dbACP: A Comprehensive Database of Anti-Cancer Peptides

513 result(s) have been found!

Accession Name Sequence Source/Organism Mechanism Assay Type Cell Line Cancer Type Activity
dbacp00322 [C/U, G1K, L5Y, K8R]cGm KURRYUYRQRUVTYURGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay CRL-1739 Epithelial cancer CC50 : 46.2 ± 7.6 μM
dbacp00323 [C/U, G1K, L5Y, K8R]cGm KURRYUYRQRUVTYURGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay CRL-1739 Chronic myeloid Leukemia CC50 : 46.2 ± 7.6 μM
dbacp00324 [C/U, G1K, L5Y, K8R]cGm KURRYUYRQRUVTYURGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay CRL-1739 Gastric cancer CC50 : 46.2 ± 7.6 μM
dbacp00325 [C/U, G1K, L5Y, K8R]cGm KURRYUYRQRUVTYURGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay CRL-1739 Breast cancer CC50 : 46.2 ± 7.6 μM
dbacp00326 [C/U, G1K, L5Y, K8R]cGm KURRYUYRQRUVTYURGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay CRL-1739 Cervical cancer CC50 : 46.2 ± 7.6 μM
dbacp00327 [C/U, G1K, L5Y, K8R]cGm KURRYUYRQRUVTYURGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay MM96L Epithelial cancer CC50 : 2.3 ± 0.2 μM
dbacp00328 [C/U, G1K, L5Y, K8R]cGm KURRYUYRQRUVTYURGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay MM96L Chronic myeloid Leukemia CC50 : 2.3 ± 0.2 μM
dbacp00329 [C/U, G1K, L5Y, K8R]cGm KURRYUYRQRUVTYURGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay MM96L Gastric cancer CC50 : 2.3 ± 0.2 μM
dbacp00330 [C/U, G1K, L5Y, K8R]cGm KURRYUYRQRUVTYURGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay MM96L Breast cancer CC50 : 2.3 ± 0.2 μM
dbacp00331 [C/U, G1K, L5Y, K8R]cGm KURRYUYRQRUVTYURGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay MM96L Cervical cancer CC50 : 2.3 ± 0.2 μM
dbacp00332 [C/U, G1K, L5Y, K8R]cGm KURRYUYRQRUVTYURGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay HFF-1 Epithelial cancer CC50 : 30.8 ± 2.0 μM
dbacp00333 [C/U, G1K, L5Y, K8R]cGm KURRYUYRQRUVTYURGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay HFF-1 Chronic myeloid Leukemia CC50 : 30.8 ± 2.0 μM
dbacp00334 [C/U, G1K, L5Y, K8R]cGm KURRYUYRQRUVTYURGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay HFF-1 Gastric cancer CC50 : 30.8 ± 2.0 μM
dbacp00335 [C/U, G1K, L5Y, K8R]cGm KURRYUYRQRUVTYURGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay HFF-1 Breast cancer CC50 : 30.8 ± 2.0 μM
dbacp00336 [C/U, G1K, L5Y, K8R]cGm KURRYUYRQRUVTYURGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay HFF-1 Cervical cancer CC50 : 30.8 ± 2.0 μM
dbacp00337 [C/U, G1K, L5Y, K8R]cGm KURRYUYRQRUVTYURGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay HeLa Epithelial cancer CC50 : 36.2 ± 2.8 μM
dbacp00338 [C/U, G1K, L5Y, K8R]cGm KURRYUYRQRUVTYURGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay HeLa Chronic myeloid Leukemia CC50 : 36.2 ± 2.8 μM
dbacp00339 [C/U, G1K, L5Y, K8R]cGm KURRYUYRQRUVTYURGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay HeLa Gastric cancer CC50 : 36.2 ± 2.8 μM
dbacp00340 [C/U, G1K, L5Y, K8R]cGm KURRYUYRQRUVTYURGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay HeLa Breast cancer CC50 : 36.2 ± 2.8 μM
dbacp00341 [C/U, G1K, L5Y, K8R]cGm KURRYUYRQRUVTYURGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay HeLa Cervical cancer CC50 : 36.2 ± 2.8 μM
dbacp00342 [C/U, G1K, L5Y, K8R]cGm KURRYUYRQRUVTYURGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay MCF-7 Epithelial cancer CC50 : 29.0 ± 3.7 μM
dbacp00343 [C/U, G1K, L5Y, K8R]cGm KURRYUYRQRUVTYURGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay MCF-7 Chronic myeloid Leukemia CC50 : 29.0 ± 3.7 μM
dbacp00344 [C/U, G1K, L5Y, K8R]cGm KURRYUYRQRUVTYURGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay MCF-7 Gastric cancer CC50 : 29.0 ± 3.7 μM
dbacp00345 [C/U, G1K, L5Y, K8R]cGm KURRYUYRQRUVTYURGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay MCF-7 Breast cancer CC50 : 29.0 ± 3.7 μM
dbacp00346 [C/U, G1K, L5Y, K8R]cGm KURRYUYRQRUVTYURGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay MCF-7 Cervical cancer CC50 : 29.0 ± 3.7 μM
dbacp00347 [C/U, G1K, L5Y, K8R]cGm KURRYUYRQRUVTYURGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay K-562 Epithelial cancer CC50 : 6.4 ± 0.6 μM
dbacp00348 [C/U, G1K, L5Y, K8R]cGm KURRYUYRQRUVTYURGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay K-562 Chronic myeloid Leukemia CC50 : 6.4 ± 0.6 μM
dbacp00349 [C/U, G1K, L5Y, K8R]cGm KURRYUYRQRUVTYURGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay K-562 Gastric cancer CC50 : 6.4 ± 0.6 μM
dbacp00350 [C/U, G1K, L5Y, K8R]cGm KURRYUYRQRUVTYURGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay K-562 Breast cancer CC50 : 6.4 ± 0.6 μM
dbacp00351 [C/U, G1K, L5Y, K8R]cGm KURRYUYRQRUVTYURGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay K-562 Cervical cancer CC50 : 6.4 ± 0.6 μM
dbacp00352 [C/U, G1K, L5Y, K8R]cGm KURRYUYRQRUVTYURGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay HL-60 Epithelial cancer CC50 : 33.3 ±7.4 μM
dbacp00353 [C/U, G1K, L5Y, K8R]cGm KURRYUYRQRUVTYURGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay HL-60 Chronic myeloid Leukemia CC50 : 33.3 ±7.4 μM
dbacp00354 [C/U, G1K, L5Y, K8R]cGm KURRYUYRQRUVTYURGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay HL-60 Gastric cancer CC50 : 33.3 ±7.4 μM
dbacp00355 [C/U, G1K, L5Y, K8R]cGm KURRYUYRQRUVTYURGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay HL-60 Breast cancer CC50 : 33.3 ±7.4 μM
dbacp00356 [C/U, G1K, L5Y, K8R]cGm KURRYUYRQRUVTYURGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay HL-60 Cervical cancer CC50 : 33.3 ±7.4 μM
dbacp00357 [C/U, G1K, L5Y, K8R]cGm KURRYUYRQRUVTYURGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay PBMCs Epithelial cancer CC50 : 9.5 ± 0.5 μM
dbacp00358 [C/U, G1K, L5Y, K8R]cGm KURRYUYRQRUVTYURGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay PBMCs Chronic myeloid Leukemia CC50 : 9.5 ± 0.5 μM
dbacp00359 [C/U, G1K, L5Y, K8R]cGm KURRYUYRQRUVTYURGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay PBMCs Gastric cancer CC50 : 9.5 ± 0.5 μM
dbacp00360 [C/U, G1K, L5Y, K8R]cGm KURRYUYRQRUVTYURGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay PBMCs Breast cancer CC50 : 9.5 ± 0.5 μM
dbacp00361 [C/U, G1K, L5Y, K8R]cGm KURRYUYRQRUVTYURGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay PBMCs Cervical cancer CC50 : 9.5 ± 0.5 μM
dbacp00362 [C/U]cGm GURRLUYKQRUVTYURGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay CRL-1739 Epithelial cancer CC50 : 51.0 ± 4.6 μM
dbacp00363 [C/U]cGm GURRLUYKQRUVTYURGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay CRL-1739 Chronic myeloid Leukemia CC50 : 51.0 ± 4.6 μM
dbacp00364 [C/U]cGm GURRLUYKQRUVTYURGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay CRL-1739 Gastric cancer CC50 : 51.0 ± 4.6 μM
dbacp00365 [C/U]cGm GURRLUYKQRUVTYURGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay CRL-1739 Breast cancer CC50 : 51.0 ± 4.6 μM
dbacp00366 [C/U]cGm GURRLUYKQRUVTYURGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay CRL-1739 Cervical cancer CC50 : 51.0 ± 4.6 μM
dbacp00367 [C/U]cGm GURRLUYKQRUVTYURGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay MM96L Epithelial cancer CC50 : 4.6 ± 0.2 μM
dbacp00368 [C/U]cGm GURRLUYKQRUVTYURGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay MM96L Chronic myeloid Leukemia CC50 : 4.6 ± 0.2 μM
dbacp00369 [C/U]cGm GURRLUYKQRUVTYURGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay MM96L Gastric cancer CC50 : 4.6 ± 0.2 μM
dbacp00370 [C/U]cGm GURRLUYKQRUVTYURGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay MM96L Breast cancer CC50 : 4.6 ± 0.2 μM
dbacp00371 [C/U]cGm GURRLUYKQRUVTYURGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay MM96L Cervical cancer CC50 : 4.6 ± 0.2 μM
dbacp00372 [C/U]cGm GURRLUYKQRUVTYURGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay HFF-1 Epithelial cancer CC50 : 15.6 ± 3.6 μM
dbacp00373 [C/U]cGm GURRLUYKQRUVTYURGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay HFF-1 Chronic myeloid Leukemia CC50 : 15.6 ± 3.6 μM
dbacp00374 [C/U]cGm GURRLUYKQRUVTYURGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay HFF-1 Gastric cancer CC50 : 15.6 ± 3.6 μM
dbacp00375 [C/U]cGm GURRLUYKQRUVTYURGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay HFF-1 Breast cancer CC50 : 15.6 ± 3.6 μM
dbacp00376 [C/U]cGm GURRLUYKQRUVTYURGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay HFF-1 Cervical cancer CC50 : 15.6 ± 3.6 μM
dbacp00377 [C/U]cGm GURRLUYKQRUVTYURGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay HeLa Epithelial cancer CC50 : > 64 μM
dbacp00378 [C/U]cGm GURRLUYKQRUVTYURGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay HeLa Chronic myeloid Leukemia CC50 : > 64 μM
dbacp00379 [C/U]cGm GURRLUYKQRUVTYURGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay HeLa Gastric cancer CC50 : > 64 μM
dbacp00380 [C/U]cGm GURRLUYKQRUVTYURGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay HeLa Breast cancer CC50 : > 64 μM
dbacp00381 [C/U]cGm GURRLUYKQRUVTYURGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay HeLa Cervical cancer CC50 : > 64 μM
dbacp00382 [C/U]cGm GURRLUYKQRUVTYURGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay MCF-7 Epithelial cancer CC50 : 37.5 ± 3.3 μM
dbacp00383 [C/U]cGm GURRLUYKQRUVTYURGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay MCF-7 Chronic myeloid Leukemia CC50 : 37.5 ± 3.3 μM
dbacp00384 [C/U]cGm GURRLUYKQRUVTYURGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay MCF-7 Gastric cancer CC50 : 37.5 ± 3.3 μM
