dbACP: A Comprehensive Database of Anti-Cancer Peptides

38 result(s) have been found!

Accession Name Sequence Source/Organism Mechanism Assay Type Cell Line Cancer Type Activity
dbacp02472 Chickpea peptide ADLPGLK Plant sources Inducing apoptosis SRB assay A-549 Human endometrial cancer IC50 : 126.4 ± 1.98 µM
dbacp02473 Chickpea peptide ADLPGLK Plant sources Inducing apoptosis SRB assay HepG-2 Human endometrial cancer IC50 : 113.7 ± 0.99 µM
dbacp02474 Chickpea peptide ADLPGLK Plant sources Inducing apoptosis SRB assay Ishikawa Human endometrial cancer IC50 : 101.5 ± 1.83 µM
dbacp02475 Chickpea peptide ADLPGLK Plant sources Inducing apoptosis SRB assay MCF-7 Human endometrial cancer IC50 : 110.3 ± 2.97µM
dbacp02476 Chickpea peptide ADLPGLK Plant sources Inducing apoptosis SRB assay MDA-MB-231 Human endometrial cancer IIC50 : 107.2 ± 1.62µM
dbacp02477 Chickpea peptide ADLPGLK Plant sources Inducing apoptosis SRB assay PA-1 Human endometrial cancer IC50 : 133.4 ± 0.70µM
dbacp03720 LCP-3 WLHV Plant sources Inducing apoptosis Not specified Caco-2 Not specified Not found
dbacp04309 Lunasin SKWQHQQDSCRKQLQGVNLTPCEKHIMEKIQGRDDDDDDDDDD Plant sources Inducing apoptosis MTT assay HCT116-derived spheres Colorectal cancer IC50 : 161.0 ± 2.4 μM
dbacp04310 Lunasin SKWQHQQDSCRKQLQGVNLTPCEKHIMEKIQGRDDDDDDDDDD Plant sources Inducing apoptosis MTT assay HCT-116 parentl Colorectal cancer IC50 : 107.5 ± 1.9 μM
dbacp04541 Malanin chain A DYPKLTFTTS Plant sources Inducing apoptosis MTT assay HeLa Cervical cancer IC50 : 0.15 ± 0.08 nM
dbacp04542 Malanin chain A DYPKLTFTTS Plant sources Inducing apoptosis MTT assay PC-12 Breast cancer IC50 : 7.71 ± 0.24 nM
dbacp04543 Malanin chain A DYPKLTFTTS Plant sources Inducing apoptosis MTT assay MCF-7 Leukemia IC50 : 11.20 ± 0.02 nM
dbacp04544 Malanin chain A DYPKLTFTTS Plant sources Inducing apoptosis MTT assay K562 Not found IC50 : 15.80 ± 0.09 nM
dbacp04545 Malanin chain A DYPKLTFTTS Plant sources Inducing apoptosis MTT assay Vero Not found IC50 : 2.79 ± 0.05 nM
dbacp04546 Malanin chain A DYPKLTFTTS Plant sources Inducing apoptosis MTT assay MDCK Not found IC50 : 3.92 ± 0.01 nM
dbacp04547 Malanin chain B DETCTDEEFN Plant sources Inducing apoptosis MTT assay HeLa Cervical cancer IC50 : 0.15 ± 0.08 nM
dbacp04548 Malanin chain B DETCTDEEFN Plant sources Inducing apoptosis MTT assay PC-12 Breast cancer IC50 : 7.71 ± 0.24 nM
dbacp04549 Malanin chain B DETCTDEEFN Plant sources Inducing apoptosis MTT assay MCF-7 Leukemia IC50 : 11.20 ± 0.02 nM
dbacp04550 Malanin chain B DETCTDEEFN Plant sources Inducing apoptosis MTT assay K562 Not found IC50 : 15.80 ± 0.09 nM
dbacp04551 Malanin chain B DETCTDEEFN Plant sources Inducing apoptosis MTT assay Vero Not found IC50 : 2.79 ± 0.05 nM
dbacp04552 Malanin chain B DETCTDEEFN Plant sources Inducing apoptosis MTT assay MDCK Not found IC50 : 3.92 ± 0.01 nM
dbacp04693 MIPP SLSLSVAR Plant sources Inducing apoptosis SRB assay HeLa Human endometrial cancer Not found
dbacp05055 P2 RALGWSCL Plant sources Inducing apoptosis MTS assay NB4 Not specified IC50 : 600 μg/mL
dbacp05056 P2 RALGWSCL Plant sources Inducing apoptosis MTS assay MOLT4 Not specified IC50 : 700 μg/mL
dbacp05057 P2 RALGWSCL Plant sources Inducing apoptosis MTS assay Raji Not specified IC50 : 700 μg/Ml
dbacp05127 PaDef ATCETPSKHFNGLCIRSSNCASVCHGEHFTDGRCQGVRRRCMCLKPC Plant sources Inducing apoptosis MTT assay Jurkat Leukemia Not found
dbacp05400 Peptide from Lentinus Squarrosulus RYGFTEVAGNFQQHNFGRG Plant sources Inducing apoptosis MTT assay H460 Breast cancer Not found
dbacp05401 Peptide from Lentinus Squarrosulus RYGFTEVAGNFQQHNFGRG Plant sources Inducing apoptosis MTT assay DPCs Breast cancer Not found
dbacp05402 Peptide from Lentinus Squarrosulus RYGFTEVAGNFQQHNFGRG Plant sources Inducing apoptosis MTT assay HK-2 Breast cancer Not found
dbacp05502 PHP ITCPQVTQSLAPCVPYLISG Plant sources Inducing apoptosis MTT assay Eca-109 Not found IC50 : 0.7 µM
dbacp05503 PHP ITCPQVTQSLAPCVPYLISG Plant sources Inducing apoptosis MTT assay HeLa Not found IC50 : 2.74 µM
dbacp05504 PHP ITCPQVTQSLAPCVPYLISG Plant sources Inducing apoptosis MTT assay MGC-7 Not found IC50 : 3.13 µM
dbacp05505 PHP ITCPQVTQSLAPCVPYLISG Plant sources Inducing apoptosis MTT assay B16 Not found IC50 : 1.47 µM
dbacp05863 RA-V cyclopeptideRA-V-,cyclo(YAAYAY) Plant sources Inducing apoptosis MTT assay MCF-7 Breast cancer Not found
dbacp05864 RA-V cyclopeptideRA-V-,cyclo(YAAYAY) Plant sources Inducing apoptosis MTT assay MDA-MB-231 Breast cancer Not found
dbacp05865 RA-V cyclopeptideRA-V-,cyclo(YAAYAY) Plant sources Inducing apoptosis MTT assay 4T1 Breast cancer Not found
dbacp06532 VS-9 VKLRSLLCS Plant sources Inducing apoptosis MTT assay MOLT4 Leukemia Not found
dbacp06533 VS-9 VKLRSLLCS Plant sources Inducing apoptosis MTT assay K562 Leukemia Not found