513 result(s) have been found!
| Accession | Name | Sequence | Source/Organism | Mechanism | Assay Type | Cell Line | Cancer Type | Activity |
|---|---|---|---|---|---|---|---|---|
| dbacp00322 | [C/U, G1K, L5Y, K8R]cGm | KURRYUYRQRUVTYURGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | CRL-1739 | Epithelial cancer | CC50 : 46.2 ± 7.6 μM |
| dbacp00323 | [C/U, G1K, L5Y, K8R]cGm | KURRYUYRQRUVTYURGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | CRL-1739 | Chronic myeloid Leukemia | CC50 : 46.2 ± 7.6 μM |
| dbacp00324 | [C/U, G1K, L5Y, K8R]cGm | KURRYUYRQRUVTYURGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | CRL-1739 | Gastric cancer | CC50 : 46.2 ± 7.6 μM |
| dbacp00325 | [C/U, G1K, L5Y, K8R]cGm | KURRYUYRQRUVTYURGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | CRL-1739 | Breast cancer | CC50 : 46.2 ± 7.6 μM |
| dbacp00326 | [C/U, G1K, L5Y, K8R]cGm | KURRYUYRQRUVTYURGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | CRL-1739 | Cervical cancer | CC50 : 46.2 ± 7.6 μM |
| dbacp00327 | [C/U, G1K, L5Y, K8R]cGm | KURRYUYRQRUVTYURGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | MM96L | Epithelial cancer | CC50 : 2.3 ± 0.2 μM |
| dbacp00328 | [C/U, G1K, L5Y, K8R]cGm | KURRYUYRQRUVTYURGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | MM96L | Chronic myeloid Leukemia | CC50 : 2.3 ± 0.2 μM |
| dbacp00329 | [C/U, G1K, L5Y, K8R]cGm | KURRYUYRQRUVTYURGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | MM96L | Gastric cancer | CC50 : 2.3 ± 0.2 μM |
| dbacp00330 | [C/U, G1K, L5Y, K8R]cGm | KURRYUYRQRUVTYURGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | MM96L | Breast cancer | CC50 : 2.3 ± 0.2 μM |
| dbacp00331 | [C/U, G1K, L5Y, K8R]cGm | KURRYUYRQRUVTYURGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | MM96L | Cervical cancer | CC50 : 2.3 ± 0.2 μM |
| dbacp00332 | [C/U, G1K, L5Y, K8R]cGm | KURRYUYRQRUVTYURGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | HFF-1 | Epithelial cancer | CC50 : 30.8 ± 2.0 μM |
| dbacp00333 | [C/U, G1K, L5Y, K8R]cGm | KURRYUYRQRUVTYURGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | HFF-1 | Chronic myeloid Leukemia | CC50 : 30.8 ± 2.0 μM |
| dbacp00334 | [C/U, G1K, L5Y, K8R]cGm | KURRYUYRQRUVTYURGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | HFF-1 | Gastric cancer | CC50 : 30.8 ± 2.0 μM |
| dbacp00335 | [C/U, G1K, L5Y, K8R]cGm | KURRYUYRQRUVTYURGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | HFF-1 | Breast cancer | CC50 : 30.8 ± 2.0 μM |
| dbacp00336 | [C/U, G1K, L5Y, K8R]cGm | KURRYUYRQRUVTYURGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | HFF-1 | Cervical cancer | CC50 : 30.8 ± 2.0 μM |
| dbacp00337 | [C/U, G1K, L5Y, K8R]cGm | KURRYUYRQRUVTYURGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | HeLa | Epithelial cancer | CC50 : 36.2 ± 2.8 μM |
| dbacp00338 | [C/U, G1K, L5Y, K8R]cGm | KURRYUYRQRUVTYURGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | HeLa | Chronic myeloid Leukemia | CC50 : 36.2 ± 2.8 μM |
| dbacp00339 | [C/U, G1K, L5Y, K8R]cGm | KURRYUYRQRUVTYURGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | HeLa | Gastric cancer | CC50 : 36.2 ± 2.8 μM |
| dbacp00340 | [C/U, G1K, L5Y, K8R]cGm | KURRYUYRQRUVTYURGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | HeLa | Breast cancer | CC50 : 36.2 ± 2.8 μM |
| dbacp00341 | [C/U, G1K, L5Y, K8R]cGm | KURRYUYRQRUVTYURGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | HeLa | Cervical cancer | CC50 : 36.2 ± 2.8 μM |
| dbacp00342 | [C/U, G1K, L5Y, K8R]cGm | KURRYUYRQRUVTYURGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | MCF-7 | Epithelial cancer | CC50 : 29.0 ± 3.7 μM |
| dbacp00343 | [C/U, G1K, L5Y, K8R]cGm | KURRYUYRQRUVTYURGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | MCF-7 | Chronic myeloid Leukemia | CC50 : 29.0 ± 3.7 μM |
| dbacp00344 | [C/U, G1K, L5Y, K8R]cGm | KURRYUYRQRUVTYURGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | MCF-7 | Gastric cancer | CC50 : 29.0 ± 3.7 μM |