dbacp00385 [C/U]cGm GURRLUYKQRUVTYURGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay MCF-7 Breast cancer CC50 : 37.5 ± 3.3 μM
dbacp00386 [C/U]cGm GURRLUYKQRUVTYURGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay MCF-7 Cervical cancer CC50 : 37.5 ± 3.3 μM
dbacp00387 [C/U]cGm GURRLUYKQRUVTYURGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay K-562 Epithelial cancer CC50 : 1.4 ± 0.2 μM
dbacp00388 [C/U]cGm GURRLUYKQRUVTYURGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay K-562 Chronic myeloid Leukemia CC50 : 1.4 ± 0.2 μM
dbacp00389 [C/U]cGm GURRLUYKQRUVTYURGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay K-562 Gastric cancer CC50 : 1.4 ± 0.2 μM
dbacp00390 [C/U]cGm GURRLUYKQRUVTYURGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay K-562 Breast cancer CC50 : 1.4 ± 0.2 μM
dbacp00391 [C/U]cGm GURRLUYKQRUVTYURGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay K-562 Cervical cancer CC50 : 1.4 ± 0.2 μM
dbacp00392 [C/U]cGm GURRLUYKQRUVTYURGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay HL-60 Epithelial cancer CC50 : 38.5 ± 4.8 μM
dbacp00393 [C/U]cGm GURRLUYKQRUVTYURGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay HL-60 Chronic myeloid Leukemia CC50 : 38.5 ± 4.8 μM
dbacp00394 [C/U]cGm GURRLUYKQRUVTYURGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay HL-60 Gastric cancer CC50 : 38.5 ± 4.8 μM
dbacp00395 [C/U]cGm GURRLUYKQRUVTYURGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay HL-60 Breast cancer CC50 : 38.5 ± 4.8 μM
dbacp00396 [C/U]cGm GURRLUYKQRUVTYURGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay HL-60 Cervical cancer CC50 : 38.5 ± 4.8 μM
dbacp00397 [C/U]cGm GURRLUYKQRUVTYURGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay PBMCs Epithelial cancer CC50 : 15.5 ± 0.8 μM
dbacp00398 [C/U]cGm GURRLUYKQRUVTYURGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay PBMCs Chronic myeloid Leukemia CC50 : 15.5 ± 0.8 μM
dbacp00399 [C/U]cGm GURRLUYKQRUVTYURGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay PBMCs Gastric cancer CC50 : 15.5 ± 0.8 μM
dbacp00400 [C/U]cGm GURRLUYKQRUVTYURGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay PBMCs Breast cancer CC50 : 15.5 ± 0.8 μM
dbacp00401 [C/U]cGm GURRLUYKQRUVTYURGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay PBMCs Cervical cancer CC50 : 15.5 ± 0.8 μM
dbacp00403 [D-P L-P]cGm GCRRLCYKQRCVTYCRGpPR Synthetic construct Target and destroy tumor cell membranes Cell viability assay CRL-1739 Epithelial cancer CC50 : 22.5 ± 3.3 μM
dbacp00404 [D-P L-P]cGm GCRRLCYKQRCVTYCRGpPR Synthetic construct Target and destroy tumor cell membranes Cell viability assay CRL-1739 Chronic myeloid Leukemia CC50 : 22.5 ± 3.3 μM
dbacp00405 [D-P L-P]cGm GCRRLCYKQRCVTYCRGpPR Synthetic construct Target and destroy tumor cell membranes Cell viability assay CRL-1739 Gastric cancer CC50 : 22.5 ± 3.3 μM
dbacp00406 [D-P L-P]cGm GCRRLCYKQRCVTYCRGpPR Synthetic construct Target and destroy tumor cell membranes Cell viability assay CRL-1739 Breast cancer CC50 : 22.5 ± 3.3 μM
dbacp00407 [D-P L-P]cGm GCRRLCYKQRCVTYCRGpPR Synthetic construct Target and destroy tumor cell membranes Cell viability assay CRL-1739 Cervical cancer CC50 : 22.5 ± 3.3 μM
dbacp00408 [D-P L-P]cGm GCRRLCYKQRCVTYCRGpPR Synthetic construct Target and destroy tumor cell membranes Cell viability assay MM96L Epithelial cancer CC50 : 3.0 ± 0.1 μM
dbacp00409 [D-P L-P]cGm GCRRLCYKQRCVTYCRGpPR Synthetic construct Target and destroy tumor cell membranes Cell viability assay MM96L Chronic myeloid Leukemia CC50 : 3.0 ± 0.1 μM
dbacp00410 [D-P L-P]cGm GCRRLCYKQRCVTYCRGpPR Synthetic construct Target and destroy tumor cell membranes Cell viability assay MM96L Gastric cancer CC50 : 3.0 ± 0.1 μM
dbacp00411 [D-P L-P]cGm GCRRLCYKQRCVTYCRGpPR Synthetic construct Target and destroy tumor cell membranes Cell viability assay MM96L Breast cancer CC50 : 3.0 ± 0.1 μM
dbacp00412 [D-P L-P]cGm GCRRLCYKQRCVTYCRGpPR Synthetic construct Target and destroy tumor cell membranes Cell viability assay MM96L Cervical cancer CC50 : 3.0 ± 0.1 μM
dbacp00413 [D-P L-P]cGm GCRRLCYKQRCVTYCRGpPR Synthetic construct Target and destroy tumor cell membranes Cell viability assay HFF-1 Epithelial cancer CC50 : 14.9 ± 0.8 μM
dbacp00414 [D-P L-P]cGm GCRRLCYKQRCVTYCRGpPR Synthetic construct Target and destroy tumor cell membranes Cell viability assay HFF-1 Chronic myeloid Leukemia CC50 : 14.9 ± 0.8 μM
dbacp00415 [D-P L-P]cGm GCRRLCYKQRCVTYCRGpPR Synthetic construct Target and destroy tumor cell membranes Cell viability assay HFF-1 Gastric cancer CC50 : 14.9 ± 0.8 μM
dbacp00416 [D-P L-P]cGm GCRRLCYKQRCVTYCRGpPR Synthetic construct Target and destroy tumor cell membranes Cell viability assay HFF-1 Breast cancer CC50 : 14.9 ± 0.8 μM
dbacp00417 [D-P L-P]cGm GCRRLCYKQRCVTYCRGpPR Synthetic construct Target and destroy tumor cell membranes Cell viability assay HFF-1 Cervical cancer CC50 : 14.9 ± 0.8 μM
dbacp00418 [D-P L-P]cGm GCRRLCYKQRCVTYCRGpPR Synthetic construct Target and destroy tumor cell membranes Cell viability assay HeLa Epithelial cancer CC50 : 51.5 ± 3.9 μM
dbacp00419 [D-P L-P]cGm GCRRLCYKQRCVTYCRGpPR Synthetic construct Target and destroy tumor cell membranes Cell viability assay HeLa Chronic myeloid Leukemia CC50 : 51.5 ± 3.9 μM
dbacp00420 [D-P L-P]cGm GCRRLCYKQRCVTYCRGpPR Synthetic construct Target and destroy tumor cell membranes Cell viability assay HeLa Gastric cancer CC50 : 51.5 ± 3.9 μM
dbacp00421 [D-P L-P]cGm GCRRLCYKQRCVTYCRGpPR Synthetic construct Target and destroy tumor cell membranes Cell viability assay HeLa Breast cancer CC50 : 51.5 ± 3.9 μM
dbacp00422 [D-P L-P]cGm GCRRLCYKQRCVTYCRGpPR Synthetic construct Target and destroy tumor cell membranes Cell viability assay HeLa Cervical cancer CC50 : 51.5 ± 3.9 μM
dbacp00423 [D-P L-P]cGm GCRRLCYKQRCVTYCRGpPR Synthetic construct Target and destroy tumor cell membranes Cell viability assay K-562 Epithelial cancer CC50 : 3.9 ± 0.2 μM
dbacp00424 [D-P L-P]cGm GCRRLCYKQRCVTYCRGpPR Synthetic construct Target and destroy tumor cell membranes Cell viability assay K-562 Chronic myeloid Leukemia CC50 : 3.9 ± 0.2 μM
dbacp00425 [D-P L-P]cGm GCRRLCYKQRCVTYCRGpPR Synthetic construct Target and destroy tumor cell membranes Cell viability assay K-562 Gastric cancer CC50 : 3.9 ± 0.2 μM
dbacp00426 [D-P L-P]cGm GCRRLCYKQRCVTYCRGpPR Synthetic construct Target and destroy tumor cell membranes Cell viability assay K-562 Breast cancer CC50 : 3.9 ± 0.2 μM
dbacp00427 [D-P L-P]cGm GCRRLCYKQRCVTYCRGpPR Synthetic construct Target and destroy tumor cell membranes Cell viability assay K-562 Cervical cancer CC50 : 3.9 ± 0.2 μM
dbacp00428 [D-P L-P]cGm GCRRLCYKQRCVTYCRGpPR Synthetic construct Target and destroy tumor cell membranes Cell viability assay PBMCs Epithelial cancer CC50 : 14.1 ± 0.9 μM
dbacp00429 [D-P L-P]cGm GCRRLCYKQRCVTYCRGpPR Synthetic construct Target and destroy tumor cell membranes Cell viability assay PBMCs Chronic myeloid Leukemia CC50 : 14.1 ± 0.9 μM
dbacp00430 [D-P L-P]cGm GCRRLCYKQRCVTYCRGpPR Synthetic construct Target and destroy tumor cell membranes Cell viability assay PBMCs Gastric cancer CC50 : 14.1 ± 0.9 μM
dbacp00431 [D-P L-P]cGm GCRRLCYKQRCVTYCRGpPR Synthetic construct Target and destroy tumor cell membranes Cell viability assay PBMCs Breast cancer CC50 : 14.1 ± 0.9 μM
dbacp00432 [D-P L-P]cGm GCRRLCYKQRCVTYCRGpPR Synthetic construct Target and destroy tumor cell membranes Cell viability assay PBMCs Cervical cancer CC50 : 14.1 ± 0.9 μM
dbacp00440 [G1K, K8R]cGm KCRRLCYRQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay CRL-1739 Epithelial cancer CC50 : 19.5 ± 0.5 μM
dbacp00441 [G1K, K8R]cGm KCRRLCYRQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay CRL-1739 Chronic myeloid Leukemia CC50 : 19.5 ± 0.5 μM
dbacp00442 [G1K, K8R]cGm KCRRLCYRQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay CRL-1739 Gastric cancer CC50 : 19.5 ± 0.5 μM
dbacp00443 [G1K, K8R]cGm KCRRLCYRQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay CRL-1739 Breast cancer CC50 : 19.5 ± 0.5 μM
dbacp00444 [G1K, K8R]cGm KCRRLCYRQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay CRL-1739 Cervical cancer CC50 : 19.5 ± 0.5 μM
dbacp00445 [G1K, K8R]cGm KCRRLCYRQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay MM96L Epithelial cancer CC50 : 1.7 ± 0.1 μM
dbacp00446 [G1K, K8R]cGm KCRRLCYRQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay MM96L Chronic myeloid Leukemia CC50 : 1.7 ± 0.1 μM
dbacp00447 [G1K, K8R]cGm KCRRLCYRQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay MM96L Gastric cancer CC50 : 1.7 ± 0.1 μM
dbacp00448 [G1K, K8R]cGm KCRRLCYRQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay MM96L Breast cancer CC50 : 1.7 ± 0.1 μM
dbacp00449 [G1K, K8R]cGm KCRRLCYRQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay MM96L Cervical cancer CC50 : 1.7 ± 0.1 μM
dbacp00450 [G1K, K8R]cGm KCRRLCYRQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay HFF-1 Epithelial cancer CC50 : 9.0 ± 0.5 μM
dbacp00451 [G1K, K8R]cGm KCRRLCYRQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay HFF-1 Chronic myeloid Leukemia CC50 : 9.0 ± 0.5 μM
dbacp00452 [G1K, K8R]cGm KCRRLCYRQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay HFF-1 Gastric cancer CC50 : 9.0 ± 0.5 μM
dbacp00453 [G1K, K8R]cGm KCRRLCYRQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay HFF-1 Breast cancer CC50 : 9.0 ± 0.5 μM
