage | MTT/MTS assay | HeLa | Cervical cancer | IC50 : 4 µM |
| dbacp04217 | LL-III/23 | VNWKKLLGKLLKVVK | Lasioglossin III and its analogs | Cell membrane damage | MTT/MTS assay | SW | Colon cancer | IC50 : 15 µM |
| dbacp04218 | LL-III/23 | VNWKKLLGKLLKVVK | Lasioglossin III and its analogs | Cell membrane damage | MTT/MTS assay | CCRF-CEM | Leukemia cancer | IC50 : 6 µM |
| dbacp04219 | LL-III/24 | VNWOOILGOIIOVVO | Lasioglossin III and its analogs | Cell membrane damage | MTT/MTS assay | HeLa | Cervical cancer | IC50 : 3 ± 1 µM |
| dbacp04220 | LL-III/24 | VNWOOILGOIIOVVO | Lasioglossin III and its analogs | Cell membrane damage | MTT/MTS assay | SW | Colon cancer | IC50 : 20 µM |
| dbacp04221 | LL-III/24 | VNWOOILGOIIOVVO | Lasioglossin III and its analogs | Cell membrane damage | MTT/MTS assay | CCRF-CEM | Leukemia cancer | IC50 : 5 ± 2 µM |
| dbacp04222 | LL-III/25 | vnwkkllgkllkvvk | Lasioglossin III and its analogs | Cell membrane damage | MTT/MTS assay | HeLa | Cervical cancer | IC50 : 4 ± 2 µM |
| dbacp04223 | LL-III/25 | vnwkkllgkllkvvk | Lasioglossin III and its analogs | Cell membrane damage | MTT/MTS assay | SW | Colon cancer | IC50 : 20 µM |
| dbacp04224 | LL-III/25 | vnwkkllgkllkvvk | Lasioglossin III and its analogs | Cell membrane damage | MTT/MTS assay | CCRF-CEM | Leukemia cancer | IC50 : 4 µM |
| dbacp04225 | LL-III/26 | VYWKKILGKIIKVVK | Lasioglossin III and its analogs | Cell membrane damage | MTT/MTS assay | HeLa | Cervical cancer | IC50 : 5 ±1 µM |
| dbacp04226 | LL-III/26 | VYWKKILGKIIKVVK | Lasioglossin III and its analogs | Cell membrane damage | MTT/MTS assay | SW | Colon cancer | IC50 : 30 µM |
| dbacp04227 | LL-III/26 | VYWKKILGKIIKVVK | Lasioglossin III and its analogs | Cell membrane damage | MTT/MTS assay | CCRF-CEM | Leukemia cancer | IC50 : 6 µM |
| dbacp04228 | LL-III/27 | VNWKKVLGKVVKVVK | Lasioglossin III and its analogs | Cell membrane damage | MTT/MTS assay | HeLa | Cervical cancer | IC50 : 13 ± 2 µM |
| dbacp04229 | LL-III/27 | VNWKKVLGKVVKVVK | Lasioglossin III and its analogs | Cell membrane damage | MTT/MTS assay | SW | Colon cancer | IC50 : > 100 µM |
| dbacp04230 | LL-III/27 | VNWKKVLGKVVKVVK | Lasioglossin III and its analogs | Cell membrane damage | MTT/MTS assay | CCRF-CEM | Leukemia cancer | IC50 : 18 µM |
| dbacp04231 | LL-III/3 | VNWKKILKKIIKVVK | Lasioglossin III and its analogs | Cell membrane damage | MTT/MTS assay | HeLa | Cervical cancer | Not found |
| dbacp04232 | LL-III/3 | VNWKKILKKIIKVVK | Lasioglossin III and its analogs | Cell membrane damage | MTT/MTS assay | SW | Colon cancer | IC50 : > 40 µM |
| dbacp04233 | LL-III/3 | VNWKKILKKIIKVVK | Lasioglossin III and its analogs | Cell membrane damage | MTT/MTS assay | CCRF-CEM | Leukemia cancer | Not found |
| dbacp04234 | LL-III/34 | NKWKKILGKIIKVVK | Lasioglossin III and its analogs | Cell membrane damage | MTT/MTS assay | HeLa | Cervical cancer | IC50 : 5 ± 2 µM |
| dbacp04235 | LL-III/34 | NKWKKILGKIIKVVK | Lasioglossin III and its analogs | Cell membrane damage | MTT/MTS assay | SW | Colon cancer | IC50 : 37 µM |
| dbacp04236 | LL-III/34 | NKWKKILGKIIKVVK | Lasioglossin III and its analogs | Cell membrane damage | MTT/MTS assay | CCRF-CEM | Leukemia cancer | IC50 : 5 ± 3 µM |
| dbacp04237 | LL-III/36 | VNWKKILAKIIKVVK | Lasioglossin III and its analogs | Cell membrane damage | MTT/MTS assay | HeLa | Cervical cancer | IC50 : 8 µM |
| dbacp04238 | LL-III/36 | VNWKKILAKIIKVVK | Lasioglossin III and its analogs | Cell membrane damage | MTT/MTS assay | SW | Colon cancer | Not found |
| dbacp04239 | LL-III/36 | VNWKKILAKIIKVVK | Lasioglossin III and its analogs | Cell membrane damage | MTT/MTS assay | CCRF-CEM | Leukemia cancer | Not found |
| dbacp04240 | LL-III/37 | VNWKKILGKIIKVVK | Lasioglossin III and its analogs | Cell membrane damage | MTT/MTS assay | SW | Colon cancer | IC50 : 5 ± 1 µM |
| dbacp04241 | LL-III/37 | VNWKKILGKIIKVVK | Lasioglossin III and its analogs | Cell membrane damage | MTT/MTS assay | SW | Colon cancer | IC50 : 13 µM |
| dbacp04242 | LL-III/37 | VNWKKILGKIIKVVK | Lasioglossin III and its analogs | Cell membrane damage | MTT/MTS assay | CCRF-CEM | Leukemia cancer | IC50 : 4 ± 1 µM |
| dbacp04243 | LL-III/4 | VNWKKILGKIKKVVK | Lasioglossin III and its analogs | Cell membrane damage | MTT/MTS assay | HeLa | Cervical cancer | IC50 : 7 ± 1 µM |
| dbacp04244 | LL-III/4 | VNWKKILGKIKKVVK | Lasioglossin III and its analogs | Cell membrane damage | MTT/MTS assay | SW | Colon cancer | IC50 : > 40 µM |
| dbacp04245 | LL-III/4 | VNWKKILGKIKKVVK | Lasioglossin III and its analogs | Cell membrane damage | MTT/MTS assay | CCRF-CEM | Leukemia cancer | IC50 : 18 µM |
| dbacp04246 | LL-III/6 | VNWKKILPKIIKVVK | Lasioglossin III and its analogs | Cell membrane damage | MTT/MTS assay | HeLa | Cervical cancer | IC50 : > 40 µM |
| dbacp04247 | LL-III/6 | VNWKKILPKIIKVVK | Lasioglossin III and its analogs | Cell membrane damage | MTT/MTS assay | SW | Colon cancer | Not found |
| dbacp04248 | LL-III/6 | VNWKKILPKIIKVVK | Lasioglossin III and its analogs | Cell membrane damage | MTT/MTS assay | CCRF-CEM | Leukemia cancer | IC50 : 6 ± 3 µM |
| dbacp04249 | LL-III/8 | VNWKKILGKIIKVVK | Lasioglossin III and its analogs | Cell membrane damage | MTT/MTS assay | HeLa | Cervical cancer | IC50 : 12 ± 1 µM |
| dbacp04250 | LL-III/8 | VNWKKILGKIIKVVK | Lasioglossin III and its analogs | Cell membrane damage | MTT/MTS assay | SW | Colon cancer | Not found |