| dbacp00345 | [C/U, G1K, L5Y, K8R]cGm | KURRYUYRQRUVTYURGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | MCF-7 | Breast cancer | CC50 : 29.0 ± 3.7 μM |
| dbacp00346 | [C/U, G1K, L5Y, K8R]cGm | KURRYUYRQRUVTYURGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | MCF-7 | Cervical cancer | CC50 : 29.0 ± 3.7 μM |
| dbacp00347 | [C/U, G1K, L5Y, K8R]cGm | KURRYUYRQRUVTYURGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | K-562 | Epithelial cancer | CC50 : 6.4 ± 0.6 μM |
| dbacp00348 | [C/U, G1K, L5Y, K8R]cGm | KURRYUYRQRUVTYURGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | K-562 | Chronic myeloid Leukemia | CC50 : 6.4 ± 0.6 μM |
| dbacp00349 | [C/U, G1K, L5Y, K8R]cGm | KURRYUYRQRUVTYURGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | K-562 | Gastric cancer | CC50 : 6.4 ± 0.6 μM |
| dbacp00350 | [C/U, G1K, L5Y, K8R]cGm | KURRYUYRQRUVTYURGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | K-562 | Breast cancer | CC50 : 6.4 ± 0.6 μM |
| dbacp00351 | [C/U, G1K, L5Y, K8R]cGm | KURRYUYRQRUVTYURGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | K-562 | Cervical cancer | CC50 : 6.4 ± 0.6 μM |
| dbacp00352 | [C/U, G1K, L5Y, K8R]cGm | KURRYUYRQRUVTYURGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | HL-60 | Epithelial cancer | CC50 : 33.3 ±7.4 μM |
| dbacp00353 | [C/U, G1K, L5Y, K8R]cGm | KURRYUYRQRUVTYURGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | HL-60 | Chronic myeloid Leukemia | CC50 : 33.3 ±7.4 μM |
| dbacp00354 | [C/U, G1K, L5Y, K8R]cGm | KURRYUYRQRUVTYURGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | HL-60 | Gastric cancer | CC50 : 33.3 ±7.4 μM |
| dbacp00355 | [C/U, G1K, L5Y, K8R]cGm | KURRYUYRQRUVTYURGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | HL-60 | Breast cancer | CC50 : 33.3 ±7.4 μM |
| dbacp00356 | [C/U, G1K, L5Y, K8R]cGm | KURRYUYRQRUVTYURGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | HL-60 | Cervical cancer | CC50 : 33.3 ±7.4 μM |
| dbacp00357 | [C/U, G1K, L5Y, K8R]cGm | KURRYUYRQRUVTYURGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | PBMCs | Epithelial cancer | CC50 : 9.5 ± 0.5 μM |
| dbacp00358 | [C/U, G1K, L5Y, K8R]cGm | KURRYUYRQRUVTYURGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | PBMCs | Chronic myeloid Leukemia | CC50 : 9.5 ± 0.5 μM |
| dbacp00359 | [C/U, G1K, L5Y, K8R]cGm | KURRYUYRQRUVTYURGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | PBMCs | Gastric cancer | CC50 : 9.5 ± 0.5 μM |
| dbacp00360 | [C/U, G1K, L5Y, K8R]cGm | KURRYUYRQRUVTYURGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | PBMCs | Breast cancer | CC50 : 9.5 ± 0.5 μM |
| dbacp00361 | [C/U, G1K, L5Y, K8R]cGm | KURRYUYRQRUVTYURGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | PBMCs | Cervical cancer | CC50 : 9.5 ± 0.5 μM |
| dbacp00362 | [C/U]cGm | GURRLUYKQRUVTYURGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | CRL-1739 | Epithelial cancer | CC50 : 51.0 ± 4.6 μM |
| dbacp00363 | [C/U]cGm | GURRLUYKQRUVTYURGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | CRL-1739 | Chronic myeloid Leukemia | CC50 : 51.0 ± 4.6 μM |
| dbacp00364 | [C/U]cGm | GURRLUYKQRUVTYURGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | CRL-1739 | Gastric cancer | CC50 : 51.0 ± 4.6 μM |
| dbacp00365 | [C/U]cGm | GURRLUYKQRUVTYURGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | CRL-1739 | Breast cancer | CC50 : 51.0 ± 4.6 μM |
| dbacp00366 | [C/U]cGm | GURRLUYKQRUVTYURGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | CRL-1739 | Cervical cancer | CC50 : 51.0 ± 4.6 μM |
| dbacp00367 | [C/U]cGm | GURRLUYKQRUVTYURGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | MM96L | Epithelial cancer | CC50 : 4.6 ± 0.2 μM |
| dbacp00368 | [C/U]cGm | GURRLUYKQRUVTYURGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | MM96L | Chronic myeloid Leukemia | CC50 : 4.6 ± 0.2 μM |