dbacp00454 [G1K, K8R]cGm KCRRLCYRQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay HFF-1 Cervical cancer CC50 : 9.0 ± 0.5 μM
dbacp00455 [G1K, K8R]cGm KCRRLCYRQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay HeLa Epithelial cancer CC50 : 44.2 ± 2.2 μM
dbacp00456 [G1K, K8R]cGm KCRRLCYRQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay HeLa Chronic myeloid Leukemia CC50 : 44.2 ± 2.2 μM
dbacp00457 [G1K, K8R]cGm KCRRLCYRQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay HeLa Gastric cancer CC50 : 44.2 ± 2.2 μM
dbacp00458 [G1K, K8R]cGm KCRRLCYRQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay HeLa Breast cancer CC50 : 44.2 ± 2.2 μM
dbacp00459 [G1K, K8R]cGm KCRRLCYRQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay HeLa Cervical cancer CC50 : 44.2 ± 2.2 μM
dbacp00460 [G1K, K8R]cGm KCRRLCYRQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay MCF-7 Epithelial cancer CC50 : 6.7 ± 0.7 μM
dbacp00461 [G1K, K8R]cGm KCRRLCYRQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay MCF-7 Chronic myeloid Leukemia CC50 : 6.7 ± 0.7 μM
dbacp00462 [G1K, K8R]cGm KCRRLCYRQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay MCF-7 Gastric cancer CC50 : 6.7 ± 0.7 μM
dbacp00463 [G1K, K8R]cGm KCRRLCYRQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay MCF-7 Breast cancer CC50 : 6.7 ± 0.7 μM
dbacp00464 [G1K, K8R]cGm KCRRLCYRQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay MCF-7 Cervical cancer CC50 : 6.7 ± 0.7 μM
dbacp00465 [G1K, K8R]cGm KCRRLCYRQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay K-562 Epithelial cancer CC50 : 2.1 ± 0.2 μM
dbacp00466 [G1K, K8R]cGm KCRRLCYRQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay K-562 Chronic myeloid Leukemia CC50 : 2.1 ± 0.2 μM
dbacp00467 [G1K, K8R]cGm KCRRLCYRQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay K-562 Gastric cancer CC50 : 2.1 ± 0.2 μM
dbacp00468 [G1K, K8R]cGm KCRRLCYRQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay K-562 Breast cancer CC50 : 2.1 ± 0.2 μM
dbacp00469 [G1K, K8R]cGm KCRRLCYRQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay K-562 Cervical cancer CC50 : 2.1 ± 0.2 μM
dbacp00470 [G1K, K8R]cGm KCRRLCYRQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay HL-60 Epithelial cancer CC50 : 9.0 ± 1.1μM
dbacp00471 [G1K, K8R]cGm KCRRLCYRQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay HL-60 Chronic myeloid Leukemia CC50 : 9.0 ± 1.1μM
dbacp00472 [G1K, K8R]cGm KCRRLCYRQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay HL-60 Gastric cancer CC50 : 9.0 ± 1.1μM
dbacp00473 [G1K, K8R]cGm KCRRLCYRQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay HL-60 Breast cancer CC50 : 9.0 ± 1.1μM
dbacp00474 [G1K, K8R]cGm KCRRLCYRQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay HL-60 Cervical cancer CC50 : 9.0 ± 1.1μM
dbacp00475 [G1K, K8R]cGm KCRRLCYRQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay PBMCs Epithelial cancer CC50 : 5.1 ± 0.3 μM
dbacp00476 [G1K, K8R]cGm KCRRLCYRQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay PBMCs Chronic myeloid Leukemia CC50 : 5.1 ± 0.3 μM
dbacp00477 [G1K, K8R]cGm KCRRLCYRQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay PBMCs Gastric cancer CC50 : 5.1 ± 0.3 μM
dbacp00478 [G1K, K8R]cGm KCRRLCYRQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay PBMCs Breast cancer CC50 : 5.1 ± 0.3 μM
dbacp00479 [G1K, K8R]cGm KCRRLCYRQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay PBMCs Cervical cancer CC50 : 5.1 ± 0.3 μM
dbacp00480 [G1K, L5Y, K8R]cGm KCRRYCYRQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay CRL-1739 Epithelial cancer CC50 : 26.5 ± 2.4 μM
dbacp00481 [G1K, L5Y, K8R]cGm KCRRYCYRQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay CRL-1739 Chronic myeloid Leukemia CC50 : 26.5 ± 2.4 μM
dbacp00482 [G1K, L5Y, K8R]cGm KCRRYCYRQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay CRL-1739 Gastric cancer CC50 : 26.5 ± 2.4 μM
dbacp00483 [G1K, L5Y, K8R]cGm KCRRYCYRQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay CRL-1739 Breast cancer CC50 : 26.5 ± 2.4 μM
dbacp00484 [G1K, L5Y, K8R]cGm KCRRYCYRQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay CRL-1739 Cervical cancer CC50 : 26.5 ± 2.4 μM
dbacp00485 [G1K, L5Y, K8R]cGm KCRRYCYRQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay MM96L Epithelial cancer CC50 : 2.0 ± 0.1 μM
dbacp00486 [G1K, L5Y, K8R]cGm KCRRYCYRQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay MM96L Chronic myeloid Leukemia CC50 : 2.0 ± 0.1 μM
dbacp00487 [G1K, L5Y, K8R]cGm KCRRYCYRQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay MM96L Gastric cancer CC50 : 2.0 ± 0.1 μM
dbacp00488 [G1K, L5Y, K8R]cGm KCRRYCYRQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay MM96L Breast cancer CC50 : 2.0 ± 0.1 μM
dbacp00489 [G1K, L5Y, K8R]cGm KCRRYCYRQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay MM96L Cervical cancer CC50 : 2.0 ± 0.1 μM
dbacp00490 [G1K, L5Y, K8R]cGm KCRRYCYRQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay HFF-1 Epithelial cancer CC50 : 14.7 ± 1.5 μM
dbacp00491 [G1K, L5Y, K8R]cGm KCRRYCYRQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay HFF-1 Chronic myeloid Leukemia CC50 : 14.7 ± 1.5 μM
dbacp00492 [G1K, L5Y, K8R]cGm KCRRYCYRQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay HFF-1 Gastric cancer CC50 : 14.7 ± 1.5 μM
dbacp00493 [G1K, L5Y, K8R]cGm KCRRYCYRQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay HFF-1 Breast cancer CC50 : 14.7 ± 1.5 μM
dbacp00494 [G1K, L5Y, K8R]cGm KCRRYCYRQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay HFF-1 Cervical cancer CC50 : 14.7 ± 1.5 μM
dbacp00495 [G1K, L5Y, K8R]cGm KCRRYCYRQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay HeLa Epithelial cancer CC50 : 20.9 ± 1.4 μM
dbacp00496 [G1K, L5Y, K8R]cGm KCRRYCYRQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay HeLa Chronic myeloid Leukemia CC50 : 20.9 ± 1.4 μM
dbacp00497 [G1K, L5Y, K8R]cGm KCRRYCYRQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay HeLa Gastric cancer CC50 : 20.9 ± 1.4 μM
dbacp00498 [G1K, L5Y, K8R]cGm KCRRYCYRQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay HeLa Breast cancer CC50 : 20.9 ± 1.4 μM
dbacp00499 [G1K, L5Y, K8R]cGm KCRRYCYRQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay HeLa Cervical cancer CC50 : 20.9 ± 1.4 μM
dbacp00500 [G1K, L5Y, K8R]cGm KCRRYCYRQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay MCF-7 Epithelial cancer CC50 : 15.2 ± 1.9 μM
dbacp00501 [G1K, L5Y, K8R]cGm KCRRYCYRQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay MCF-7 Chronic myeloid Leukemia CC50 : 15.2 ± 1.9 μM
dbacp00502 [G1K, L5Y, K8R]cGm KCRRYCYRQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay MCF-7 Gastric cancer CC50 : 15.2 ± 1.9 μM
dbacp00503 [G1K, L5Y, K8R]cGm KCRRYCYRQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay MCF-7 Breast cancer CC50 : 15.2 ± 1.9 μM
dbacp00504 [G1K, L5Y, K8R]cGm KCRRYCYRQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay MCF-7 Cervical cancer CC50 : 15.2 ± 1.9 μM
dbacp00505 [G1K, L5Y, K8R]cGm KCRRYCYRQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay K-562 Epithelial cancer CC50 : 1.3 ± 0.1 μM
dbacp00506 [G1K, L5Y, K8R]cGm KCRRYCYRQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay K-562 Chronic myeloid Leukemia CC50 : 1.3 ± 0.1 μM
dbacp00507 [G1K, L5Y, K8R]cGm KCRRYCYRQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay K-562 Gastric cancer CC50 : 1.3 ± 0.1 μM
dbacp00508 [G1K, L5Y, K8R]cGm KCRRYCYRQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay K-562 Breast cancer CC50 : 1.3 ± 0.1 μM
dbacp00509 [G1K, L5Y, K8R]cGm KCRRYCYRQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay K-562 Cervical cancer CC50 : 1.3 ± 0.1 μM
dbacp00510 [G1K, L5Y, K8R]cGm KCRRYCYRQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay HL-60 Epithelial cancer CC50 : 15.7 ±1.1μM
dbacp00511 [G1K, L5Y, K8R]cGm KCRRYCYRQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay HL-60 Chronic myeloid Leukemia CC50 : 15.7 ±1.1μM
dbacp00512 [G1K, L5Y, K8R]cGm KCRRYCYRQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay HL-60 Gastric cancer CC50 : 15.7 ±1.1μM
dbacp00513 [G1K, L5Y, K8R]cGm KCRRYCYRQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay HL-60 Breast cancer CC50 : 15.7 ±1.1μM
dbacp00514 [G1K, L5Y, K8R]cGm KCRRYCYRQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay HL-60 Cervical cancer CC50 : 15.7 ±1.1μM
dbacp00515 [G1K, L5Y, K8R]cGm KCRRYCYRQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay PBMCs Epithelial cancer CC50 : 10.4 ± 1.0 μM
dbacp00516 [G1K, L5Y, K8R]cGm KCRRYCYRQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay PBMCs Chronic myeloid Leukemia CC50 : 10.4 ± 1.0 μM
dbacp00517 [G1K, L5Y, K8R]cGm KCRRYCYRQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay PBMCs Gastric cancer CC50 : 10.4 ± 1.0 μM
dbacp00518 [G1K, L5Y, K8R]cGm KCRRYCYRQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay PBMCs Breast cancer CC50 : 10.4 ± 1.0 μM
dbacp00519 [G1K, L5Y, K8R]cGm KCRRYCYRQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay PBMCs Cervical cancer CC50 : 10.4 ± 1.0 μM
dbacp00520 [K8R]cGm GCRRLCYRQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay CRL-1739 Epithelial cancer CC50 : 29.4 ± 1.1 μM
dbacp00521 [K8R]cGm GCRRLCYRQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay CRL-1739 Chronic myeloid Leukemia CC50 : 29.4 ± 1.1 μM
dbacp00522 [K8R]cGm GCRRLCYRQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay CRL-1739 Gastric cancer CC50 : 29.4 ± 1.1 μM