| dbacp04251 | LL-III/8 | VNWKKILGKIIKVVK | Lasioglossin III and its analogs | Cell membrane damage | MTT/MTS assay | CCRF-CEM | Leukemia cancer | IC50 : 9 µM |
| dbacp04252 | LL-III/9 | VNWKKILGKIIKVVK | Lasioglossin III and its analogs | Cell membrane damage | MTT/MTS assay | HeLa | Cervical cancer | IC50 : 3 ± 1 µM |
| dbacp04253 | LL-III/9 | VNWKKILGKIIKVVK | Lasioglossin III and its analogs | Cell membrane damage | MTT/MTS assay | SW | Colon cancer | IC50 : 25 ± 5 µM |
| dbacp04254 | LL-III/9 | VNWKKILGKIIKVVK | Lasioglossin III and its analogs | Cell membrane damage | MTT/MTS assay | CCRF-CEM | Leukemia cancer | Not found |
| dbacp04376 | MAC1 | GFGMALKLLKKVL | Wallabies and their analogs | Cell membrane damage | MTT/MTS assay | HeLa | Cervical cancer | IC50 : 10 ± 4 µM |
| dbacp04377 | MAC1 | GFGMALKLLKKVL | Wallabies and their analogs | Cell membrane damage | MTT/MTS assay | SW | Colon cancer | IC50 : 23 ± 4 µM |
| dbacp04378 | MAC1 | GFGMALKLLKKVL | Wallabies and their analogs | Cell membrane damage | MTT/MTS assay | CCRF-CEM | Leukemia cancer | IC50 : 12 ± 6 µM |
| dbacp04379 | MAC1/1 | gfgmalkllkkvl | Wallabies and their analogs | Cell membrane damage | MTT/MTS assay | HeLa | Cervical cancer | IC50 : 12 ± 4 µM |
| dbacp04380 | MAC1/1 | gfgmalkllkkvl | Wallabies and their analogs | Cell membrane damage | MTT/MTS assay | SW | Colon cancer | IC50 : 19 ± 2 µM |
| dbacp04381 | MAC1/1 | gfgmalkllkkvl | Wallabies and their analogs | Cell membrane damage | MTT/MTS assay | CCRF-CEM | Leukemia cancer | IC50 : 11 µM |
| dbacp04382 | MAC1/10 | GFKMALKLLKKVL | Wallabies and their analogs | Cell membrane damage | MTT/MTS assay | HeLa | Cervical cancer | IC50 : 15 ± 6 µM |
| dbacp04383 | MAC1/10 | GFKMALKLLKKVL | Wallabies and their analogs | Cell membrane damage | MTT/MTS assay | SW | Colon cancer | Not found |
| dbacp04384 | MAC1/10 | GFKMALKLLKKVL | Wallabies and their analogs | Cell membrane damage | MTT/MTS assay | CCRF-CEM | Leukemia cancer | IC50 : 16 µM |
| dbacp04385 | MAC1/16 | GFGMALKLLKKVL-NH2 | Wallabies and their analogs | Cell membrane damage | MTT/MTS assay | HeLa | Cervical cancer | IC50 : 32 ± 2 µM |
| dbacp04386 | MAC1/16 | GFGMALKLLKKVL-NH2 | Wallabies and their analogs | Cell membrane damage | MTT/MTS assay | SW | Colon cancer | IC50 : > 100 µM |
| dbacp04387 | MAC1/16 | GFGMALKLLKKVL-NH2 | Wallabies and their analogs | Cell membrane damage | MTT/MTS assay | CCRF-CEM | Leukemia cancer | IC50 : 70 µM |
| dbacp04388 | MAC1/19 | GFGMALKLLKKVL-NH2 | Wallabies and their analogs | Cell membrane damage | MTT/MTS assay | HeLa | Cervical cancer | IC50 : 21 ± 4 µM |
| dbacp04389 | MAC1/19 | GFGMALKLLKKVL-NH2 | Wallabies and their analogs | Cell membrane damage | MTT/MTS assay | SW | Colon cancer | IC50 : 68 ± 2 µM |
| dbacp04390 | MAC1/19 | GFGMALKLLKKVL-NH2 | Wallabies and their analogs | Cell membrane damage | MTT/MTS assay | CCRF-CEM | Leukemia cancer | IC50 : 43 ± 11 µM |
| dbacp04391 | MAC1/2 | AFGMALKLLKKVL | Wallabies and their analogs | Cell membrane damage | MTT/MTS assay | HeLa | Cervical cancer | IC50 : 16 ± 3 µM |
| dbacp04392 | MAC1/2 | AFGMALKLLKKVL | Wallabies and their analogs | Cell membrane damage | MTT/MTS assay | SW | Colon cancer | IC50 : 16 µM |
| dbacp04393 | MAC1/2 | AFGMALKLLKKVL | Wallabies and their analogs | Cell membrane damage | MTT/MTS assay | CCRF-CEM | Leukemia cancer | IC50 : 17 µM |
| dbacp04394 | MAC1/20 | GFGMALOLLOOVL | Wallabies and their analogs | Cell membrane damage | MTT/MTS assay | HeLa | Cervical cancer | IC50 : 10 ± 1 µM |
| dbacp04395 | MAC1/20 | GFGMALOLLOOVL | Wallabies and their analogs | Cell membrane damage | MTT/MTS assay | SW | Colon cancer | IC50 : 35 ± 4 µM |
| dbacp04396 | MAC1/20 | GFGMALOLLOOVL | Wallabies and their analogs | Cell membrane damage | MTT/MTS assay | CCRF-CEM | Leukemia cancer | IC50 : 25 ± 3 µM |
| dbacp04397 | MAC1/21 | GFGMALRLLRRVL | Wallabies and their analogs | Cell membrane damage | MTT/MTS assay | HeLa | Cervical cancer | IC50 : 9 ± 3 µM |
| dbacp04398 | MAC1/21 | GFGMALRLLRRVL | Wallabies and their analogs | Cell membrane damage | MTT/MTS assay | SW | Colon cancer | IC50 : 17 ± 2 µM |
| dbacp04399 | MAC1/21 | GFGMALRLLRRVL | Wallabies and their analogs | Cell membrane damage | MTT/MTS assay | CCRF-CEM | Leukemia cancer | IC50 : 22 ± 4 µM |
| dbacp04400 | MAC1/24 | GFGMALKL-(AC6C)-KKVL | Wallabies and their analogs | Cell membrane damage | MTT/MTS assay | HeLa | Cervical cancer | IC50 : 8 ± 2 µM |
| dbacp04401 | MAC1/24 | GFGMALKL-(AC6C)-KKVL | Wallabies and their analogs | Cell membrane damage | MTT/MTS assay | SW | Colon cancer | IC50 : 16 ± 1 µM |
| dbacp04402 | MAC1/24 | GFGMALKL-(AC6C)-KKVL | Wallabies and their analogs | Cell membrane damage | MTT/MTS assay | CCRF-CEM | Leukemia cancer | IC50 : 11 µM |
| dbacp04403 | MAC1/25 | GFGMALK-(AC6C)-LKKVL | Wallabies and their analogs | Cell membrane damage | MTT/MTS assay | HeLa | Cervical cancer | IC50 : 7 ± 1 µM |
| dbacp04404 | MAC1/25 | GFGMALK-(AC6C)-LKKVL | Wallabies and their analogs | Cell membrane damage | MTT/MTS assay | SW | Colon cancer | IC50 : 14 ± 1 µM |
| dbacp04405 | MAC1/25 | GFGMALK-(AC6C)-LKKVL | Wallabies and their analogs | Cell membrane damage | MTT/MTS assay | CCRF-CEM | Leukemia cancer | IC50 : 12 ± 2 µM |
| dbacp04406 | MAC1/26 | GFGMA-(AC6C)-KLLKKVL | Wallabies and their analogs | Cell membrane damage | MTT/MTS assay | HeLa | Cervical cancer | IC50 : 8 ± 2 µM |