| dbacp00369 | [C/U]cGm | GURRLUYKQRUVTYURGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | MM96L | Gastric cancer | CC50 : 4.6 ± 0.2 μM |
| dbacp00370 | [C/U]cGm | GURRLUYKQRUVTYURGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | MM96L | Breast cancer | CC50 : 4.6 ± 0.2 μM |
| dbacp00371 | [C/U]cGm | GURRLUYKQRUVTYURGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | MM96L | Cervical cancer | CC50 : 4.6 ± 0.2 μM |
| dbacp00372 | [C/U]cGm | GURRLUYKQRUVTYURGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | HFF-1 | Epithelial cancer | CC50 : 15.6 ± 3.6 μM |
| dbacp00373 | [C/U]cGm | GURRLUYKQRUVTYURGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | HFF-1 | Chronic myeloid Leukemia | CC50 : 15.6 ± 3.6 μM |
| dbacp00374 | [C/U]cGm | GURRLUYKQRUVTYURGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | HFF-1 | Gastric cancer | CC50 : 15.6 ± 3.6 μM |
| dbacp00375 | [C/U]cGm | GURRLUYKQRUVTYURGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | HFF-1 | Breast cancer | CC50 : 15.6 ± 3.6 μM |
| dbacp00376 | [C/U]cGm | GURRLUYKQRUVTYURGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | HFF-1 | Cervical cancer | CC50 : 15.6 ± 3.6 μM |
| dbacp00377 | [C/U]cGm | GURRLUYKQRUVTYURGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | HeLa | Epithelial cancer | CC50 : > 64 μM |
| dbacp00378 | [C/U]cGm | GURRLUYKQRUVTYURGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | HeLa | Chronic myeloid Leukemia | CC50 : > 64 μM |
| dbacp00379 | [C/U]cGm | GURRLUYKQRUVTYURGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | HeLa | Gastric cancer | CC50 : > 64 μM |
| dbacp00380 | [C/U]cGm | GURRLUYKQRUVTYURGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | HeLa | Breast cancer | CC50 : > 64 μM |
| dbacp00381 | [C/U]cGm | GURRLUYKQRUVTYURGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | HeLa | Cervical cancer | CC50 : > 64 μM |
| dbacp00382 | [C/U]cGm | GURRLUYKQRUVTYURGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | MCF-7 | Epithelial cancer | CC50 : 37.5 ± 3.3 μM |
| dbacp00383 | [C/U]cGm | GURRLUYKQRUVTYURGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | MCF-7 | Chronic myeloid Leukemia | CC50 : 37.5 ± 3.3 μM |
| dbacp00384 | [C/U]cGm | GURRLUYKQRUVTYURGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | MCF-7 | Gastric cancer | CC50 : 37.5 ± 3.3 μM |
| dbacp00385 | [C/U]cGm | GURRLUYKQRUVTYURGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | MCF-7 | Breast cancer | CC50 : 37.5 ± 3.3 μM |
| dbacp00386 | [C/U]cGm | GURRLUYKQRUVTYURGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | MCF-7 | Cervical cancer | CC50 : 37.5 ± 3.3 μM |
| dbacp00387 | [C/U]cGm | GURRLUYKQRUVTYURGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | K-562 | Epithelial cancer | CC50 : 1.4 ± 0.2 μM |
| dbacp00388 | [C/U]cGm | GURRLUYKQRUVTYURGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | K-562 | Chronic myeloid Leukemia | CC50 : 1.4 ± 0.2 μM |
| dbacp00389 | [C/U]cGm | GURRLUYKQRUVTYURGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | K-562 | Gastric cancer | CC50 : 1.4 ± 0.2 μM |
| dbacp00390 | [C/U]cGm | GURRLUYKQRUVTYURGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | K-562 | Breast cancer | CC50 : 1.4 ± 0.2 μM |
| dbacp00391 | [C/U]cGm | GURRLUYKQRUVTYURGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | K-562 | Cervical cancer | CC50 : 1.4 ± 0.2 μM |
| dbacp00392 | [C/U]cGm | GURRLUYKQRUVTYURGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | HL-60 | Epithelial cancer | CC50 : 38.5 ± 4.8 μM |
| dbacp00393 | [C/U]cGm | GURRLUYKQRUVTYURGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | HL-60 | Chronic myeloid Leukemia | CC50 : 38.5 ± 4.8 μM |
| dbacp00394 | [C/U]cGm | GURRLUYKQRUVTYURGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | HL-60 | Gastric cancer | CC50 : 38.5 ± 4.8 μM |
| dbacp00395 | [C/U]cGm | GURRLUYKQRUVTYURGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | HL-60 | Breast cancer | CC50 : 38.5 ± 4.8 μM |