dbacp00523 [K8R]cGm GCRRLCYRQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay CRL-1739 Breast cancer CC50 : 29.4 ± 1.1 μM
dbacp00524 [K8R]cGm GCRRLCYRQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay CRL-1739 Cervical cancer CC50 : 29.4 ± 1.1 μM
dbacp00525 [K8R]cGm GCRRLCYRQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay MM96L Epithelial cancer CC50 : 5.0 ± 0.3 μM
dbacp00526 [K8R]cGm GCRRLCYRQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay MM96L Chronic myeloid Leukemia CC50 : 5.0 ± 0.3 μM
dbacp00527 [K8R]cGm GCRRLCYRQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay MM96L Gastric cancer CC50 : 5.0 ± 0.3 μM
dbacp00528 [K8R]cGm GCRRLCYRQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay MM96L Breast cancer CC50 : 5.0 ± 0.3 μM
dbacp00529 [K8R]cGm GCRRLCYRQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay MM96L Cervical cancer CC50 : 5.0 ± 0.3 μM
dbacp00530 [K8R]cGm GCRRLCYRQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay HFF-1 Epithelial cancer CC50 : 34.5 ± 3.6 μM
dbacp00531 [K8R]cGm GCRRLCYRQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay HFF-1 Chronic myeloid Leukemia CC50 : 34.5 ± 3.6 μM
dbacp00532 [K8R]cGm GCRRLCYRQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay HFF-1 Gastric cancer CC50 : 34.5 ± 3.6 μM
dbacp00533 [K8R]cGm GCRRLCYRQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay HFF-1 Breast cancer CC50 : 34.5 ± 3.6 μM
dbacp00534 [K8R]cGm GCRRLCYRQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay HFF-1 Cervical cancer CC50 : 34.5 ± 3.6 μM
dbacp00535 [K8R]cGm GCRRLCYRQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay HeLa Epithelial cancer CC50 : 39.4 ± 2.6 μM
dbacp00536 [K8R]cGm GCRRLCYRQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay HeLa Chronic myeloid Leukemia CC50 : 39.4 ± 2.6 μM
dbacp00537 [K8R]cGm GCRRLCYRQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay HeLa Gastric cancer CC50 : 39.4 ± 2.6 μM
dbacp00538 [K8R]cGm GCRRLCYRQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay HeLa Breast cancer CC50 : 39.4 ± 2.6 μM
dbacp00539 [K8R]cGm GCRRLCYRQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay HeLa Cervical cancer CC50 : 39.4 ± 2.6 μM
dbacp00540 [K8R]cGm GCRRLCYRQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay K-562 Epithelial cancer CC50 : 3.1 ± 0.1 μM
dbacp00541 [K8R]cGm GCRRLCYRQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay K-562 Chronic myeloid Leukemia CC50 : 3.1 ± 0.1 μM
dbacp00542 [K8R]cGm GCRRLCYRQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay K-562 Gastric cancer CC50 : 3.1 ± 0.1 μM
dbacp00543 [K8R]cGm GCRRLCYRQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay K-562 Breast cancer CC50 : 3.1 ± 0.1 μM
dbacp00544 [K8R]cGm GCRRLCYRQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay K-562 Cervical cancer CC50 : 3.1 ± 0.1 μM
dbacp00545 [L5W]cGm GCRRWCYKQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay CRL-1739 Epithelial cancer CC50 : 18.3 ± 1.4 μM
dbacp00546 [L5W]cGm GCRRWCYKQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay CRL-1739 Chronic myeloid Leukemia CC50 : 18.3 ± 1.4 μM
dbacp00547 [L5W]cGm GCRRWCYKQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay CRL-1739 Gastric cancer CC50 : 18.3 ± 1.4 μM
dbacp00548 [L5W]cGm GCRRWCYKQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay CRL-1739 Breast cancer CC50 : 18.3 ± 1.4 μM
dbacp00549 [L5W]cGm GCRRWCYKQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay CRL-1739 Cervical cancer CC50 : 18.3 ± 1.4 μM
dbacp00550 [L5W]cGm GCRRWCYKQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay MM96L Epithelial cancer CC50 : 4.0 ± 0.1 μM
dbacp00551 [L5W]cGm GCRRWCYKQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay MM96L Chronic myeloid Leukemia CC50 : 4.0 ± 0.1 μM
dbacp00552 [L5W]cGm GCRRWCYKQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay MM96L Gastric cancer CC50 : 4.0 ± 0.1 μM
dbacp00553 [L5W]cGm GCRRWCYKQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay MM96L Breast cancer CC50 : 4.0 ± 0.1 μM
dbacp00554 [L5W]cGm GCRRWCYKQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay MM96L Cervical cancer CC50 : 4.0 ± 0.1 μM
dbacp00555 [L5W]cGm GCRRWCYKQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay HFF-1 Epithelial cancer CC50 : 25.0 ± 2.9 μM
dbacp00556 [L5W]cGm GCRRWCYKQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay HFF-1 Chronic myeloid Leukemia CC50 : 25.0 ± 2.9 μM
dbacp00557 [L5W]cGm GCRRWCYKQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay HFF-1 Gastric cancer CC50 : 25.0 ± 2.9 μM
dbacp00558 [L5W]cGm GCRRWCYKQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay HFF-1 Breast cancer CC50 : 25.0 ± 2.9 μM
dbacp00559 [L5W]cGm GCRRWCYKQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay HFF-1 Cervical cancer CC50 : 25.0 ± 2.9 μM
dbacp00560 [L5W]cGm GCRRWCYKQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay HeLa Epithelial cancer CC50 : 17.1 ± 0.7 μM
dbacp00561 [L5W]cGm GCRRWCYKQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay HeLa Chronic myeloid Leukemia CC50 : 17.1 ± 0.7 μM
dbacp00562 [L5W]cGm GCRRWCYKQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay HeLa Gastric cancer CC50 : 17.1 ± 0.7 μM
dbacp00563 [L5W]cGm GCRRWCYKQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay HeLa Breast cancer CC50 : 17.1 ± 0.7 μM
dbacp00564 [L5W]cGm GCRRWCYKQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay HeLa Cervical cancer CC50 : 17.1 ± 0.7 μM
dbacp00565 [L5W]cGm GCRRWCYKQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay K-562 Epithelial cancer CC50 : 1.0 ± 0.1 μM
dbacp00566 [L5W]cGm GCRRWCYKQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay K-562 Chronic myeloid Leukemia CC50 : 1.0 ± 0.1 μM
dbacp00567 [L5W]cGm GCRRWCYKQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay K-562 Gastric cancer CC50 : 1.0 ± 0.1 μM
dbacp00568 [L5W]cGm GCRRWCYKQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay K-562 Breast cancer CC50 : 1.0 ± 0.1 μM
dbacp00569 [L5W]cGm GCRRWCYKQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay K-562 Cervical cancer CC50 : 1.0 ± 0.1 μM
dbacp00573 [R4A, R18A]cGm GCRALCYKQRCVTYCRGA Synthetic construct Target and destroy tumor cell membranes Cell viability assay CRL-1739 Epithelial cancer CC50 : > 64 μM
dbacp00574 [R4A, R18A]cGm GCRALCYKQRCVTYCRGA Synthetic construct Target and destroy tumor cell membranes Cell viability assay CRL-1739 Chronic myeloid Leukemia CC50 : > 64 μM
dbacp00575 [R4A, R18A]cGm GCRALCYKQRCVTYCRGA Synthetic construct Target and destroy tumor cell membranes Cell viability assay CRL-1739 Gastric cancer CC50 : > 64 μM
dbacp00576 [R4A, R18A]cGm GCRALCYKQRCVTYCRGA Synthetic construct Target and destroy tumor cell membranes Cell viability assay CRL-1739 Breast cancer CC50 : > 64 μM
dbacp00577 [R4A, R18A]cGm GCRALCYKQRCVTYCRGA Synthetic construct Target and destroy tumor cell membranes Cell viability assay CRL-1739 Cervical cancer CC50 : > 64 μM
dbacp00578 [R4A, R18A]cGm GCRALCYKQRCVTYCRGA Synthetic construct Target and destroy tumor cell membranes Cell viability assay MM96L Epithelial cancer CC50 : 10.3 ± 1.1 μM
dbacp00579 [R4A, R18A]cGm GCRALCYKQRCVTYCRGA Synthetic construct Target and destroy tumor cell membranes Cell viability assay MM96L Chronic myeloid Leukemia CC50 : 10.3 ± 1.1 μM
dbacp00580 [R4A, R18A]cGm GCRALCYKQRCVTYCRGA Synthetic construct Target and destroy tumor cell membranes Cell viability assay MM96L Gastric cancer CC50 : 10.3 ± 1.1 μM
dbacp00581 [R4A, R18A]cGm GCRALCYKQRCVTYCRGA Synthetic construct Target and destroy tumor cell membranes Cell viability assay MM96L Breast cancer CC50 : 10.3 ± 1.1 μM
dbacp00582 [R4A, R18A]cGm GCRALCYKQRCVTYCRGA Synthetic construct Target and destroy tumor cell membranes Cell viability assay MM96L Cervical cancer CC50 : 10.3 ± 1.1 μM
dbacp00583 [R4A, R18A]cGm GCRALCYKQRCVTYCRGA Synthetic construct Target and destroy tumor cell membranes Cell viability assay HFF-1 Epithelial cancer CC50 : 51.2 ± 4.0 μM
dbacp00584 [R4A, R18A]cGm GCRALCYKQRCVTYCRGA Synthetic construct Target and destroy tumor cell membranes Cell viability assay HFF-1 Chronic myeloid Leukemia CC50 : 51.2 ± 4.0 μM
dbacp00585 [R4A, R18A]cGm GCRALCYKQRCVTYCRGA Synthetic construct Target and destroy tumor cell membranes Cell viability assay HFF-1 Gastric cancer CC50 : 51.2 ± 4.0 μM
dbacp00586 [R4A, R18A]cGm GCRALCYKQRCVTYCRGA Synthetic construct Target and destroy tumor cell membranes Cell viability assay HFF-1 Breast cancer CC50 : 51.2 ± 4.0 μM
dbacp00587 [R4A, R18A]cGm GCRALCYKQRCVTYCRGA Synthetic construct Target and destroy tumor cell membranes Cell viability assay HFF-1 Cervical cancer CC50 : 51.2 ± 4.0 μM
dbacp00588 [R4A, R18A]cGm GCRALCYKQRCVTYCRGA Synthetic construct Target and destroy tumor cell membranes Cell viability assay HeLa Epithelial cancer CC50 : > 64 μM
dbacp00589 [R4A, R18A]cGm GCRALCYKQRCVTYCRGA Synthetic construct Target and destroy tumor cell membranes Cell viability assay HeLa Chronic myeloid Leukemia CC50 : > 64 μM
dbacp00590 [R4A, R18A]cGm GCRALCYKQRCVTYCRGA Synthetic construct Target and destroy tumor cell membranes Cell viability assay HeLa Gastric cancer CC50 : > 64 μM
dbacp00591 [R4A, R18A]cGm GCRALCYKQRCVTYCRGA Synthetic construct Target and destroy tumor cell membranes Cell viability assay HeLa Breast cancer CC50 : > 64 μM
dbacp00592 [R4A, R18A]cGm GCRALCYKQRCVTYCRGA Synthetic construct Target and destroy tumor cell membranes Cell viability assay HeLa Cervical cancer CC50 : > 64 μM