| dbacp04407 | MAC1/26 | GFGMA-(AC6C)-KLLKKVL | Wallabies and their analogs | Cell membrane damage | MTT/MTS assay | SW | Colon cancer | IC50 : 18 ± 1 µM |
| dbacp04408 | MAC1/26 | GFGMA-(AC6C)-KLLKKVL | Wallabies and their analogs | Cell membrane damage | MTT/MTS assay | CCRF-CEM | Leukemia cancer | IC50 : 9 ± 2 µM |
| dbacp04409 | MAC1/3 | LFGMALKLLKKVL | Wallabies and their analogs | Cell membrane damage | MTT/MTS assay | HeLa | Cervical cancer | IC50 : 9 ± 2 µM |
| dbacp04410 | MAC1/3 | LFGMALKLLKKVL | Wallabies and their analogs | Cell membrane damage | MTT/MTS assay | SW | Colon cancer | IC50 : 11 ± 1 µM |
| dbacp04411 | MAC1/3 | LFGMALKLLKKVL | Wallabies and their analogs | Cell membrane damage | MTT/MTS assay | CCRF-CEM | Leukemia cancer | IC50 : 22 µM |
| dbacp04412 | MAC1/4 | GFGMALKLLKKVL-NH2 | Wallabies and their analogs | Cell membrane damage | MTT/MTS assay | HeLa | Cervical cancer | IC50 : 15 ± 5 µM |
| dbacp04413 | MAC1/4 | GFGMALKLLKKVL-NH2 | Wallabies and their analogs | Cell membrane damage | MTT/MTS assay | SW | Colon cancer | IC50 : 49 ± 9 µM |
| dbacp04414 | MAC1/4 | GFGMALKLLKKVL-NH2 | Wallabies and their analogs | Cell membrane damage | MTT/MTS assay | CCRF-CEM | Leukemia cancer | IC50 : 29 µM |
| dbacp04415 | MAC1/6 | GFGMALKLLKKVL-NH2 | Wallabies and their analogs | Cell membrane damage | MTT/MTS assay | HeLa | Cervical cancer | IC50 : 8 ± 2 µM |
| dbacp04416 | MAC1/6 | GFGMALKLLKKVL-NH2 | Wallabies and their analogs | Cell membrane damage | MTT/MTS assay | SW | Colon cancer | IC50 : 29 ± 3 µM |
| dbacp04417 | MAC1/6 | GFGMALKLLKKVL-NH2 | Wallabies and their analogs | Cell membrane damage | MTT/MTS assay | CCRF-CEM | Leukemia cancer | IC50 : 15 µM |
| dbacp04418 | MAC1/9 | GFKMALKLLKKVL-NH2 | Wallabies and their analogs | Cell membrane damage | MTT/MTS assay | HeLa | Cervical cancer | IC50 : 8 ± 1 µM |
| dbacp04419 | MAC1/9 | GFKMALKLLKKVL-NH2 | Wallabies and their analogs | Cell membrane damage | MTT/MTS assay | SW | Colon cancer | IC50 : 13 ± 3 µM |
| dbacp04420 | MAC1/9 | GFKMALKLLKKVL-NH2 | Wallabies and their analogs | Cell membrane damage | MTT/MTS assay | CCRF-CEM | Leukemia cancer | IC50 : 14 ± 4 µM |
| dbacp04421 | MAC2 | GTGLPMSERRKIMLMMR | Wallabies and their analogs | Cell membrane damage | MTT/MTS assay | HeLa | Cervical cancer | IC50 : > 100 µM |
| dbacp04422 | MAC2 | GTGLPMSERRKIMLMMR | Wallabies and their analogs | Cell membrane damage | MTT/MTS assay | SW | Colon cancer | IC50 : > 100 µM |
| dbacp04423 | MAC2 | GTGLPMSERRKIMLMMR | Wallabies and their analogs | Cell membrane damage | MTT/MTS assay | CCRF-CEM | Leukemia cancer | IC50 : 32 µM |
| dbacp04424 | Macropin 1 | GFGMALKLLKKVL | Venom, the solitary bee | Cell membrane damage | Not specified | Not found | Not found | Not found |
| dbacp04430 | Macropin 1 | GFGMALKLLKKVL | Venom, the solitary bee | Cell membrane damage | Not specified | Not found | Not found | Not found |
| dbacp04431 | Macropin 2 | GTGLPMSERRKIMLMMR | Venom, the solitary bee | Cell membrane damage | Not specified | Not found | Not found | Not found |
| dbacp04437 | Macropin 2 | GTGLPMSERRKIMLMMR | Venom, the solitary bee | Cell membrane damage | Not specified | Not found | Not found | Not found |
| dbacp04487 | Magainin 2 | GIGKFLHSAKKFGKAFVGEIMNS | African clawed frog | Dissipate ion gradients; Induce osmotic lysis; Membrane damage | Trypan blue assay | U-937 | Lymphoma cancer | IC50 : >150 µg/ml |
| dbacp04488 | Magainin 2 | GIGKFLHSAKKFGKAFVGEIMNS | African clawed frog | Dissipate ion gradients; Induce osmotic lysis; Membrane damage | Trypan blue assay | 8402 | Leukemia cancer | IC50 : >150 µg/ml |
| dbacp04489 | Magainin 2 | GIGKFLHSAKKFGKAFVGEIMNS | African clawed frog | Dissipate ion gradients; Induce osmotic lysis; Membrane damage | Trypan blue assay | SSKT-1 | Hematopoietic cancer | IC50 : >150 µg/ml |
| dbacp04490 | Magainin 2 | GIGKFLHSAKKFGKAFVGEIMNS | African clawed frog | Dissipate ion gradients; Induce osmotic lysis; Membrane damage | Trypan blue assay | Daudi | Colon cancer | IC50 : >150 µg/ml |
| dbacp04491 | Magainin 2 | GIGKFLHSAKKFGKAFVGEIMNS | African clawed frog | Dissipate ion gradients; Induce osmotic lysis; Membrane damage | Trypan blue assay | MLA | Leukemia cancer | IC50 : >150 µg/ml |
| dbacp04492 | Magainin 2 | GIGKFLHSAKKFGKAFVGEIMNS | African clawed frog | Dissipate ion gradients; Induce osmotic lysis; Membrane damage | Trypan blue assay | Raji | Lymphoma cancer | IC50 : >150 µg/ml |
| dbacp04493 | Magainin 2 | GIGKFLHSAKKFGKAFVGEIMNS | African clawed frog | Dissipate ion gradients; Induce osmotic lysis; Membrane damage | Trypan blue assay | K-562 | Leukemia cancer | IC50 : >150 µg/ml |
| dbacp04494 | Magainin 2 | GIGKFLHSAKKFGKAFVGEIMNS | African clawed frog | Dissipate ion gradients; Induce osmotic lysis; Membrane damage | Trypan blue assay | CHP-100 | Ewing sarcoma | IC50 : >200 µg/ml |
| dbacp04495 | Magainin 2 | GIGKFLHSAKKFGKAFVGEIMNS | African clawed frog | Dissipate ion gradients; Induce osmotic lysis; Membrane damage | Trypan blue assay | MCF-7 | Breast cancer | IC50 : >200 µg/ml |
| dbacp04496 | Magainin 2 | GIGKFLHSAKKFGKAFVGEIMNS | African clawed frog | Dissipate ion gradients; Induce osmotic lysis; Membrane damage | Trypan blue assay | PC-3 | Prostate cancer | IC50 : >200 µg/ml |
| dbacp04505 | Magainin A | AIGKFLHSAKKFGKAFVGEIMNS | African clawed frog | Dissipate ion gradients; Induce osmotic lysis; Membrane damage | Trypan blue assay | U-937 | Lymphoma cancer | IC50 : 16 µg/ml |