| dbacp00396 | [C/U]cGm | GURRLUYKQRUVTYURGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | HL-60 | Cervical cancer | CC50 : 38.5 ± 4.8 μM |
| dbacp00397 | [C/U]cGm | GURRLUYKQRUVTYURGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | PBMCs | Epithelial cancer | CC50 : 15.5 ± 0.8 μM |
| dbacp00398 | [C/U]cGm | GURRLUYKQRUVTYURGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | PBMCs | Chronic myeloid Leukemia | CC50 : 15.5 ± 0.8 μM |
| dbacp00399 | [C/U]cGm | GURRLUYKQRUVTYURGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | PBMCs | Gastric cancer | CC50 : 15.5 ± 0.8 μM |
| dbacp00400 | [C/U]cGm | GURRLUYKQRUVTYURGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | PBMCs | Breast cancer | CC50 : 15.5 ± 0.8 μM |
| dbacp00401 | [C/U]cGm | GURRLUYKQRUVTYURGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | PBMCs | Cervical cancer | CC50 : 15.5 ± 0.8 μM |
| dbacp00403 | [D-P L-P]cGm | GCRRLCYKQRCVTYCRGpPR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | CRL-1739 | Epithelial cancer | CC50 : 22.5 ± 3.3 μM |
| dbacp00404 | [D-P L-P]cGm | GCRRLCYKQRCVTYCRGpPR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | CRL-1739 | Chronic myeloid Leukemia | CC50 : 22.5 ± 3.3 μM |
| dbacp00405 | [D-P L-P]cGm | GCRRLCYKQRCVTYCRGpPR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | CRL-1739 | Gastric cancer | CC50 : 22.5 ± 3.3 μM |
| dbacp00406 | [D-P L-P]cGm | GCRRLCYKQRCVTYCRGpPR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | CRL-1739 | Breast cancer | CC50 : 22.5 ± 3.3 μM |
| dbacp00407 | [D-P L-P]cGm | GCRRLCYKQRCVTYCRGpPR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | CRL-1739 | Cervical cancer | CC50 : 22.5 ± 3.3 μM |
| dbacp00408 | [D-P L-P]cGm | GCRRLCYKQRCVTYCRGpPR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | MM96L | Epithelial cancer | CC50 : 3.0 ± 0.1 μM |
| dbacp00409 | [D-P L-P]cGm | GCRRLCYKQRCVTYCRGpPR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | MM96L | Chronic myeloid Leukemia | CC50 : 3.0 ± 0.1 μM |
| dbacp00410 | [D-P L-P]cGm | GCRRLCYKQRCVTYCRGpPR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | MM96L | Gastric cancer | CC50 : 3.0 ± 0.1 μM |
| dbacp00411 | [D-P L-P]cGm | GCRRLCYKQRCVTYCRGpPR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | MM96L | Breast cancer | CC50 : 3.0 ± 0.1 μM |
| dbacp00412 | [D-P L-P]cGm | GCRRLCYKQRCVTYCRGpPR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | MM96L | Cervical cancer | CC50 : 3.0 ± 0.1 μM |
| dbacp00413 | [D-P L-P]cGm | GCRRLCYKQRCVTYCRGpPR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | HFF-1 | Epithelial cancer | CC50 : 14.9 ± 0.8 μM |
| dbacp00414 | [D-P L-P]cGm | GCRRLCYKQRCVTYCRGpPR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | HFF-1 | Chronic myeloid Leukemia | CC50 : 14.9 ± 0.8 μM |
| dbacp00415 | [D-P L-P]cGm | GCRRLCYKQRCVTYCRGpPR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | HFF-1 | Gastric cancer | CC50 : 14.9 ± 0.8 μM |
| dbacp00416 | [D-P L-P]cGm | GCRRLCYKQRCVTYCRGpPR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | HFF-1 | Breast cancer | CC50 : 14.9 ± 0.8 μM |
| dbacp00417 | [D-P L-P]cGm | GCRRLCYKQRCVTYCRGpPR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | HFF-1 | Cervical cancer | CC50 : 14.9 ± 0.8 μM |
| dbacp00418 | [D-P L-P]cGm | GCRRLCYKQRCVTYCRGpPR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | HeLa | Epithelial cancer | CC50 : 51.5 ± 3.9 μM |
| dbacp00419 | [D-P L-P]cGm | GCRRLCYKQRCVTYCRGpPR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | HeLa | Chronic myeloid Leukemia | CC50 : 51.5 ± 3.9 μM |
| dbacp00420 | [D-P L-P]cGm | GCRRLCYKQRCVTYCRGpPR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | HeLa | Gastric cancer | CC50 : 51.5 ± 3.9 μM |
| dbacp00421 | [D-P L-P]cGm | GCRRLCYKQRCVTYCRGpPR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | HeLa | Breast cancer | CC50 : 51.5 ± 3.9 μM |
| dbacp00422 | [D-P L-P]cGm | GCRRLCYKQRCVTYCRGpPR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | HeLa | Cervical cancer | CC50 : 51.5 ± 3.9 μM |