dbacp00593 [R4A, R18A]cGm GCRALCYKQRCVTYCRGA Synthetic construct Target and destroy tumor cell membranes Cell viability assay MCF-7 Epithelial cancer CC50 : 48.4 ± 0.7 μM
dbacp00594 [R4A, R18A]cGm GCRALCYKQRCVTYCRGA Synthetic construct Target and destroy tumor cell membranes Cell viability assay MCF-7 Chronic myeloid Leukemia CC50 : 48.4 ± 0.7 μM
dbacp00595 [R4A, R18A]cGm GCRALCYKQRCVTYCRGA Synthetic construct Target and destroy tumor cell membranes Cell viability assay MCF-7 Gastric cancer CC50 : 48.4 ± 0.7 μM
dbacp00596 [R4A, R18A]cGm GCRALCYKQRCVTYCRGA Synthetic construct Target and destroy tumor cell membranes Cell viability assay MCF-7 Breast cancer CC50 : 48.4 ± 0.7 μM
dbacp00597 [R4A, R18A]cGm GCRALCYKQRCVTYCRGA Synthetic construct Target and destroy tumor cell membranes Cell viability assay MCF-7 Cervical cancer CC50 : 48.4 ± 0.7 μM
dbacp00598 [R4A, R18A]cGm GCRALCYKQRCVTYCRGA Synthetic construct Target and destroy tumor cell membranes Cell viability assay K-562 Epithelial cancer CC50 : 11.5 ± 0.6 μM
dbacp00599 [R4A, R18A]cGm GCRALCYKQRCVTYCRGA Synthetic construct Target and destroy tumor cell membranes Cell viability assay K-562 Chronic myeloid Leukemia CC50 : 11.5 ± 0.6 μM
dbacp00600 [R4A, R18A]cGm GCRALCYKQRCVTYCRGA Synthetic construct Target and destroy tumor cell membranes Cell viability assay K-562 Gastric cancer CC50 : 11.5 ± 0.6 μM
dbacp00601 [R4A, R18A]cGm GCRALCYKQRCVTYCRGA Synthetic construct Target and destroy tumor cell membranes Cell viability assay K-562 Breast cancer CC50 : 11.5 ± 0.6 μM
dbacp00602 [R4A, R18A]cGm GCRALCYKQRCVTYCRGA Synthetic construct Target and destroy tumor cell membranes Cell viability assay K-562 Cervical cancer CC50 : 11.5 ± 0.6 μM
dbacp00603 [R4A, R18A]cGm GCRALCYKQRCVTYCRGA Synthetic construct Target and destroy tumor cell membranes Cell viability assay HL-60 Epithelial cancer CC50 : 34.1 ± 3.9 μM
dbacp00604 [R4A, R18A]cGm GCRALCYKQRCVTYCRGA Synthetic construct Target and destroy tumor cell membranes Cell viability assay HL-60 Chronic myeloid Leukemia CC50 : 34.1 ± 3.9 μM
dbacp00605 [R4A, R18A]cGm GCRALCYKQRCVTYCRGA Synthetic construct Target and destroy tumor cell membranes Cell viability assay HL-60 Gastric cancer CC50 : 34.1 ± 3.9 μM
dbacp00606 [R4A, R18A]cGm GCRALCYKQRCVTYCRGA Synthetic construct Target and destroy tumor cell membranes Cell viability assay HL-60 Breast cancer CC50 : 34.1 ± 3.9 μM
dbacp00607 [R4A, R18A]cGm GCRALCYKQRCVTYCRGA Synthetic construct Target and destroy tumor cell membranes Cell viability assay HL-60 Cervical cancer CC50 : 34.1 ± 3.9 μM
dbacp00608 [R4A, R18A]cGm GCRALCYKQRCVTYCRGA Synthetic construct Target and destroy tumor cell membranes Cell viability assay PBMCs Epithelial cancer CC50 : 30.8 ± 2.5 μM
dbacp00609 [R4A, R18A]cGm GCRALCYKQRCVTYCRGA Synthetic construct Target and destroy tumor cell membranes Cell viability assay PBMCs Chronic myeloid Leukemia CC50 : 30.8 ± 2.5 μM
dbacp00610 [R4A, R18A]cGm GCRALCYKQRCVTYCRGA Synthetic construct Target and destroy tumor cell membranes Cell viability assay PBMCs Gastric cancer CC50 : 30.8 ± 2.5 μM
dbacp00611 [R4A, R18A]cGm GCRALCYKQRCVTYCRGA Synthetic construct Target and destroy tumor cell membranes Cell viability assay PBMCs Breast cancer CC50 : 30.8 ± 2.5 μM
dbacp00612 [R4A, R18A]cGm GCRALCYKQRCVTYCRGA Synthetic construct Target and destroy tumor cell membranes Cell viability assay PBMCs Cervical cancer CC50 : 30.8 ± 2.5 μM
dbacp00621 [Y14W]cGm GCRRLCYKQRCVTWCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay CRL-1739 Epithelial cancer CC50 : 30.3 ± 1.1 μM
dbacp00622 [Y14W]cGm GCRRLCYKQRCVTWCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay CRL-1739 Chronic myeloid Leukemia CC50 : 30.3 ± 1.1 μM
dbacp00623 [Y14W]cGm GCRRLCYKQRCVTWCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay CRL-1739 Gastric cancer CC50 : 30.3 ± 1.1 μM
dbacp00624 [Y14W]cGm GCRRLCYKQRCVTWCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay CRL-1739 Breast cancer CC50 : 30.3 ± 1.1 μM
dbacp00625 [Y14W]cGm GCRRLCYKQRCVTWCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay CRL-1739 Cervical cancer CC50 : 30.3 ± 1.1 μM
dbacp00626 [Y14W]cGm GCRRLCYKQRCVTWCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay MM96L Epithelial cancer CC50 : 4.0 ± 0.1 μM
dbacp00627 [Y14W]cGm GCRRLCYKQRCVTWCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay MM96L Chronic myeloid Leukemia CC50 : 4.0 ± 0.1 μM
dbacp00628 [Y14W]cGm GCRRLCYKQRCVTWCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay MM96L Gastric cancer CC50 : 4.0 ± 0.1 μM
dbacp00629 [Y14W]cGm GCRRLCYKQRCVTWCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay MM96L Breast cancer CC50 : 4.0 ± 0.1 μM
dbacp00630 [Y14W]cGm GCRRLCYKQRCVTWCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay MM96L Cervical cancer CC50 : 4.0 ± 0.1 μM
dbacp00631 [Y14W]cGm GCRRLCYKQRCVTWCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay HFF-1 Epithelial cancer CC50 : 68.4 ± 9.6 μM
dbacp00632 [Y14W]cGm GCRRLCYKQRCVTWCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay HFF-1 Chronic myeloid Leukemia CC50 : 68.4 ± 9.6 μM
dbacp00633 [Y14W]cGm GCRRLCYKQRCVTWCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay HFF-1 Gastric cancer CC50 : 68.4 ± 9.6 μM
dbacp00634 [Y14W]cGm GCRRLCYKQRCVTWCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay HFF-1 Breast cancer CC50 : 68.4 ± 9.6 μM
dbacp00635 [Y14W]cGm GCRRLCYKQRCVTWCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay HFF-1 Cervical cancer CC50 : 68.4 ± 9.6 μM
dbacp00636 [Y14W]cGm GCRRLCYKQRCVTWCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay HeLa Epithelial cancer CC50 : 50.4 ± 2.4 μM
dbacp00637 [Y14W]cGm GCRRLCYKQRCVTWCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay HeLa Chronic myeloid Leukemia CC50 : 50.4 ± 2.4 μM
dbacp00638 [Y14W]cGm GCRRLCYKQRCVTWCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay HeLa Gastric cancer CC50 : 50.4 ± 2.4 μM
dbacp00639 [Y14W]cGm GCRRLCYKQRCVTWCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay HeLa Breast cancer CC50 : 50.4 ± 2.4 μM
dbacp00640 [Y14W]cGm GCRRLCYKQRCVTWCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay HeLa Cervical cancer CC50 : 50.4 ± 2.4 μM
dbacp00641 [Y14W]cGm GCRRLCYKQRCVTWCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay K-562 Epithelial cancer CC50 : 2.7 ± 0.1 μM
dbacp00642 [Y14W]cGm GCRRLCYKQRCVTWCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay K-562 Chronic myeloid Leukemia CC50 : 2.7 ± 0.1 μM
dbacp00643 [Y14W]cGm GCRRLCYKQRCVTWCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay K-562 Gastric cancer CC50 : 2.7 ± 0.1 μM
dbacp00644 [Y14W]cGm GCRRLCYKQRCVTWCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay K-562 Breast cancer CC50 : 2.7 ± 0.1 μM
dbacp00645 [Y14W]cGm GCRRLCYKQRCVTWCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay K-562 Cervical cancer CC50 : 2.7 ± 0.1 μM
dbacp00646 [Y7W, K8R, Y14W]cGm GCRRLCWRQRCVTWCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay CRL-1739 Epithelial cancer CC50 : 31.6 ± 1.3 μM
dbacp00647 [Y7W, K8R, Y14W]cGm GCRRLCWRQRCVTWCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay CRL-1739 Chronic myeloid Leukemia CC50 : 31.6 ± 1.3 μM
dbacp00648 [Y7W, K8R, Y14W]cGm GCRRLCWRQRCVTWCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay CRL-1739 Gastric cancer CC50 : 31.6 ± 1.3 μM
dbacp00649 [Y7W, K8R, Y14W]cGm GCRRLCWRQRCVTWCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay CRL-1739 Breast cancer CC50 : 31.6 ± 1.3 μM
dbacp00650 [Y7W, K8R, Y14W]cGm GCRRLCWRQRCVTWCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay CRL-1739 Cervical cancer CC50 : 31.6 ± 1.3 μM
dbacp00651 [Y7W, K8R, Y14W]cGm GCRRLCWRQRCVTWCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay MM96L Epithelial cancer CC50 : 5.4 ± 0.3 μM
dbacp00652 [Y7W, K8R, Y14W]cGm GCRRLCWRQRCVTWCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay MM96L Chronic myeloid Leukemia CC50 : 5.4 ± 0.3 μM
dbacp00653 [Y7W, K8R, Y14W]cGm GCRRLCWRQRCVTWCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay MM96L Gastric cancer CC50 : 5.4 ± 0.3 μM
dbacp00654 [Y7W, K8R, Y14W]cGm GCRRLCWRQRCVTWCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay MM96L Breast cancer CC50 : 5.4 ± 0.3 μM
dbacp00655 [Y7W, K8R, Y14W]cGm GCRRLCWRQRCVTWCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay MM96L Cervical cancer CC50 : 5.4 ± 0.3 μM
dbacp00656 [Y7W, K8R, Y14W]cGm GCRRLCWRQRCVTWCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay HFF-1 Epithelial cancer CC50 : 31.3 ± 2.6 μM
dbacp00657 [Y7W, K8R, Y14W]cGm GCRRLCWRQRCVTWCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay HFF-1 Chronic myeloid Leukemia CC50 : 31.3 ± 2.6 μM
dbacp00658 [Y7W, K8R, Y14W]cGm GCRRLCWRQRCVTWCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay HFF-1 Gastric cancer CC50 : 31.3 ± 2.6 μM
dbacp00659 [Y7W, K8R, Y14W]cGm GCRRLCWRQRCVTWCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay HFF-1 Breast cancer CC50 : 31.3 ± 2.6 μM
dbacp00660 [Y7W, K8R, Y14W]cGm GCRRLCWRQRCVTWCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay HFF-1 Cervical cancer CC50 : 31.3 ± 2.6 μM
dbacp00661 [Y7W, K8R, Y14W]cGm GCRRLCWRQRCVTWCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay HeLa Epithelial cancer CC50 : 41.0 ± 4.2 μM
dbacp00662 [Y7W, K8R, Y14W]cGm GCRRLCWRQRCVTWCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay HeLa Chronic myeloid Leukemia CC50 : 41.0 ± 4.2 μM