| dbacp04506 | Magainin A | AIGKFLHSAKKFGKAFVGEIMNS | African clawed frog | Dissipate ion gradients; Induce osmotic lysis; Membrane damage | Trypan blue assay | 8402 | Leukemia cancer | IC50 : 18 µg/ml |
| dbacp04507 | Magainin A | AIGKFLHSAKKFGKAFVGEIMNS | African clawed frog | Dissipate ion gradients; Induce osmotic lysis; Membrane damage | Trypan blue assay | SSKT-1 | Hematopoietic cancer | IC50 : 23 µg/ml |
| dbacp04508 | Magainin A | AIGKFLHSAKKFGKAFVGEIMNS | African clawed frog | Dissipate ion gradients; Induce osmotic lysis; Membrane damage | Trypan blue assay | Daudi | Lung cancer | IC50 : 30 µg/ml |
| dbacp04509 | Magainin A | AIGKFLHSAKKFGKAFVGEIMNS | African clawed frog | Dissipate ion gradients; Induce osmotic lysis; Membrane damage | Trypan blue assay | MLA | Leukemia cancer | IC50 : 34 µg/ml |
| dbacp04510 | Magainin A | AIGKFLHSAKKFGKAFVGEIMNS | African clawed frog | Dissipate ion gradients; Induce osmotic lysis; Membrane damage | Trypan blue assay | Raji | Lymphoma cancer | IC50 : 20 µg/ml |
| dbacp04511 | Magainin A | AIGKFLHSAKKFGKAFVGEIMNS | African clawed frog | Dissipate ion gradients; Induce osmotic lysis; Membrane damage | Trypan blue assay | K-562 | Leukemia cancer | IC50 : 40 µg/ml |
| dbacp04512 | Magainin A | AIGKFLHSAKKFGKAFVGEIMNS | African clawed frog | Dissipate ion gradients; Induce osmotic lysis; Membrane damage | Trypan blue assay | CHP-100 | Ewing sarcoma | IC50 : 45 µg/ml |
| dbacp04513 | Magainin A | AIGKFLHSAKKFGKAFVGEIMNS | African clawed frog | Dissipate ion gradients; Induce osmotic lysis; Membrane damage | Trypan blue assay | MCF-7 | Breast cancer | IC50 : 49 µg/ml |
| dbacp04514 | Magainin A | AIGKFLHSAKKFGKAFVGEIMNS | African clawed frog | Dissipate ion gradients; Induce osmotic lysis; Membrane damage | Trypan blue assay | PC-3 | Prostate cancer | IC50 : 53 µg/ml |
| dbacp04515 | Magainin B | GIGKFLHAAKKFAKAFVAEIMNS | African clawed frog | Dissipate ion gradients; Induce osmotic lysis; Membrane damage | Trypan blue assay | U-937 | Lymphoma cancer | IC50 : 17 µg/ml |
| dbacp04516 | Magainin B | GIGKFLHAAKKFAKAFVAEIMNS | African clawed frog | Dissipate ion gradients; Induce osmotic lysis; Membrane damage | Trypan blue assay | 8402 | Leukemia cancer | IC50 : 12 µg/ml |
| dbacp04517 | Magainin B | GIGKFLHAAKKFAKAFVAEIMNS | African clawed frog | Dissipate ion gradients; Induce osmotic lysis; Membrane damage | Trypan blue assay | SSKT-1 | Hematopoietic cancer | IC50 : 27 µg/ml |
| dbacp04518 | Magainin B | GIGKFLHAAKKFAKAFVAEIMNS | African clawed frog | Dissipate ion gradients; Induce osmotic lysis; Membrane damage | Trypan blue assay | Daudi | Ovarian cancer | IC50 : 28 µg/ml |
| dbacp04519 | Magainin B | GIGKFLHAAKKFAKAFVAEIMNS | African clawed frog | Dissipate ion gradients; Induce osmotic lysis; Membrane damage | Trypan blue assay | MLA | Leukemia cancer | IC50 : 30 µg/ml |
| dbacp04520 | Magainin B | GIGKFLHAAKKFAKAFVAEIMNS | African clawed frog | Dissipate ion gradients; Induce osmotic lysis; Membrane damage | Trypan blue assay | Raji | Lymphoma cancer | IC50 : 23 µg/ml |
| dbacp04521 | Magainin B | GIGKFLHAAKKFAKAFVAEIMNS | African clawed frog | Dissipate ion gradients; Induce osmotic lysis; Membrane damage | Trypan blue assay | K-562 | Leukemia cancer | IC50 : 32 µg/ml |
| dbacp04522 | Magainin B | GIGKFLHAAKKFAKAFVAEIMNS | African clawed frog | Dissipate ion gradients; Induce osmotic lysis; Membrane damage | Trypan blue assay | CHP-100 | Ewing sarcoma | IC50 : 32 µg/ml |
| dbacp04523 | Magainin B | GIGKFLHAAKKFAKAFVAEIMNS | African clawed frog | Dissipate ion gradients; Induce osmotic lysis; Membrane damage | Trypan blue assay | MCF-7 | Breast cancer | IC50 : 37 µg/ml |
| dbacp04524 | Magainin B | GIGKFLHAAKKFAKAFVAEIMNS | African clawed frog | Dissipate ion gradients; Induce osmotic lysis; Membrane damage | Trypan blue assay | PC-3 | Prostate cancer | IC50 : 41 µg/ml |
| dbacp04531 | Magainin G | GIGKFLHSAKKFAKAFVAEIMNS | African clawed frog | Dissipate ion gradients; Induce osmotic lysis; Membrane damage | Trypan blue assay | U-937 | Lymphoma cancer | IC50 : 19 µg/ml |
| dbacp04532 | Magainin G | GIGKFLHSAKKFAKAFVAEIMNS | African clawed frog | Dissipate ion gradients; Induce osmotic lysis; Membrane damage | Trypan blue assay | 8402 | Leukemia cancer | IC50 : 16 µg/ml |
| dbacp04533 | Magainin G | GIGKFLHSAKKFAKAFVAEIMNS | African clawed frog | Dissipate ion gradients; Induce osmotic lysis; Membrane damage | Trypan blue assay | SSKT-1 | Hematopoietic cancer | IC50 : 29 µg/ml |
| dbacp04534 | Magainin G | GIGKFLHSAKKFAKAFVAEIMNS | African clawed frog | Dissipate ion gradients; Induce osmotic lysis; Membrane damage | Trypan blue assay | Daudi | Renal cancer | IC50 : 38 µg/ml |
| dbacp04535 | Magainin G | GIGKFLHSAKKFAKAFVAEIMNS | African clawed frog | Dissipate ion gradients; Induce osmotic lysis; Membrane damage | Trypan blue assay | MLA | Leukemia cancer | IC50 : 33 µg/ml |
| dbacp04536 | Magainin G | GIGKFLHSAKKFAKAFVAEIMNS | African clawed frog | Dissipate ion gradients; Induce osmotic lysis; Membrane damage | Trypan blue assay | Raji | Lymphoma cancer | IC50 : 25 µg/ml |
| dbacp04537 | Magainin G | GIGKFLHSAKKFAKAFVAEIMNS | African clawed frog | Dissipate ion gradients; Induce osmotic lysis; Membrane damage | Trypan blue assay | K-562 | Leukemia cancer | IC50 :37 µg/ml |
| dbacp04538 | Magainin G | GIGKFLHSAKKFAKAFVAEIMNS | African clawed frog | Dissipate ion gradients; Induce osmotic lysis; Membrane damage | Trypan blue assay | CHP-100 | Ewing sarcoma | IC50 : 39 µg/ml |