| dbacp00423 | [D-P L-P]cGm | GCRRLCYKQRCVTYCRGpPR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | K-562 | Epithelial cancer | CC50 : 3.9 ± 0.2 μM |
| dbacp00424 | [D-P L-P]cGm | GCRRLCYKQRCVTYCRGpPR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | K-562 | Chronic myeloid Leukemia | CC50 : 3.9 ± 0.2 μM |
| dbacp00425 | [D-P L-P]cGm | GCRRLCYKQRCVTYCRGpPR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | K-562 | Gastric cancer | CC50 : 3.9 ± 0.2 μM |
| dbacp00426 | [D-P L-P]cGm | GCRRLCYKQRCVTYCRGpPR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | K-562 | Breast cancer | CC50 : 3.9 ± 0.2 μM |
| dbacp00427 | [D-P L-P]cGm | GCRRLCYKQRCVTYCRGpPR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | K-562 | Cervical cancer | CC50 : 3.9 ± 0.2 μM |
| dbacp00428 | [D-P L-P]cGm | GCRRLCYKQRCVTYCRGpPR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | PBMCs | Epithelial cancer | CC50 : 14.1 ± 0.9 μM |
| dbacp00429 | [D-P L-P]cGm | GCRRLCYKQRCVTYCRGpPR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | PBMCs | Chronic myeloid Leukemia | CC50 : 14.1 ± 0.9 μM |
| dbacp00430 | [D-P L-P]cGm | GCRRLCYKQRCVTYCRGpPR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | PBMCs | Gastric cancer | CC50 : 14.1 ± 0.9 μM |
| dbacp00431 | [D-P L-P]cGm | GCRRLCYKQRCVTYCRGpPR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | PBMCs | Breast cancer | CC50 : 14.1 ± 0.9 μM |
| dbacp00432 | [D-P L-P]cGm | GCRRLCYKQRCVTYCRGpPR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | PBMCs | Cervical cancer | CC50 : 14.1 ± 0.9 μM |
| dbacp00440 | [G1K, K8R]cGm | KCRRLCYRQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | CRL-1739 | Epithelial cancer | CC50 : 19.5 ± 0.5 μM |
| dbacp00441 | [G1K, K8R]cGm | KCRRLCYRQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | CRL-1739 | Chronic myeloid Leukemia | CC50 : 19.5 ± 0.5 μM |
| dbacp00442 | [G1K, K8R]cGm | KCRRLCYRQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | CRL-1739 | Gastric cancer | CC50 : 19.5 ± 0.5 μM |
| dbacp00443 | [G1K, K8R]cGm | KCRRLCYRQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | CRL-1739 | Breast cancer | CC50 : 19.5 ± 0.5 μM |
| dbacp00444 | [G1K, K8R]cGm | KCRRLCYRQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | CRL-1739 | Cervical cancer | CC50 : 19.5 ± 0.5 μM |
| dbacp00445 | [G1K, K8R]cGm | KCRRLCYRQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | MM96L | Epithelial cancer | CC50 : 1.7 ± 0.1 μM |
| dbacp00446 | [G1K, K8R]cGm | KCRRLCYRQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | MM96L | Chronic myeloid Leukemia | CC50 : 1.7 ± 0.1 μM |
| dbacp00447 | [G1K, K8R]cGm | KCRRLCYRQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | MM96L | Gastric cancer | CC50 : 1.7 ± 0.1 μM |
| dbacp00448 | [G1K, K8R]cGm | KCRRLCYRQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | MM96L | Breast cancer | CC50 : 1.7 ± 0.1 μM |
| dbacp00449 | [G1K, K8R]cGm | KCRRLCYRQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | MM96L | Cervical cancer | CC50 : 1.7 ± 0.1 μM |
| dbacp00450 | [G1K, K8R]cGm | KCRRLCYRQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | HFF-1 | Epithelial cancer | CC50 : 9.0 ± 0.5 μM |
| dbacp00451 | [G1K, K8R]cGm | KCRRLCYRQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | HFF-1 | Chronic myeloid Leukemia | CC50 : 9.0 ± 0.5 μM |
| dbacp00452 | [G1K, K8R]cGm | KCRRLCYRQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | HFF-1 | Gastric cancer | CC50 : 9.0 ± 0.5 μM |
| dbacp00453 | [G1K, K8R]cGm | KCRRLCYRQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | HFF-1 | Breast cancer | CC50 : 9.0 ± 0.5 μM |
| dbacp00454 | [G1K, K8R]cGm | KCRRLCYRQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | HFF-1 | Cervical cancer | CC50 : 9.0 ± 0.5 μM |
| dbacp00455 | [G1K, K8R]cGm | KCRRLCYRQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | HeLa | Epithelial cancer | CC50 : 44.2 ± 2.2 μM |