dbacp00663 [Y7W, K8R, Y14W]cGm GCRRLCWRQRCVTWCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay HeLa Gastric cancer CC50 : 41.0 ± 4.2 μM
dbacp00664 [Y7W, K8R, Y14W]cGm GCRRLCWRQRCVTWCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay HeLa Breast cancer CC50 : 41.0 ± 4.2 μM
dbacp00665 [Y7W, K8R, Y14W]cGm GCRRLCWRQRCVTWCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay HeLa Cervical cancer CC50 : 41.0 ± 4.2 μM
dbacp00666 [Y7W, K8R, Y14W]cGm GCRRLCWRQRCVTWCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay MCF-7 Epithelial cancer CC50 : 15.1 ± 1.4 μM
dbacp00667 [Y7W, K8R, Y14W]cGm GCRRLCWRQRCVTWCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay MCF-7 Chronic myeloid Leukemia CC50 : 15.1 ± 1.4 μM
dbacp00668 [Y7W, K8R, Y14W]cGm GCRRLCWRQRCVTWCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay MCF-7 Gastric cancer CC50 : 15.1 ± 1.4 μM
dbacp00669 [Y7W, K8R, Y14W]cGm GCRRLCWRQRCVTWCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay MCF-7 Breast cancer CC50 : 15.1 ± 1.4 μM
dbacp00670 [Y7W, K8R, Y14W]cGm GCRRLCWRQRCVTWCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay MCF-7 Cervical cancer CC50 : 15.1 ± 1.4 μM
dbacp00671 [Y7W, K8R, Y14W]cGm GCRRLCWRQRCVTWCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay K-562 Epithelial cancer CC50 : 3.9 ± 0.1 μM
dbacp00672 [Y7W, K8R, Y14W]cGm GCRRLCWRQRCVTWCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay K-562 Chronic myeloid Leukemia CC50 : 3.9 ± 0.1 μM
dbacp00673 [Y7W, K8R, Y14W]cGm GCRRLCWRQRCVTWCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay K-562 Gastric cancer CC50 : 3.9 ± 0.1 μM
dbacp00674 [Y7W, K8R, Y14W]cGm GCRRLCWRQRCVTWCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay K-562 Breast cancer CC50 : 3.9 ± 0.1 μM
dbacp00675 [Y7W, K8R, Y14W]cGm GCRRLCWRQRCVTWCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay K-562 Cervical cancer CC50 : 3.9 ± 0.1 μM
dbacp00676 [Y7W]cGm GCRRLCWKQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay CRL-1739 Epithelial cancer CC50 : 23.3 ± 0.4 μM
dbacp00677 [Y7W]cGm GCRRLCWKQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay CRL-1739 Chronic myeloid Leukemia CC50 : 23.3 ± 0.4 μM
dbacp00678 [Y7W]cGm GCRRLCWKQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay CRL-1739 Gastric cancer CC50 : 23.3 ± 0.4 μM
dbacp00679 [Y7W]cGm GCRRLCWKQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay CRL-1739 Breast cancer CC50 : 23.3 ± 0.4 μM
dbacp00680 [Y7W]cGm GCRRLCWKQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay CRL-1739 Cervical cancer CC50 : 23.3 ± 0.4 μM
dbacp00681 [Y7W]cGm GCRRLCWKQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay MM96L Epithelial cancer CC50 : 5.1 ± 0.3 μM
dbacp00682 [Y7W]cGm GCRRLCWKQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay MM96L Chronic myeloid Leukemia CC50 : 5.1 ± 0.3 μM
dbacp00683 [Y7W]cGm GCRRLCWKQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay MM96L Gastric cancer CC50 : 5.1 ± 0.3 μM
dbacp00684 [Y7W]cGm GCRRLCWKQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay MM96L Breast cancer CC50 : 5.1 ± 0.3 μM
dbacp00685 [Y7W]cGm GCRRLCWKQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay MM96L Cervical cancer CC50 : 5.1 ± 0.3 μM
dbacp00686 [Y7W]cGm GCRRLCWKQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay HFF-1 Epithelial cancer CC50 : 39.7 ± 3.8 μM
dbacp00687 [Y7W]cGm GCRRLCWKQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay HFF-1 Chronic myeloid Leukemia CC50 : 39.7 ± 3.8 μM
dbacp00688 [Y7W]cGm GCRRLCWKQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay HFF-1 Gastric cancer CC50 : 39.7 ± 3.8 μM
dbacp00689 [Y7W]cGm GCRRLCWKQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay HFF-1 Breast cancer CC50 : 39.7 ± 3.8 μM
dbacp00690 [Y7W]cGm GCRRLCWKQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay HFF-1 Cervical cancer CC50 : 39.7 ± 3.8 μM
dbacp00691 [Y7W]cGm GCRRLCWKQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay HeLa Epithelial cancer CC50 : > 64 μM
dbacp00692 [Y7W]cGm GCRRLCWKQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay HeLa Chronic myeloid Leukemia CC50 : > 64 μM
dbacp00693 [Y7W]cGm GCRRLCWKQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay HeLa Gastric cancer CC50 : > 64 μM
dbacp00694 [Y7W]cGm GCRRLCWKQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay HeLa Breast cancer CC50 : > 64 μM
dbacp00695 [Y7W]cGm GCRRLCWKQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay HeLa Cervical cancer CC50 : > 64 μM
dbacp00696 [Y7W]cGm GCRRLCWKQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay K-562 Epithelial cancer CC50 : 3.9 ± 0.2 μM
dbacp00697 [Y7W]cGm GCRRLCWKQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay K-562 Chronic myeloid Leukemia CC50 : 3.9 ± 0.2 μM
dbacp00698 [Y7W]cGm GCRRLCWKQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay K-562 Gastric cancer CC50 : 3.9 ± 0.2 μM
dbacp00699 [Y7W]cGm GCRRLCWKQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay K-562 Breast cancer CC50 : 3.9 ± 0.2 μM
dbacp00700 [Y7W]cGm GCRRLCWKQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay K-562 Cervical cancer CC50 : 3.9 ± 0.2 μM
dbacp00805 A4K14-citropin1.1 GLFAVIKKVASVIKGL Synthetic construct Cell membrane disintegration CCK-8 test C4-2B Prostate cancer IC50 : 29.05 μM
dbacp00806 A4K14-citropin1.1 GLFAVIKKVASVIKGL Synthetic construct Cell membrane disintegration CCK-8 test C4-2B Lung cancer IC50 : 29.05 μM
dbacp00807 A4K14-citropin1.1 GLFAVIKKVASVIKGL Synthetic construct Cell membrane disintegration CCK-8 test A549 Prostate cancer IC50 : 14.97 μM
dbacp00808 A4K14-citropin1.1 GLFAVIKKVASVIKGL Synthetic construct Cell membrane disintegration CCK-8 test A549 Lung cancer IC50 : 14.97 μM
dbacp00809 A4K14-citropin1.1 GLFAVIKKVASVIKGL Synthetic construct Cell membrane disintegration CCK-8 test U87 Prostate cancer IC50 : 14.8 μM
dbacp00810 A4K14-citropin1.1 GLFAVIKKVASVIKGL Synthetic construct Cell membrane disintegration CCK-8 test U87 Lung cancer IC50 : 14.8 μM
dbacp00811 A4K14-citropin1.1 GLFAVIKKVASVIKGL Synthetic construct Cell membrane disintegration CCK-8 test MCF-7 Prostate cancer IC50 : 14.16 μM
dbacp00812 A4K14-citropin1.1 GLFAVIKKVASVIKGL Synthetic construct Cell membrane disintegration CCK-8 test MCF-7 Lung cancer IC50 : 14.16 μM
dbacp00951 ABP-dHC-Cecropin A RWKIFKKIERVGQNVRDGIIKAGPAIQVLGTAKALGK Synthetic construct Apoptosis inducing MTT assay K562 cells Leukemia IC50 : 349.5 μM
dbacp00952 ABP-dHC-Cecropin A RWKIFKKIERVGQNVRDGIIKAGPAIQVLGTAKALGK Synthetic construct Apoptosis inducing MTT assay U937 cells Leukemia IC50 : 303.2 μM
dbacp00953 ABP-dHC-Cecropin A RWKIFKKIERVGQNVRDGIIKAGPAIQVLGTAKALGK Synthetic construct Apoptosis inducing MTT assay THP-1 cells Leukemia IC50 : 228.5 μM
dbacp00954 ABP-dHC-Cecropin A-K RWKIFKKIERVGQNVRDGIIKAGKAIQVLGTAKALGK Synthetic construct Apoptosis inducing MTT assay K562 cells Leukemia IC50 : 349.5 μM
dbacp00955 ABP-dHC-Cecropin A-K RWKIFKKIERVGQNVRDGIIKAGKAIQVLGTAKALGK Synthetic construct Apoptosis inducing MTT assay U937 cells Leukemia IC50 : 303.2 μM
dbacp00956 ABP-dHC-Cecropin A-K RWKIFKKIERVGQNVRDGIIKAGKAIQVLGTAKALGK Synthetic construct Apoptosis inducing MTT assay THP-1 cells Leukemia IC50 : 228.5 μM
dbacp01186 APQQ NA Synthetic construct Cell metatstasis inhibition Transwell assay MDA-MB-231 Breast cancer Not found
dbacp01187 APQQ NA Synthetic construct Cell metatstasis inhibition Transwell assay MCF-7 Breast cancer Not found
dbacp01188 APQQ NA Synthetic construct Cell metatstasis inhibition Transwell assay U251 Brain cancer Not found
dbacp01192 Ascaphin-8 [T16A] GFKDLLKGAAKALVKAVLF Synthetic construct Not specified Not specified Not found Liver cancer Not found
dbacp01442 Baceridin cyclo(L-Trp-D-Ala-D-allo-Ile-L-Val-D-Leu-L-Leu-) Synthetic construct Apoptosis inducing MTT assay HCT116 Not specified Not found
dbacp01443 Baceridin cyclo(L-Trp-D-Ala-D-allo-Ile-L-Val-D-Leu-L-Leu-) Synthetic construct Apoptosis inducing MTT assay RKO Not specified Not found
dbacp01444 Baceridin cyclo(L-Trp-D-Ala-D-allo-Ile-L-Val-D-Leu-L-Leu-) Synthetic construct Apoptosis inducing MTT assay HeLa Not specified Not found
dbacp02108 cMastoparan-C(cMP-C) CLNLKALLAVAKKILC Synthetic construct Apoptosis MTT assay H157 Non-small cell Lung cancer IC50 : 7.02 μM
dbacp02109 cMastoparan-C(cMP-C) CLNLKALLAVAKKILC Synthetic construct Apoptosis MTT assay MBD-MB-435S Melanocyte IC50 : 13.87 μM
dbacp02110 cMastoparan-C(cMP-C) CLNLKALLAVAKKILC Synthetic construct Apoptosis MTT assay PC-3 Human prostate carcinoma IC50 : 13.87 μM
dbacp02111 cMastoparan-C(cMP-C) CLNLKALLAVAKKILC Synthetic construct Apoptosis MTT assay U251-MG Human glioblastoma astrocytoma IC50 : 8.56 μM
dbacp02112 cMastoparan-C(cMP-C) CLNLKALLAVAKKILC Synthetic construct Apoptosis MTT assay MCF-7 Human breast cancer IC50 : 13.66 μM
dbacp02145 C1 KKWβ2,2WKK Synthetic construct Membrane disruptive mode of action MTT/MTS assay Ramos Lymphoma cancer IC50 : 10 ±2 µMol/L
dbacp02146 C1 KKWβ2,2WKK Synthetic construct Membrane disruptive mode of action MTT/MTS assay Ramos Lymphoma cancer IC50 : 22 ±5 µMol/L
dbacp02148 C2 KWβ2,2WKK Synthetic construct Membrane disruptive mode of action MTT/MTS assay Ramos Lymphoma cancer IC50 : 7.9 ± 0.3 µMol/L
dbacp02149 C2 KWβ2,2WKK Synthetic construct Membrane disruptive mode of action MTT/MTS assay Ramos Lymphoma cancer IC50 : 1.71 ± 0.6 µMol/L
dbacp02150 C3 KKβ2,2WKK Synthetic construct Membrane disruptive mode of action MTT/MTS assay Ramos Lymphoma cancer IC50 : 15 ± 2 µMol/L