| dbacp04539 | Magainin G | GIGKFLHSAKKFAKAFVAEIMNS | African clawed frog | Dissipate ion gradients; Induce osmotic lysis; Membrane damage | Trypan blue assay | MCF-7 | Breast cancer | IC50 : 42 µg/ml |
| dbacp04540 | Magainin G | GIGKFLHSAKKFAKAFVAEIMNS | African clawed frog | Dissipate ion gradients; Induce osmotic lysis; Membrane damage | Trypan blue assay | PC-3 | Prostate cancer | IC50 : 47 µg/ml |
| dbacp04652 | Melittin | GIGAVLKVLTTGLPALISWIKRKRQQ | Main component of honey bee venom | Membrane damage; Apoptotic cell death; Necrosis | Cell viability assay | SCC25 | Skin cancer | 102.9 ± 4.1% cell growth inhibition at 1 µM |
| dbacp04654 | Melittin | GIGAVLKVLTTGLPALISWIKRKRQQ | Honey bee | Membrane damage as swelling; Breakage or blebbing | Live/Dead staining and florescence microscopy assay | AGS | Human adenocarcinoma | MIC : 10 μg/mL |
| dbacp04655 | Melittin | GIGAVLKVLTTGLPALISWIKRKRQQ | Honey bee | Membrane damage as swelling; Breakage or blebbing | Live/Dead staining and florescence microscopy assay | COLO205 | Human adenocarcinoma | MIC : 10 μg/mL |
| dbacp04656 | Melittin | GIGAVLKVLTTGLPALISWIKRKRQQ | Honey bee | Membrane damage as swelling; Breakage or blebbing | Live/Dead staining and florescence microscopy assay | HCT-15 | Human adenocarcinoma | MIC : 5 μg/mL |
| dbacp04909 | NRC-03 | GRRKRKWLRRIGKGVKIIGGAALDHL | Skin mucous secretion of winter flounder | Cell membrane damage | MTT/MTS assay | MDA-MB-231 | Breast cancer | 5% Cytotoxic at 5 µM |
| dbacp04910 | NRC-03 | GRRKRKWLRRIGKGVKIIGGAALDHL | Skin mucous secretion of winter flounder | Cell membrane damage | MTT/MTS assay | MDA-MB-231 | Breast cancer | 5% Cytotoxic at 10 µM |
| dbacp04911 | NRC-03 | GRRKRKWLRRIGKGVKIIGGAALDHL | Skin mucous secretion of winter flounder | Cell membrane damage | MTT/MTS assay | MDA-MB-231 | Breast cancer | 30-35% Cytotoxic at 25 µM |
| dbacp04912 | NRC-03 | GRRKRKWLRRIGKGVKIIGGAALDHL | Skin mucous secretion of winter flounder | Cell membrane damage | MTT/MTS assay | MDA-MB-231 | Breast cancer | 60% Cytotoxic at 50 µM |
| dbacp04913 | NRC-03 | GRRKRKWLRRIGKGVKIIGGAALDHL | Skin mucous secretion of winter flounder | Cell membrane damage | MTT/MTS assay | T-47D | Breast cancer | 5-10% Cytotoxic at 5 µM |
| dbacp04914 | NRC-03 | GRRKRKWLRRIGKGVKIIGGAALDHL | Skin mucous secretion of winter flounder | Cell membrane damage | MTT/MTS assay | T-47D | Breast cancer | 10% Cytotoxic at 10 µM |
| dbacp04915 | NRC-03 | GRRKRKWLRRIGKGVKIIGGAALDHL | Skin mucous secretion of winter flounder | Cell membrane damage | MTT/MTS assay | T-47D | Breast cancer | 30-35% Cytotoxic at 25 µM |
| dbacp04916 | NRC-03 | GRRKRKWLRRIGKGVKIIGGAALDHL | Skin mucous secretion of winter flounder | Cell membrane damage | MTT/MTS assay | T-47D | Breast cancer | 60% Cytotoxic at 50 µM |
| dbacp04917 | NRC-03 | GRRKRKWLRRIGKGVKIIGGAALDHL | Skin mucous secretion of winter flounder | Cell membrane damage | MTT/MTS assay | SKBR-3 | Breast cancer | 30% Cytotoxic at 5 µM |
| dbacp04918 | NRC-03 | GRRKRKWLRRIGKGVKIIGGAALDHL | Skin mucous secretion of winter flounder | Cell membrane damage | MTT/MTS assay | SKBR-3 | Breast cancer | 50% Cytotoxic at 10 µM |
| dbacp04919 | NRC-03 | GRRKRKWLRRIGKGVKIIGGAALDHL | Skin mucous secretion of winter flounder | Cell membrane damage | MTT/MTS assay | SKBR-3 | Breast cancer | 70% Cytotoxic at 25 µM |
| dbacp04920 | NRC-03 | GRRKRKWLRRIGKGVKIIGGAALDHL | Skin mucous secretion of winter flounder | Cell membrane damage | MTT/MTS assay | SKBR-3 | Breast cancer | 80-85% Cytotoxic at 50 µM |
| dbacp04921 | NRC-03 | GRRKRKWLRRIGKGVKIIGGAALDHL | Skin mucous secretion of winter flounder | Cell membrane damage | MTT/MTS assay | MDA-MB-468 | Breast cancer | 30% Cytotoxic at 5 µM |
| dbacp04922 | NRC-03 | GRRKRKWLRRIGKGVKIIGGAALDHL | Skin mucous secretion of winter flounder | Cell membrane damage | MTT/MTS assay | MDA-MB-468 | Breast cancer | 40-50% Cytotoxic at 10 µM |
| dbacp04923 | NRC-03 | GRRKRKWLRRIGKGVKIIGGAALDHL | Skin mucous secretion of winter flounder | Cell membrane damage | MTT/MTS assay | MDA-MB-468 | Breast cancer | 60-70% Cytotoxic at 25 µM |
| dbacp04924 | NRC-03 | GRRKRKWLRRIGKGVKIIGGAALDHL | Skin mucous secretion of winter flounder | Cell membrane damage | MTT/MTS assay | MDA-MB-468 | Breast cancer | 80-85% Cytotoxic at 50 µM |
| dbacp04925 | NRC-03 | GRRKRKWLRRIGKGVKIIGGAALDHL | Skin mucous secretion of winter flounder | Cell membrane damage | MTT/MTS assay | 4T1 | Breast cancer | 15-20% Cytotoxic at 5 µM |
| dbacp04926 | NRC-03 | GRRKRKWLRRIGKGVKIIGGAALDHL | Skin mucous secretion of winter flounder | Cell membrane damage | MTT/MTS assay | 4T1 | Breast cancer | 40-50% Cytotoxic at 10 µM |
| dbacp04927 | NRC-03 | GRRKRKWLRRIGKGVKIIGGAALDHL | Skin mucous secretion of winter flounder | Cell membrane damage | MTT/MTS assay | 4T1 | Breast cancer | 80% Cytotoxic at 25 µM |
| dbacp04928 | NRC-03 | GRRKRKWLRRIGKGVKIIGGAALDHL | Skin mucous secretion of winter flounder | Cell membrane damage | MTT/MTS assay | 4T1 | Breast cancer | 85-90% Cytotoxic at 50 µM |
| dbacp04929 | NRC-03 | GRRKRKWLRRIGKGVKIIGGAALDHL | Skin mucous secretion of winter flounder | Cell membrane damage | MTT/MTS assay | MCF-7 | Breast cancer | 70% Cytotoxic at 50 µM |
| dbacp04930 | NRC-03 | GRRKRKWLRRIGKGVKIIGGAALDHL | Skin mucous secretion of winter flounder | Cell membrane damage | MTT/MTS assay | MCF-7-TX400 | Breast cancer | 60-70% Cytotoxic at 50 µM |