| dbacp00456 | [G1K, K8R]cGm | KCRRLCYRQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | HeLa | Chronic myeloid Leukemia | CC50 : 44.2 ± 2.2 μM |
| dbacp00457 | [G1K, K8R]cGm | KCRRLCYRQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | HeLa | Gastric cancer | CC50 : 44.2 ± 2.2 μM |
| dbacp00458 | [G1K, K8R]cGm | KCRRLCYRQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | HeLa | Breast cancer | CC50 : 44.2 ± 2.2 μM |
| dbacp00459 | [G1K, K8R]cGm | KCRRLCYRQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | HeLa | Cervical cancer | CC50 : 44.2 ± 2.2 μM |
| dbacp00460 | [G1K, K8R]cGm | KCRRLCYRQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | MCF-7 | Epithelial cancer | CC50 : 6.7 ± 0.7 μM |
| dbacp00461 | [G1K, K8R]cGm | KCRRLCYRQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | MCF-7 | Chronic myeloid Leukemia | CC50 : 6.7 ± 0.7 μM |
| dbacp00462 | [G1K, K8R]cGm | KCRRLCYRQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | MCF-7 | Gastric cancer | CC50 : 6.7 ± 0.7 μM |
| dbacp00463 | [G1K, K8R]cGm | KCRRLCYRQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | MCF-7 | Breast cancer | CC50 : 6.7 ± 0.7 μM |
| dbacp00464 | [G1K, K8R]cGm | KCRRLCYRQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | MCF-7 | Cervical cancer | CC50 : 6.7 ± 0.7 μM |
| dbacp00465 | [G1K, K8R]cGm | KCRRLCYRQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | K-562 | Epithelial cancer | CC50 : 2.1 ± 0.2 μM |
| dbacp00466 | [G1K, K8R]cGm | KCRRLCYRQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | K-562 | Chronic myeloid Leukemia | CC50 : 2.1 ± 0.2 μM |
| dbacp00467 | [G1K, K8R]cGm | KCRRLCYRQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | K-562 | Gastric cancer | CC50 : 2.1 ± 0.2 μM |
| dbacp00468 | [G1K, K8R]cGm | KCRRLCYRQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | K-562 | Breast cancer | CC50 : 2.1 ± 0.2 μM |
| dbacp00469 | [G1K, K8R]cGm | KCRRLCYRQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | K-562 | Cervical cancer | CC50 : 2.1 ± 0.2 μM |
| dbacp00470 | [G1K, K8R]cGm | KCRRLCYRQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | HL-60 | Epithelial cancer | CC50 : 9.0 ± 1.1μM |
| dbacp00471 | [G1K, K8R]cGm | KCRRLCYRQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | HL-60 | Chronic myeloid Leukemia | CC50 : 9.0 ± 1.1μM |
| dbacp00472 | [G1K, K8R]cGm | KCRRLCYRQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | HL-60 | Gastric cancer | CC50 : 9.0 ± 1.1μM |
| dbacp00473 | [G1K, K8R]cGm | KCRRLCYRQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | HL-60 | Breast cancer | CC50 : 9.0 ± 1.1μM |
| dbacp00474 | [G1K, K8R]cGm | KCRRLCYRQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | HL-60 | Cervical cancer | CC50 : 9.0 ± 1.1μM |
| dbacp00475 | [G1K, K8R]cGm | KCRRLCYRQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | PBMCs | Epithelial cancer | CC50 : 5.1 ± 0.3 μM |
| dbacp00476 | [G1K, K8R]cGm | KCRRLCYRQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | PBMCs | Chronic myeloid Leukemia | CC50 : 5.1 ± 0.3 μM |
| dbacp00477 | [G1K, K8R]cGm | KCRRLCYRQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | PBMCs | Gastric cancer | CC50 : 5.1 ± 0.3 μM |
| dbacp00478 | [G1K, K8R]cGm | KCRRLCYRQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | PBMCs | Breast cancer | CC50 : 5.1 ± 0.3 μM |
| dbacp00479 | [G1K, K8R]cGm | KCRRLCYRQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | PBMCs | Cervical cancer | CC50 : 5.1 ± 0.3 μM |
| dbacp00480 | [G1K, L5Y, K8R]cGm | KCRRYCYRQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | CRL-1739 | Epithelial cancer | CC50 : 26.5 ± 2.4 μM |
| dbacp00481 | [G1K, L5Y, K8R]cGm | KCRRYCYRQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | CRL-1739 | Chronic myeloid Leukemia | CC50 : 26.5 ± 2.4 μM |
| dbacp00482 | [G1K, L5Y, K8R]cGm | KCRRYCYRQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | CRL-1739 | Gastric cancer | CC50 : 26.5 ± 2.4 μM |