dbacp02151 C3 KKβ2,2WKK Synthetic construct Membrane disruptive mode of action MTT/MTS assay Ramos Lymphoma cancer IC50 : 92 ± 2 µMol/L
dbacp02152 C4 KWβ2,2KK Synthetic construct Membrane disruptive mode of action MTT/MTS assay Ramos Lymphoma cancer IC50 : 12.6 ± 0.6 µMol/L
dbacp02153 C4 KWβ2,2KK Synthetic construct Membrane disruptive mode of action MTT/MTS assay Ramos Lymphoma cancer IC50 : 99 ± 15 µMol/L
dbacp02154 C5 KKWβ2,2WKK Synthetic construct Membrane disruptive mode of action MTT/MTS assay Ramos Lymphoma cancer IC50 : 11 ± 2 µMol/L
dbacp02155 C5 KKWβ2,2WKK Synthetic construct Membrane disruptive mode of action MTT/MTS assay Ramos Lymphoma cancer IC50 : 23 ± 3 µMol/L
dbacp02156 C6 KWβ2,2WKK Synthetic construct Membrane disruptive mode of action MTT/MTS assay Ramos Lymphoma cancer IC50 : 8 ± 1 µMol/L
dbacp02157 C6 KWβ2,2WKK Synthetic construct Membrane disruptive mode of action MTT/MTS assay Ramos Lymphoma cancer IC50 : 26 ± 2 µMol/L
dbacp02158 C7 KKβ2,2WKK Synthetic construct Membrane disruptive mode of action MTT/MTS assay Ramos Lymphoma cancer IC50 : 16 ± 5 µMol/L
dbacp02159 C7 KKβ2,2WKK Synthetic construct Membrane disruptive mode of action MTT/MTS assay Ramos Lymphoma cancer IC50 : 157 ± 30 µMol/L
dbacp02395 cGm (Derived from Gm) GCRRLCYKQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay CRL-1739 Epithelial cancer CC50 : 39.8 ± 1.0 μM
dbacp02396 cGm (Derived from Gm) GCRRLCYKQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay CRL-1739 Chronic myeloid leukemia CC50 : 39.8 ± 1.0 μM
dbacp02397 cGm (Derived from Gm) GCRRLCYKQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay CRL-1739 Gastric cancer CC50 : 39.8 ± 1.0 μM
dbacp02398 cGm (Derived from Gm) GCRRLCYKQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay CRL-1739 Breast cancer CC50 : 39.8 ± 1.0 μM
dbacp02399 cGm (Derived from Gm) GCRRLCYKQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay CRL-1739 Cervical cancer CC50 : 39.8 ± 1.0 μM
dbacp02400 cGm (Derived from Gm) GCRRLCYKQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay MM96L Epithelial cancer CC50 : 2.9 ± 0.1 μM
dbacp02401 cGm (Derived from Gm) GCRRLCYKQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay MM96L Chronic myeloid leukemia CC50 : 2.9 ± 0.1 μM
dbacp02402 cGm (Derived from Gm) GCRRLCYKQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay MM96L Gastric cancer CC50 : 2.9 ± 0.1 μM
dbacp02403 cGm (Derived from Gm) GCRRLCYKQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay MM96L Breast cancer CC50 : 2.9 ± 0.1 μM
dbacp02404 cGm (Derived from Gm) GCRRLCYKQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay MM96L Cervical cancer CC50 : 2.9 ± 0.1 μM
dbacp02405 cGm (Derived from Gm) GCRRLCYKQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay HFF-1 Epithelial cancer CC50 : 71.7 ± 9.2 μM
dbacp02406 cGm (Derived from Gm) GCRRLCYKQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay HFF-1 Chronic myeloid leukemia CC50 : 71.7 ± 9.2 μM
dbacp02407 cGm (Derived from Gm) GCRRLCYKQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay HFF-1 Gastric cancer CC50 : 71.7 ± 9.2 μM
dbacp02408 cGm (Derived from Gm) GCRRLCYKQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay HFF-1 Breast cancer CC50 : 71.7 ± 9.2 μM
dbacp02409 cGm (Derived from Gm) GCRRLCYKQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay HFF-1 Cervical cancer CC50 : 71.7 ± 9.2 μM
dbacp02410 cGm (Derived from Gm) GCRRLCYKQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay HeLa Epithelial cancer CC50 : > 64 μM
dbacp02411 cGm (Derived from Gm) GCRRLCYKQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay HeLa Chronic myeloid leukemia CC50 : > 64 μM
dbacp02412 cGm (Derived from Gm) GCRRLCYKQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay HeLa Gastric cancer CC50 : > 64 μM
dbacp02413 cGm (Derived from Gm) GCRRLCYKQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay HeLa Breast cancer CC50 : > 64 μM
dbacp02414 cGm (Derived from Gm) GCRRLCYKQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay HeLa Cervical cancer CC50 : > 64 μM
dbacp02415 cGm (Derived from Gm) GCRRLCYKQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay MCF-7 Epithelial cancer CC50 : 15.3 ± 1.4 μM
dbacp02416 cGm (Derived from Gm) GCRRLCYKQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay MCF-7 Chronic myeloid leukemia CC50 : 15.3 ± 1.4 μM
dbacp02417 cGm (Derived from Gm) GCRRLCYKQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay MCF-7 Gastric cancer CC50 : 15.3 ± 1.4 μM
dbacp02418 cGm (Derived from Gm) GCRRLCYKQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay MCF-7 Breast cancer CC50 : 15.3 ± 1.4 μM
dbacp02419 cGm (Derived from Gm) GCRRLCYKQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay MCF-7 Cervical cancer CC50 : 15.3 ± 1.4 μM
dbacp02420 cGm (Derived from Gm) GCRRLCYKQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay K-562 Epithelial cancer CC50 : 2.7 ± 0.1 μM
dbacp02421 cGm (Derived from Gm) GCRRLCYKQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay K-562 Chronic myeloid leukemia CC50 : 2.7 ± 0.1 μM
dbacp02422 cGm (Derived from Gm) GCRRLCYKQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay K-562 Gastric cancer CC50 : 2.7 ± 0.1 μM
dbacp02423 cGm (Derived from Gm) GCRRLCYKQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay K-562 Breast cancer CC50 : 2.7 ± 0.1 μM
dbacp02424 cGm (Derived from Gm) GCRRLCYKQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay K-562 Cervical cancer CC50 : 2.7 ± 0.1 μM
dbacp02425 cGm (Derived from Gm) GCRRLCYKQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay PBMCs Epithelial cancer CC50 : 12.7 ± 1.1 μM
dbacp02426 cGm (Derived from Gm) GCRRLCYKQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay PBMCs Chronic myeloid leukemia CC50 : 12.7 ± 1.1 μM
dbacp02427 cGm (Derived from Gm) GCRRLCYKQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay PBMCs Gastric cancer CC50 : 12.7 ± 1.1 μM
dbacp02428 cGm (Derived from Gm) GCRRLCYKQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay PBMCs Breast cancer CC50 : 12.7 ± 1.1 μM
dbacp02429 cGm (Derived from Gm) GCRRLCYKQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay PBMCs Cervical cancer CC50 : 12.7 ± 1.1 μM
dbacp03067 GLK-19 GLKKLLGKLLKKLGKLLLK Synthetic construct Not specified Not specified Not found Not found Not found
dbacp03177 H-11 IKLSPETKKNLKKVLKGAIKGAIAVAKMV Synthetic construct Inducing apoptosis MTT assay A549 Not found IC50 : 1.82 ± 0.23 μM
dbacp03178 H-11 IKLSPETKKNLKKVLKGAIKGAIAVAKMV Synthetic construct Inducing apoptosis MTT assay HCT116 Not found IC50 : 6.50 ± 0.32 μM
dbacp03179 H-11 IKLSPETKKNLKKVLKGAIKGAIAVAKMV Synthetic construct Inducing apoptosis MTT assay HepG2 Not found IC50 : 4.96 ± 0.43 μM
dbacp03180 H-12 IKLSKETKDNLKKVLKGAIKGAIAVAKMV Synthetic construct Inducing apoptosis MTT assay A549 Not found IC50 : 2.35 ± 0.31 μM
dbacp03181 H-12 IKLSKETKDNLKKVLKGAIKGAIAVAKMV Synthetic construct Inducing apoptosis MTT assay HCT116 Not found IC50 : 8.09 ± 0.40 μM
dbacp03182 H-12 IKLSKETKDNLKKVLKGAIKGAIAVAKMV Synthetic construct Inducing apoptosis MTT assay HepG2 Not found IC50 : 4.28 ± 0.38 μM
dbacp03183 H-13 IKLSKETKKNLKKVLKGAIKGAIAVAKMV Synthetic construct Inducing apoptosis MTT assay A549 Not found IC50 : 1.17 ± 0.23 μM
dbacp03184 H-13 IKLSKETKKNLKKVLKGAIKGAIAVAKMV Synthetic construct Inducing apoptosis MTT assay HCT116 Not found IC50 : 4.93 ± 0.51 μM
dbacp03185 H-13 IKLSKETKKNLKKVLKGAIKGAIAVAKMV Synthetic construct Inducing apoptosis MTT assay HepG2 Not found IC50 : 2.46 ± 0.32 μM
dbacp03186 H-14 IKLSKKTKKNLKKVLKGAIKGAIAVAKMV Synthetic construct Inducing apoptosis MTT assay A549 Not found IC50 : 0.98 ± 0.11 μM
dbacp03187 H-14 IKLSKKTKKNLKKVLKGAIKGAIAVAKMV Synthetic construct Inducing apoptosis MTT assay HCT116 Not found IC50 : 1.841 ± 0.34 μM
dbacp03188 H-14 IKLSKKTKKNLKKVLKGAIKGAIAVAKMV Synthetic construct Inducing apoptosis MTT assay HepG2 Not found IC50 : 4.54 ± 0.25 μM
dbacp04130 LK1 (Temporin-1CEa Analog peptide) FVDLKKIANIINSIFKK Synthetic construct Cell membrane disintegration MTT-assay MCF-7 Breast cancer IC50 : 20.97 µM
dbacp04131 LK1 (Temporin-1CEa Analog peptide) FVDLKKIANIINSIFKK Synthetic construct Cell membrane disintegration MTT-assay Bcap-37 Breast cancer IC50 : 18.7 µM
dbacp04132 LK1 (Temporin-1CEa Analog peptide) FVDLKKIANIINSIFKK Synthetic construct Cell membrane disintegration MTT-assay MDA-MB-231 Breast cancer IC50 : 66.4µM
dbacp04133 LK2(5) (Temporin-1CEa Analog peptide) FKDLKKIANIINSIFKK Synthetic construct Cell membrane disintegration MTT-assay MCF-7 Breast cancer IC50 : 44.7 µM
dbacp04134 LK2(5) (Temporin-1CEa Analog peptide) FKDLKKIANIINSIFKK Synthetic construct Cell membrane disintegration MTT-assay Bcap-37 Breast cancer IC50 : 83.49 µM
dbacp04135 LK2(5) (Temporin-1CEa Analog peptide) FKDLKKIANIINSIFKK Synthetic construct Cell membrane disintegration MTT-assay MDA-MB-231 Breast cancer IC50 : 894.7 µM
dbacp04136 LK2(6) (Temporin-1CEa Analog peptide) FVKLKKIANIINSIFKK Synthetic construct Cell membrane disintegration MTT-assay MCF-7 Breast cancer IC50 : 15.54 µM
dbacp04137 LK2(6) (Temporin-1CEa Analog peptide) FVKLKKIANIINSIFKK Synthetic construct Cell membrane disintegration MTT-assay Bcap-37 Breast cancer IC50 : 18.9 µM
dbacp04138 LK2(6) (Temporin-1CEa Analog peptide) FVKLKKIANIINSIFKK Synthetic construct Cell membrane disintegration MTT-assay MDA-MB-231 Breast cancer IC50 : 85.41 µM