| dbacp04931 | NRC-03 | GRRKRKWLRRIGKGVKIIGGAALDHL-NH2 | PseudopWinter flounder | Cell membrane damage | MTT/MTS assay | MCF-7-TX400 | Breast cancer | 60-70% Cytotoxic at 50 µM |
| dbacp04932 | NRC-03 | GRRKRKWLRRIGKGVKIIGGAALDHL | Skin mucous secretion of winter flounder | Cell membrane damage | MTT/MTS assay | MDA-MB-231 | Breast cancer | 5% Cytotoxic at 5 µM |
| dbacp04933 | NRC-03 | GRRKRKWLRRIGKGVKIIGGAALDHL | Skin mucous secretion of winter flounder | Cell membrane damage | MTT/MTS assay | MDA-MB-231 | Breast cancer | 5% Cytotoxic at 10 µM |
| dbacp04934 | NRC-03 | GRRKRKWLRRIGKGVKIIGGAALDHL | Skin mucous secretion of winter flounder | Cell membrane damage | MTT/MTS assay | MDA-MB-231 | Breast cancer | 30-35% Cytotoxic at 25 µM |
| dbacp04935 | NRC-03 | GRRKRKWLRRIGKGVKIIGGAALDHL | Skin mucous secretion of winter flounder | Cell membrane damage | MTT/MTS assay | MDA-MB-231 | Breast cancer | 60% Cytotoxic at 50 µM |
| dbacp04936 | NRC-03 | GRRKRKWLRRIGKGVKIIGGAALDHL | Skin mucous secretion of winter flounder | Cell membrane damage | MTT/MTS assay | T-47D | Breast cancer | 5-10% Cytotoxic at 5 µM |
| dbacp04937 | NRC-03 | GRRKRKWLRRIGKGVKIIGGAALDHL | Skin mucous secretion of winter flounder | Cell membrane damage | MTT/MTS assay | T-47D | Breast cancer | 10% Cytotoxic at 10 µM |
| dbacp04938 | NRC-03 | GRRKRKWLRRIGKGVKIIGGAALDHL | Skin mucous secretion of winter flounder | Cell membrane damage | MTT/MTS assay | T-47D | Breast cancer | 30-35% Cytotoxic at 25 µM |
| dbacp04939 | NRC-03 | GRRKRKWLRRIGKGVKIIGGAALDHL | Skin mucous secretion of winter flounder | Cell membrane damage | MTT/MTS assay | T-47D | Breast cancer | 60% Cytotoxic at 50 µM |
| dbacp04940 | NRC-03 | GRRKRKWLRRIGKGVKIIGGAALDHL | Skin mucous secretion of winter flounder | Cell membrane damage | MTT/MTS assay | SKBR-3 | Breast cancer | 30% Cytotoxic at 5 µM |
| dbacp04941 | NRC-03 | GRRKRKWLRRIGKGVKIIGGAALDHL | Skin mucous secretion of winter flounder | Cell membrane damage | MTT/MTS assay | SKBR-3 | Breast cancer | 50% Cytotoxic at 10 µM |
| dbacp04942 | NRC-03 | GRRKRKWLRRIGKGVKIIGGAALDHL | Skin mucous secretion of winter flounder | Cell membrane damage | MTT/MTS assay | SKBR-3 | Breast cancer | 70% Cytotoxic at 25 µM |
| dbacp04943 | NRC-03 | GRRKRKWLRRIGKGVKIIGGAALDHL | Skin mucous secretion of winter flounder | Cell membrane damage | MTT/MTS assay | SKBR-3 | Breast cancer | 80-85% Cytotoxic at 50 µM |
| dbacp04944 | NRC-03 | GRRKRKWLRRIGKGVKIIGGAALDHL | Skin mucous secretion of winter flounder | Cell membrane damage | MTT/MTS assay | MDA-MB-468 | Breast cancer | 30% Cytotoxic at 5 µM |
| dbacp04945 | NRC-03 | GRRKRKWLRRIGKGVKIIGGAALDHL | Skin mucous secretion of winter flounder | Cell membrane damage | MTT/MTS assay | MDA-MB-468 | Breast cancer | 40-50% Cytotoxic at 10 µM |
| dbacp04946 | NRC-03 | GRRKRKWLRRIGKGVKIIGGAALDHL | Skin mucous secretion of winter flounder | Cell membrane damage | MTT/MTS assay | MDA-MB-468 | Breast cancer | 60-70% Cytotoxic at 25 µM |
| dbacp04947 | NRC-03 | GRRKRKWLRRIGKGVKIIGGAALDHL | Skin mucous secretion of winter flounder | Cell membrane damage | MTT/MTS assay | MDA-MB-468 | Breast cancer | 80-85% Cytotoxic at 50 µM |
| dbacp04948 | NRC-03 | GRRKRKWLRRIGKGVKIIGGAALDHL | Skin mucous secretion of winter flounder | Cell membrane damage | MTT/MTS assay | 4T1 | Breast cancer | 15-20% Cytotoxic at 5 µM |
| dbacp04949 | NRC-03 | GRRKRKWLRRIGKGVKIIGGAALDHL | Skin mucous secretion of winter flounder | Cell membrane damage | MTT/MTS assay | 4T1 | Breast cancer | 40-50% Cytotoxic at 10 µM |
| dbacp04950 | NRC-03 | GRRKRKWLRRIGKGVKIIGGAALDHL | Skin mucous secretion of winter flounder | Cell membrane damage | MTT/MTS assay | 4T1 | Breast cancer | 80% Cytotoxic at 25 µM |
| dbacp04951 | NRC-03 | GRRKRKWLRRIGKGVKIIGGAALDHL | Skin mucous secretion of winter flounder | Cell membrane damage | MTT/MTS assay | 4T1 | Breast cancer | 85-90% Cytotoxic at 50 µM |
| dbacp04952 | NRC-03 | GRRKRKWLRRIGKGVKIIGGAALDHL | Skin mucous secretion of winter flounder | Cell membrane damage | MTT/MTS assay | MCF-7 | Breast cancer | 70% Cytotoxic at 50 µM |
| dbacp04954 | NRC-07 | GRRKRKWLRRIGKGVKIIGGAALDHL | Skin mucous secretion of winter flounder | Cell membrane damage | MTT/MTS assay | MDA-MB-231 | Breast cancer | ~0% Cytotoxic at 5 µM |
| dbacp04955 | NRC-07 | RWGKWFKKATHVGKHVGKAALTAYL | Skin mucous secretion of winter flounder | Cell membrane damage | MTT/MTS assay | MDA-MB-231 | Breast cancer | 5% Cytotoxic at 10 µM |
| dbacp04956 | NRC-07 | RWGKWFKKATHVGKHVGKAALTAYL | Skin mucous secretion of winter flounder | Cell membrane damage | MTT/MTS assay | MDA-MB-231 | Breast cancer | 20-30% Cytotoxic at 25 µM |
| dbacp04957 | NRC-07 | RWGKWFKKATHVGKHVGKAALTAYL | Skin mucous secretion of winter flounder | Cell membrane damage | MTT/MTS assay | MDA-MB-231 | Breast cancer | 40-50% Cytotoxic at 50 µM |
| dbacp04958 | NRC-07 | RWGKWFKKATHVGKHVGKAALTAYL | Skin mucous secretion of winter flounder | Cell membrane damage | MTT/MTS assay | T-47D | Breast cancer | ~0% Cytotoxic at 5 µM |
| dbacp04959 | NRC-07 | RWGKWFKKATHVGKHVGKAALTAYL | Skin mucous secretion of winter flounder | Cell membrane damage | MTT/MTS assay | T-47D | Breast cancer | 10% Cytotoxic at 10 µM |
| dbacp04960 | NRC-07 | RWGKWFKKATHVGKHVGKAALTAYL | Skin mucous secretion of winter flounder | Cell membrane damage | MTT/MTS assay | T-47D | Breast cancer | 20% Cytotoxic at 25 µM |
| dbacp04961 | NRC-07 | RWGKWFKKATHVGKHVGKAALTAYL | Skin mucous secretion of winter flounder | Cell membrane damage | MTT/MTS assay | T-47D | Breast cancer | 40-50% Cytotoxic at 50 µM |