| dbacp00483 | [G1K, L5Y, K8R]cGm | KCRRYCYRQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | CRL-1739 | Breast cancer | CC50 : 26.5 ± 2.4 μM |
| dbacp00484 | [G1K, L5Y, K8R]cGm | KCRRYCYRQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | CRL-1739 | Cervical cancer | CC50 : 26.5 ± 2.4 μM |
| dbacp00485 | [G1K, L5Y, K8R]cGm | KCRRYCYRQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | MM96L | Epithelial cancer | CC50 : 2.0 ± 0.1 μM |
| dbacp00486 | [G1K, L5Y, K8R]cGm | KCRRYCYRQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | MM96L | Chronic myeloid Leukemia | CC50 : 2.0 ± 0.1 μM |
| dbacp00487 | [G1K, L5Y, K8R]cGm | KCRRYCYRQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | MM96L | Gastric cancer | CC50 : 2.0 ± 0.1 μM |
| dbacp00488 | [G1K, L5Y, K8R]cGm | KCRRYCYRQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | MM96L | Breast cancer | CC50 : 2.0 ± 0.1 μM |
| dbacp00489 | [G1K, L5Y, K8R]cGm | KCRRYCYRQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | MM96L | Cervical cancer | CC50 : 2.0 ± 0.1 μM |
| dbacp00490 | [G1K, L5Y, K8R]cGm | KCRRYCYRQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | HFF-1 | Epithelial cancer | CC50 : 14.7 ± 1.5 μM |
| dbacp00491 | [G1K, L5Y, K8R]cGm | KCRRYCYRQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | HFF-1 | Chronic myeloid Leukemia | CC50 : 14.7 ± 1.5 μM |
| dbacp00492 | [G1K, L5Y, K8R]cGm | KCRRYCYRQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | HFF-1 | Gastric cancer | CC50 : 14.7 ± 1.5 μM |
| dbacp00493 | [G1K, L5Y, K8R]cGm | KCRRYCYRQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | HFF-1 | Breast cancer | CC50 : 14.7 ± 1.5 μM |
| dbacp00494 | [G1K, L5Y, K8R]cGm | KCRRYCYRQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | HFF-1 | Cervical cancer | CC50 : 14.7 ± 1.5 μM |
| dbacp00495 | [G1K, L5Y, K8R]cGm | KCRRYCYRQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | HeLa | Epithelial cancer | CC50 : 20.9 ± 1.4 μM |
| dbacp00496 | [G1K, L5Y, K8R]cGm | KCRRYCYRQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | HeLa | Chronic myeloid Leukemia | CC50 : 20.9 ± 1.4 μM |
| dbacp00497 | [G1K, L5Y, K8R]cGm | KCRRYCYRQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | HeLa | Gastric cancer | CC50 : 20.9 ± 1.4 μM |
| dbacp00498 | [G1K, L5Y, K8R]cGm | KCRRYCYRQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | HeLa | Breast cancer | CC50 : 20.9 ± 1.4 μM |
| dbacp00499 | [G1K, L5Y, K8R]cGm | KCRRYCYRQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | HeLa | Cervical cancer | CC50 : 20.9 ± 1.4 μM |
| dbacp00500 | [G1K, L5Y, K8R]cGm | KCRRYCYRQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | MCF-7 | Epithelial cancer | CC50 : 15.2 ± 1.9 μM |
| dbacp00501 | [G1K, L5Y, K8R]cGm | KCRRYCYRQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | MCF-7 | Chronic myeloid Leukemia | CC50 : 15.2 ± 1.9 μM |
| dbacp00502 | [G1K, L5Y, K8R]cGm | KCRRYCYRQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | MCF-7 | Gastric cancer | CC50 : 15.2 ± 1.9 μM |
| dbacp00503 | [G1K, L5Y, K8R]cGm | KCRRYCYRQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | MCF-7 | Breast cancer | CC50 : 15.2 ± 1.9 μM |
| dbacp00504 | [G1K, L5Y, K8R]cGm | KCRRYCYRQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | MCF-7 | Cervical cancer | CC50 : 15.2 ± 1.9 μM |
| dbacp00505 | [G1K, L5Y, K8R]cGm | KCRRYCYRQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | K-562 | Epithelial cancer | CC50 : 1.3 ± 0.1 μM |
| dbacp00506 | [G1K, L5Y, K8R]cGm | KCRRYCYRQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | K-562 | Chronic myeloid Leukemia | CC50 : 1.3 ± 0.1 μM |
| dbacp00507 | [G1K, L5Y, K8R]cGm | KCRRYCYRQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | K-562 | Gastric cancer | CC50 : 1.3 ± 0.1 μM |
| dbacp00508 | [G1K, L5Y, K8R]cGm | KCRRYCYRQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | K-562 | Breast cancer | CC50 : 1.3 ± 0.1 μM |