dbacp04139 LK2(6)A(L) (Temporin-1CEa Analog peptide) FVKLKKILNIINSIFKK Synthetic construct Cell membrane disintegration MTT-assay MCF-7 Breast cancer IC50 : 9.01 µM
dbacp04140 LK2(6)A(L) (Temporin-1CEa Analog peptide) FVKLKKILNIINSIFKK Synthetic construct Cell membrane disintegration MTT-assay Bcap-37 Breast cancer IC50 : 10.52 µM
dbacp04141 LK2(6)A(L) (Temporin-1CEa Analog peptide) FVKLKKILNIINSIFKK Synthetic construct Cell membrane disintegration MTT-assay MDA-MB-231 Breast cancer IC50 : 34.74 µM
dbacp04142 LK2(6)AN(2L) (Temporin-1CEa Analog peptide) FVKLKKILNIILSIFKK Synthetic construct Cell membrane disintegration MTT-assay MCF-7 Breast cancer IC50 : 11 µM
dbacp04143 LK2(6)AN(2L) (Temporin-1CEa Analog peptide) FVKLKKILNIILSIFKK Synthetic construct Cell membrane disintegration MTT-assay Bcap-37 Breast cancer IC50 : 9.39 µM
dbacp04144 LK2(6)AN(2L) (Temporin-1CEa Analog peptide) FVKLKKILNIILSIFKK Synthetic construct Cell membrane disintegration MTT-assay MDA-MB-231 Breast cancer IC50 : 41.55 µM
dbacp04145 LK3 (Temporin-1CEa Analog peptide) FKKLKKIANIINSIFKK Synthetic construct Cell membrane disintegration MTT-assay MCF-7 Breast cancer IC50 : 27.72 µM
dbacp04146 LK3 (Temporin-1CEa Analog peptide) FKKLKKIANIINSIFKK Synthetic construct Cell membrane disintegration MTT-assay Bcap-37 Breast cancer IC50 : 25.04 µM
dbacp04147 LK3 (Temporin-1CEa Analog peptide) FKKLKKIANIINSIFKK Synthetic construct Cell membrane disintegration MTT-assay MDA-MB-231 Breast cancer IC50 : 224.8 µM
dbacp04872 NK-dpro (Derived from NK-2) KILPGVCKKIMRPFLRRISKDILTGKK Synthetic construct Not specified MTT assay EJ Not found IC50 : 28.7 μM
dbacp04873 NK-dpro (Derived from NK-2) KILPGVCKKIMRPFLRRISKDILTGKK Synthetic construct Not specified MTT assay PC-3 Not found IC50 : 9.6 μM
dbacp04874 NK-dpro (Derived from NK-2) KILPGVCKKIMRPFLRRISKDILTGKK Synthetic construct Not specified MTT assay T24 Not found IC50 : 39.6 μM
dbacp04875 NK-dpro (Derived from NK-2) KILPGVCKKIMRPFLRRISKDILTGKK Synthetic construct Not specified MTT assay HL-60 Not found IC50 : 48.4 μM
dbacp04876 NK-pro (Derived from NK-2) KILRGVCKKIMRPFLRRISKDILTGKK Synthetic construct Not specified MTT assay EJ Not found IC50 : 23.3 μM
dbacp04877 NK-pro (Derived from NK-2) KILRGVCKKIMRPFLRRISKDILTGKK Synthetic construct Not specified MTT assay PC-3 Not found IC50 : 9.3 μM
dbacp04878 NK-pro (Derived from NK-2) KILRGVCKKIMRPFLRRISKDILTGKK Synthetic construct Not specified MTT assay T24 Not found IC50 : 33.0 μM
dbacp04879 NK-pro (Derived from NK-2) KILRGVCKKIMRPFLRRISKDILTGKK Synthetic construct Not specified MTT assay HL-60 Not found IC50 : 26.1 μM
dbacp05051 P18 (Cecropin A(1-8)-Magainin 2(1ˆ’12) hybrid peptide Analogue) KWKLFKKIPKFLHLAKKF Synthetic construct Not specified Not specified Not found Not found Not found
dbacp05103 PA10 RQIKIWFQNRRMKWKKGGGGNNETTSIQIAGSLHHHHHH Synthetic construct Cell proliferation inhibition; Cell penetration; Apoptosis Cell viability assay MDA-MB231 Breast cancer MIC : 10 μM
dbacp05104 PA10 RQIKIWFQNRRMKWKKGGGGNNETTSIQIAGSLHHHHHH Synthetic construct Cell proliferation inhibition; Cell penetration; Apoptosis Cell viability assay HCC1806 Breast cancer MIC : 10 μM
dbacp05105 PA10 RQIKIWFQNRRMKWKKGGGGNNETTSIQIAGSLHHHHHH Synthetic construct Cell proliferation inhibition; Cell penetration; Apoptosis Cell viability assay 184B5 Breast cancer MIC : 10 μM
dbacp05106 PA10 RQIKIWFQNRRMKWKKGGGGNNETTSIQIAGSLHHHHHH Synthetic construct Cell proliferation inhibition; Cell penetration; Apoptosis Cell viability assay MCF10A Breast cancer MIC : 10 μM
dbacp05107 PA15 RQIKIWFQNRRMKWKKGGSLSAACHEQWSLGAQHHHHHH Synthetic construct Cell proliferation inhibition; Cell penetration; Apoptosis Cell viability assay MDA-MB231 Breast cancer MIC : 10 μM
dbacp05108 PA15 RQIKIWFQNRRMKWKKGGSLSAACHEQWSLGAQHHHHHH Synthetic construct Cell proliferation inhibition; Cell penetration; Apoptosis Cell viability assay HCC1806 Breast cancer MIC : 10 μM
dbacp05109 PA15 RQIKIWFQNRRMKWKKGGSLSAACHEQWSLGAQHHHHHH Synthetic construct Cell proliferation inhibition; Cell penetration; Apoptosis Cell viability assay 184B5 Breast cancer MIC : 10 μM
dbacp05110 PA15 RQIKIWFQNRRMKWKKGGSLSAACHEQWSLGAQHHHHHH Synthetic construct Cell proliferation inhibition; Cell penetration; Apoptosis Cell viability assay MCF10A Breast cancer MIC : 10 μM
dbacp05111 PA2 RQIKIWFQNRRMKWKKGGATRPRVDTQPELCGMHHHHHH Synthetic construct Cell proliferation inhibition; Cell penetration; Apoptosis Cell viability assay MDA-MB231 Breast cancer MIC : 10 μM
dbacp05112 PA2 RQIKIWFQNRRMKWKKGGATRPRVDTQPELCGMHHHHHH Synthetic construct Cell proliferation inhibition; Cell penetration; Apoptosis Cell viability assay HCC1806 Breast cancer MIC : 10 μM
dbacp05113 PA2 RQIKIWFQNRRMKWKKGGATRPRVDTQPELCGMHHHHHH Synthetic construct Cell proliferation inhibition; Cell penetration; Apoptosis Cell viability assay 184B5 Breast cancer MIC : 10 μM
dbacp05114 PA2 RQIKIWFQNRRMKWKKGGATRPRVDTQPELCGMHHHHHH Synthetic construct Cell proliferation inhibition; Cell penetration; Apoptosis Cell viability assay MCF10A Breast cancer MIC : 10 μM
dbacp05115 PA3 RQIKIWFQNRRMKWKKGGDCLCISRRARLLRATHHHHHH Synthetic construct Cell proliferation inhibition; Cell penetration; Apoptosis Cell viability assay MDA-MB231 Breast cancer MIC : 10 μM
dbacp05116 PA3 RQIKIWFQNRRMKWKKGGDCLCISRRARLLRATHHHHHH Synthetic construct Cell proliferation inhibition; Cell penetration; Apoptosis Cell viability assay HCC1806 Breast cancer MIC : 10 μM
dbacp05117 PA3 RQIKIWFQNRRMKWKKGGDCLCISRRARLLRATHHHHHH Synthetic construct Cell proliferation inhibition; Cell penetration; Apoptosis Cell viability assay 184B5 Breast cancer MIC : 10 μM
dbacp05118 PA3 RQIKIWFQNRRMKWKKGGDCLCISRRARLLRATHHHHHH Synthetic construct Cell proliferation inhibition; Cell penetration; Apoptosis Cell viability assay MCF10A Breast cancer MIC : 10 μM
dbacp05119 PA38 RQIKIWFQNRRMKWKKGGKYNGRFTTHHLLHLLNHHHHHH Synthetic construct Cell proliferation inhibition; Cell penetration; Apoptosis Cell viability assay MDA-MB231 Breast cancer MIC : 10 μM
dbacp05120 PA38 RQIKIWFQNRRMKWKKGGKYNGRFTTHHLLHLLNHHHHHH Synthetic construct Cell proliferation inhibition; Cell penetration; Apoptosis Cell viability assay HCC1806 Breast cancer MIC : 10 μM
dbacp05121 PA38 RQIKIWFQNRRMKWKKGGKYNGRFTTHHLLHLLNHHHHHH Synthetic construct Cell proliferation inhibition; Cell penetration; Apoptosis Cell viability assay 184B5 Breast cancer MIC : 10 μM
dbacp05122 PA38 RQIKIWFQNRRMKWKKGGKYNGRFTTHHLLHLLNHHHHHH Synthetic construct Cell proliferation inhibition; Cell penetration; Apoptosis Cell viability assay MCF10A Breast cancer MIC : 10 μM
dbacp05123 PA49 RQIKIWFQNRRMKWKKGGAGVYTFLVGADNRGWEHHHHHH Synthetic construct Cell proliferation inhibition; Cell penetration; Apoptosis Cell viability assay MDA-MB231 Breast cancer MIC : 10 μM
dbacp05124 PA49 RQIKIWFQNRRMKWKKGGAGVYTFLVGADNRGWEHHHHHH Synthetic construct Cell proliferation inhibition; Cell penetration; Apoptosis Cell viability assay HCC1806 Breast cancer MIC : 10 μM
dbacp05125 PA49 RQIKIWFQNRRMKWKKGGAGVYTFLVGADNRGWEHHHHHH Synthetic construct Cell proliferation inhibition; Cell penetration; Apoptosis Cell viability assay 184B5 Breast cancer MIC : 10 μM
dbacp05126 PA49 RQIKIWFQNRRMKWKKGGAGVYTFLVGADNRGWEHHHHHH Synthetic construct Cell proliferation inhibition; Cell penetration; Apoptosis Cell viability assay MCF10A Breast cancer MIC : 10 μM
dbacp05434 Peptide-1 IELLQARGGC-Pem Synthetic construct Cell membrane disintegration MTT/MTS assay HL-60 Leukemia cancer IC50 : 2.17 µM
dbacp05435 Peptide-1 IELLQARGGC-Pem Synthetic construct Cell membrane disintegration MTT/MTS assay NCI-H358 Lung cancer IC50 : 4.63 mM
dbacp05436 Peptide-2 IELLQARGGC-Pem-GGRRRRRRRR Synthetic construct Cell membrane disintegration MTT/MTS assay HL-60 Leukemia cancer IC50 : 2.64 µM
dbacp05437 Peptide-2 IELLQARGGC-Pem-GGRRRRRRRR Synthetic construct Cell membrane disintegration MTT/MTS assay NCI-H358 Lung cancer IC50 : 2.19 µM
dbacp05445 Peptide-3 RRRRRRRRGGC-Pem Synthetic construct Cell membrane disintegration MTT/MTS assay HL-60 Leukemia cancer IC50 : 6.24 µM
dbacp05446 Peptide-3 RRRRRRRRGGC-Pem Synthetic construct Cell membrane disintegration MTT/MTS assay NCI-H358 Lung cancer IC50 : 8.41 µM
dbacp06183 t Mastoparan-C(tMP-C, Tat (49-57)-Mastoparan-C) RKKRRQRRRLNLKALLAVAKKIL Synthetic construct Apoptosis inducing MTT assay H157 Non-small cell Lung cancer IC50 : 2.79 μM
dbacp06184 t Mastoparan-C(tMP-C, Tat (49-57)-Mastoparan-C) RKKRRQRRRLNLKALLAVAKKIL Synthetic construct Apoptosis inducing MTT assay MBD-MB-435S Melanocyte IC50 : 3.86 μM
dbacp06185 t Mastoparan-C(tMP-C, Tat (49-57)-Mastoparan-C) RKKRRQRRRLNLKALLAVAKKIL Synthetic construct Apoptosis inducing MTT assay PC-3 Human prostate carcinoma IC50 : 3.86 μM
dbacp06186 t Mastoparan-C(tMP-C, Tat (49-57)-Mastoparan-C) RKKRRQRRRLNLKALLAVAKKIL Synthetic construct Apoptosis inducing MTT assay U251-MG Human glioblastoma astrocytoma IC50 : 3.36 μM
dbacp06187 t Mastoparan-C(tMP-C, Tat (49-57)-Mastoparan-C) RKKRRQRRRLNLKALLAVAKKIL Synthetic construct Apoptosis inducing MTT assay MCF-7 Human breast cancer IC50 : 3.70 μM
dbacp06196 Tat (47-57) YGRKKRRQRRR Synthetic construct Cell membrane disintegration MTT/MTS assay HeLa Cervical cancer At 1 µM 90 - 100% viablity
dbacp06197 Tat (47-57) YGRKKRRQRRR Synthetic construct Cell membrane disintegration MTT/MTS assay HeLa Cervical cancer At 10 µM 80% viablity
dbacp06198 Tat (47-57) YGRKKRRQRRR Synthetic construct Cell membrane disintegration MTT/MTS assay HeLa Cervical cancer At 100 µM 60% viablity