| dbacp04962 | NRC-07 | RWGKWFKKATHVGKHVGKAALTAYL | Skin mucous secretion of winter flounder | Cell membrane damage | MTT/MTS assay | SKBR-3 | Breast cancer | ~0% Cytotoxic at 5 µM |
| dbacp04963 | NRC-07 | RWGKWFKKATHVGKHVGKAALTAYL | Skin mucous secretion of winter flounder | Cell membrane damage | MTT/MTS assay | SKBR-3 | Breast cancer | 20% Cytotoxic at 10 µM |
| dbacp04964 | NRC-07 | RWGKWFKKATHVGKHVGKAALTAYL | Skin mucous secretion of winter flounder | Cell membrane damage | MTT/MTS assay | SKBR-3 | Breast cancer | 70-80% Cytotoxic at 25 µM |
| dbacp04965 | NRC-07 | RWGKWFKKATHVGKHVGKAALTAYL | Skin mucous secretion of winter flounder | Cell membrane damage | MTT/MTS assay | SKBR-3 | Breast cancer | 80-85% Cytotoxic at 50 µM |
| dbacp04966 | NRC-07 | RWGKWFKKATHVGKHVGKAALTAYL | Skin mucous secretion of winter flounder | Cell membrane damage | MTT/MTS assay | MDA-MB-468 | Breast cancer | 10% Cytotoxic at 5 µM |
| dbacp04967 | NRC-07 | RWGKWFKKATHVGKHVGKAALTAYL | Skin mucous secretion of winter flounder | Cell membrane damage | MTT/MTS assay | MDA-MB-468 | Breast cancer | 50% Cytotoxic at 10 µM |
| dbacp04968 | NRC-07 | RWGKWFKKATHVGKHVGKAALTAYL | Skin mucous secretion of winter flounder | Cell membrane damage | MTT/MTS assay | MDA-MB-468 | Breast cancer | 80% Cytotoxic at 25 µM |
| dbacp04969 | NRC-07 | RWGKWFKKATHVGKHVGKAALTAYL | Skin mucous secretion of winter flounder | Cell membrane damage | MTT/MTS assay | MDA-MB-468 | Breast cancer | 80-90% Cytotoxic at 50 µM |
| dbacp04970 | NRC-07 | RWGKWFKKATHVGKHVGKAALTAYL | Skin mucous secretion of winter flounder | Cell membrane damage | MTT/MTS assay | 4T1 | Breast cancer | 30-40% Cytotoxic at 5 µM |
| dbacp04971 | NRC-07 | RWGKWFKKATHVGKHVGKAALTAYL | Skin mucous secretion of winter flounder | Cell membrane damage | MTT/MTS assay | 4T1 | Breast cancer | 60-70% Cytotoxic at 10 µM |
| dbacp04972 | NRC-07 | RWGKWFKKATHVGKHVGKAALTAYL | Skin mucous secretion of winter flounder | Cell membrane damage | MTT/MTS assay | 4T1 | Breast cancer | 80-90% Cytotoxic at 25 µM |
| dbacp04973 | NRC-07 | RWGKWFKKATHVGKHVGKAALTAYL | Skin mucous secretion of winter flounder | Cell membrane damage | MTT/MTS assay | 4T1 | Breast cancer | 85-90% Cytotoxic at 50 µM |
| dbacp04974 | NRC-07 | RWGKWFKKATHVGKHVGKAALTAYL | Skin mucous secretion of winter flounder | Cell membrane damage | MTT/MTS assay | MCF-7 | Breast cancer | 70% Cytotoxic at 50 µM |
| dbacp04975 | NRC-07 | RWGKWFKKATHVGKHVGKAALTAYL | Skin mucous secretion of winter flounder | Cell membrane damage | MTT/MTS assay | MCF-7-TX400 | Breast cancer | 60-70% Cytotoxic at 50 µM |
| dbacp04976 | NRC-07 | RWGKWFKKATHVGKHVGKAALTAYL | Skin mucous secretion of winter flounder | Cell membrane damage | MTT/MTS assay | MDA-MB-468 | Breast cancer | 80% Cytotoxic at 25 µM |
| dbacp04977 | NRC-13 | GWRTLLKKAEVKTVGKLALKHYL | Skin mucous secretion of winter flounder | Cell membrane damage | MTT/MTS assay | MDA-MB-231 | Breast cancer | ~5% Cytotoxic at 10 µM |
| dbacp04978 | NRC-13 | GWRTLLKKAEVKTVGKLALKHYL | Skin mucous secretion of winter flounder | Cell membrane damage | MTT/MTS assay | MDA-MB-231 | Breast cancer | 10% Cytotoxic at 25 µM |
| dbacp04979 | NRC-13 | GWRTLLKKAEVKTVGKLALKHYL | Skin mucous secretion of winter flounder | Cell membrane damage | MTT/MTS assay | MDA-MB-231 | Breast cancer | 10-15% Cytotoxic at 50 µM |
| dbacp04980 | NRC-13 | GWRTLLKKAEVKTVGKLALKHYL | Skin mucous secretion of winter flounder | Cell membrane damage | MTT/MTS assay | T-47D | Breast cancer | ~0% Cytotoxic at 5 µM |
| dbacp04981 | NRC-13 | GWRTLLKKAEVKTVGKLALKHYL | Skin mucous secretion of winter flounder | Cell membrane damage | MTT/MTS assay | T-47D | Breast cancer | ~0% Cytotoxic at 10 µM |
| dbacp04982 | NRC-13 | GWRTLLKKAEVKTVGKLALKHYL | Skin mucous secretion of winter flounder | Cell membrane damage | MTT/MTS assay | T-47D | Breast cancer | 10% Cytotoxic at 25 µM |
| dbacp04983 | NRC-13 | GWRTLLKKAEVKTVGKLALKHYL | Skin mucous secretion of winter flounder | Cell membrane damage | MTT/MTS assay | T-47D | Breast cancer | 10-15% Cytotoxic at 50 µM |
| dbacp04984 | NRC-13 | GWRTLLKKAEVKTVGKLALKHYL | Skin mucous secretion of winter flounder | Cell membrane damage | MTT/MTS assay | SKBR-3 | Breast cancer | 10% Cytotoxic at 5 µM |
| dbacp04985 | NRC-13 | GWRTLLKKAEVKTVGKLALKHYL | Skin mucous secretion of winter flounder | Cell membrane damage | MTT/MTS assay | SKBR-3 | Breast cancer | 10% Cytotoxic at 10 µM |
| dbacp04986 | NRC-13 | GWRTLLKKAEVKTVGKLALKHYL | Skin mucous secretion of winter flounder | Cell membrane damage | MTT/MTS assay | SKBR-3 | Breast cancer | 10-15% Cytotoxic at 25 µM |
| dbacp04987 | NRC-13 | GWRTLLKKAEVKTVGKLALKHYL | Skin mucous secretion of winter flounder | Cell membrane damage | MTT/MTS assay | SKBR-3 | Breast cancer | 15-20% Cytotoxic at 50 µM |
| dbacp04988 | NRC-13 | GWRTLLKKAEVKTVGKLALKHYL | Skin mucous secretion of winter flounder | Cell membrane damage | MTT/MTS assay | MDA-MB-468 | Breast cancer | ~5% Cytotoxic at 5 µM |
| dbacp04989 | NRC-13 | GWRTLLKKAEVKTVGKLALKHYL | Skin mucous secretion of winter flounder | Cell membrane damage | MTT/MTS assay | MDA-MB-468 | Breast cancer | ~5% Cytotoxic at 10 µM |
| dbacp04990 | NRC-13 | GWRTLLKKAEVKTVGKLALKHYL | Skin mucous secretion of winter flounder | Cell membrane damage | MTT/MTS assay | MDA-MB-468 | Breast cancer | 5% Cytotoxic at 25 µM |
| dbacp04991 | NRC-13 | GWRTLLKKAEVKTVGKLALKHYL | Skin mucous secretion of winter flounder | Cell membrane damage | MTT/MTS assay | MDA-MB-468 | Breast cancer | 10-15% Cytotoxic at 50 µM |
| dbacp04992 | NRC-13 | GWRTLLKKAEVKTVGKLALKHYL | Skin mucous secretion of winter flounder | Cell membrane damage | MTT/MTS assay | 4T1 | Breast cancer | ~0% Cytotoxic at 5 µM |
| dbacp04993 | NRC-13 | GWRTLLKKAEVKTVGKLALKHYL | Skin mucous secretion of winter flounder | Cell membrane damage | MTT/MTS assay | 4T1 | Breast cancer | ~0% Cytotoxic at 10 µM |
| dbacp04994 | NRC-13 | GWRTLLKKAEVKTVGKLALKHYL | Skin mucous secretion of winter flounder | Cell membrane damage | MTT/MTS assay | 4T1 | Breast cancer | 5-10% Cytotoxic at 25 µM |
| dbacp04995 | NRC-13 | GWRTLLKKAEVKTVGKLALKHYL | Skin mucous secretion of winter flounder | Cell membrane damage | MTT/MTS assay | 4T1 | Breast cancer | 20% Cytotoxic at 50 µM |
| dbacp04996 | NRC-13 | GWRTLLKKAEVKTVGKLALKHYL | Skin mucous secretion of winter flounder | Cell membrane damage | MTT/MTS assay | MCF-7 | Breast cancer | 0% Cytotoxic at 50 µM |
| dbacp04997 | NRC-13 | GWRTLLKKAEVKTVGKLALKHYL | Skin mucous secretion of winter flounder | Cell membrane damage | MTT/MTS assay | MCF-7-TX400 | Breast cancer | ~5% Cytotoxic at 50 µM |
| dbacp05706 | PTP-7a | FLGALFHALSKLL | Synthetic peptide | Inducing cell membrane damage | MTT/MTS assay | A-549 | Lung cancer | IC50 : 28 µM |
| dbacp05707 | PTP-7b | FLGALFKALSHLL | Synthetic peptide | Inducing cell membrane damage | MTT/MTS assay | A-549 | Lung cancer | IC50 : 32 µM |
| dbacp06557 | Z24 | ALSKALSKALSKALSKALSKALSK | African clawed frog | Dissipate ion gradients; Induce osmotic lysis; Membrane damage | Trypan blue assay | U-937 | Lymphoma cancer | IC50 : 123 µg/ml |
| dbacp06558 | Z24 | ALSKALSKALSKALSKALSKALSK | African clawed frog | Dissipate ion gradients; Induce osmotic lysis; Membrane damage | Trypan blue assay | 8402 | Leukemia cancer | IC50 : 83 µg/ml |
| dbacp06559 | Z24 | ALSKALSKALSKALSKALSKALSK | African clawed frog | Dissipate ion gradients; Induce osmotic lysis; Membrane damage | Trypan blue assay | SSKT-1 | Hematopoietic cancer | IC50 : 109 µg/ml |
| dbacp06560 | Z24 | ALSKALSKALSKALSKALSKALSK | African clawed frog | Dissipate ion gradients; Induce osmotic lysis; Membrane damage | Trypan blue assay | Daudi | Leukemia cancer | IC50 : 143 µg/ml |
| dbacp06561 | Z24 | ALSKALSKALSKALSKALSKALSK | African clawed frog | Dissipate ion gradients; Induce osmotic lysis; Membrane damage | Trypan blue assay | MLA | Leukemia cancer | IC50 : 102 µg/ml |
| dbacp06562 | Z24 | ALSKALSKALSKALSKALSKALSK | African clawed frog | Dissipate ion gradients; Induce osmotic lysis; Membrane damage | Trypan blue assay | Raji | Lymphoma cancer | IC50 : 72 µg/ml |
| dbacp06563 | Z24 | ALSKALSKALSKALSKALSKALSK | African clawed frog | Dissipate ion gradients; Induce osmotic lysis; Membrane damage | Trypan blue assay | K-562 | Leukemia cancer | IC50 : 112 µg/ml |
| dbacp06564 | Z24 | ALSKALSKALSKALSKALSKALSK | African clawed frog | Dissipate ion gradients; Induce osmotic lysis; Membrane damage | Trypan blue assay | CHP-100 | Ewing sarcoma | Not found |
| dbacp06565 | Z24 | ALSKALSKALSKALSKALSKALSK | African clawed frog | Dissipate ion gradients; Induce osmotic lysis; Membrane damage | Trypan blue assay | MCF-7 | Breast cancer | Not found |
| dbacp06566 | Z24 | ALSKALSKALSKALSKALSKALSK | African clawed frog | Dissipate ion gradients; Induce osmotic lysis; Membrane damage | Trypan blue assay | PC-3 | Prostate cancer | Not found |
| dbacp06573 | Z44 | ALSKALSKALSKALSKALSKALSK | African clawed frog | Dissipate ion gradients;Induce osmotic lysis; Membrane damage | Trypan blue assay | U-937 | Lymphoma cancer | IC50 : 97 µg/ml |
| dbacp06574 | Z44 | ALSKALSKALSKALSKALSKALSK | African clawed frog | Dissipate ion gradients;Induce osmotic lysis; Membrane damage | Trypan blue assay | 8402 | Leukemia cancer | IC50 : 60 µg/ml |
| dbacp06575 | Z44 | ALSKALSKALSKALSKALSKALSK | African clawed frog | Dissipate ion gradients;Induce osmotic lysis; Membrane damage | Trypan blue assay | SSKT-1 | Hematopoietic cancer | IC50 : 107 µg/ml |
| dbacp06576 | Z44 | ALSKALSKALSKALSKALSKALSK | African clawed frog | Dissipate ion gradients;Induce osmotic lysis; Membrane damage | Trypan blue assay | Daudi | Brain tumor | IC50 : 115 µg/ml |
| dbacp06577 | Z44 | ALSKALSKALSKALSKALSKALSK | African clawed frog | Dissipate ion gradients;Induce osmotic lysis; Membrane damage | Trypan blue assay | MLA | Leukemia cancer | IC50 : 80 µg/ml |
| dbacp06578 | Z44 | ALSKALSKALSKALSKALSKALSK | African clawed frog | Dissipate ion gradients;Induce osmotic lysis; Membrane damage | Trypan blue assay | Raji | Lymphoma cancer | IC50 : 64 µg/ml |
| dbacp06579 | Z44 | ALSKALSKALSKALSKALSKALSK | African clawed frog | Dissipate ion gradients;Induce osmotic lysis; Membrane damage | Trypan blue assay | K-562 | Leukemia cancer | IC50 : 98 µg/ml |
| dbacp06580 | Z44 | ALSKALSKALSKALSKALSKALSK | African clawed frog | Dissipate ion gradients;Induce osmotic lysis; Membrane damage | Trypan blue assay | CHP-100 | Ewing sarcoma | Not found |
| dbacp06581 | Z44 | ALSKALSKALSKALSKALSKALSK | African clawed frog | Dissipate ion gradients;Induce osmotic lysis; Membrane damage | Trypan blue assay | MCF-7 | Breast cancer | Not found |
| dbacp06582 | Z44 | ALSKALSKALSKALSKALSKALSK | African clawed frog | Dissipate ion gradients;Induce osmotic lysis; Membrane damage | Trypan blue assay | PC-3 | Prostate cancer | Not found |