| dbacp00509 | [G1K, L5Y, K8R]cGm | KCRRYCYRQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | K-562 | Cervical cancer | CC50 : 1.3 ± 0.1 μM |
| dbacp00510 | [G1K, L5Y, K8R]cGm | KCRRYCYRQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | HL-60 | Epithelial cancer | CC50 : 15.7 ±1.1μM |
| dbacp00511 | [G1K, L5Y, K8R]cGm | KCRRYCYRQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | HL-60 | Chronic myeloid Leukemia | CC50 : 15.7 ±1.1μM |
| dbacp00512 | [G1K, L5Y, K8R]cGm | KCRRYCYRQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | HL-60 | Gastric cancer | CC50 : 15.7 ±1.1μM |
| dbacp00513 | [G1K, L5Y, K8R]cGm | KCRRYCYRQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | HL-60 | Breast cancer | CC50 : 15.7 ±1.1μM |
| dbacp00514 | [G1K, L5Y, K8R]cGm | KCRRYCYRQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | HL-60 | Cervical cancer | CC50 : 15.7 ±1.1μM |
| dbacp00515 | [G1K, L5Y, K8R]cGm | KCRRYCYRQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | PBMCs | Epithelial cancer | CC50 : 10.4 ± 1.0 μM |
| dbacp00516 | [G1K, L5Y, K8R]cGm | KCRRYCYRQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | PBMCs | Chronic myeloid Leukemia | CC50 : 10.4 ± 1.0 μM |
| dbacp00517 | [G1K, L5Y, K8R]cGm | KCRRYCYRQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | PBMCs | Gastric cancer | CC50 : 10.4 ± 1.0 μM |
| dbacp00518 | [G1K, L5Y, K8R]cGm | KCRRYCYRQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | PBMCs | Breast cancer | CC50 : 10.4 ± 1.0 μM |
| dbacp00519 | [G1K, L5Y, K8R]cGm | KCRRYCYRQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | PBMCs | Cervical cancer | CC50 : 10.4 ± 1.0 μM |
| dbacp00520 | [K8R]cGm | GCRRLCYRQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | CRL-1739 | Epithelial cancer | CC50 : 29.4 ± 1.1 μM |
| dbacp00521 | [K8R]cGm | GCRRLCYRQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | CRL-1739 | Chronic myeloid Leukemia | CC50 : 29.4 ± 1.1 μM |
| dbacp00522 | [K8R]cGm | GCRRLCYRQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | CRL-1739 | Gastric cancer | CC50 : 29.4 ± 1.1 μM |
| dbacp00523 | [K8R]cGm | GCRRLCYRQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | CRL-1739 | Breast cancer | CC50 : 29.4 ± 1.1 μM |
| dbacp00524 | [K8R]cGm | GCRRLCYRQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | CRL-1739 | Cervical cancer | CC50 : 29.4 ± 1.1 μM |
| dbacp00525 | [K8R]cGm | GCRRLCYRQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | MM96L | Epithelial cancer | CC50 : 5.0 ± 0.3 μM |
| dbacp00526 | [K8R]cGm | GCRRLCYRQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | MM96L | Chronic myeloid Leukemia | CC50 : 5.0 ± 0.3 μM |
| dbacp00527 | [K8R]cGm | GCRRLCYRQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | MM96L | Gastric cancer | CC50 : 5.0 ± 0.3 μM |
| dbacp00528 | [K8R]cGm | GCRRLCYRQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | MM96L | Breast cancer | CC50 : 5.0 ± 0.3 μM |
| dbacp00529 | [K8R]cGm | GCRRLCYRQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | MM96L | Cervical cancer | CC50 : 5.0 ± 0.3 μM |
| dbacp00530 | [K8R]cGm | GCRRLCYRQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | HFF-1 | Epithelial cancer | CC50 : 34.5 ± 3.6 μM |
| dbacp00531 | [K8R]cGm | GCRRLCYRQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | HFF-1 | Chronic myeloid Leukemia | CC50 : 34.5 ± 3.6 μM |
| dbacp00532 | [K8R]cGm | GCRRLCYRQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | HFF-1 | Gastric cancer | CC50 : 34.5 ± 3.6 μM |
| dbacp00533 | [K8R]cGm | GCRRLCYRQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | HFF-1 | Breast cancer | CC50 : 34.5 ± 3.6 μM |
| dbacp00534 | [K8R]cGm | GCRRLCYRQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | HFF-1 | Cervical cancer | CC50 : 34.5 ± 3.6 μM |
| dbacp00535 | [K8R]cGm | GCRRLCYRQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | HeLa | Epithelial cancer | CC50 : 39.4 ± 2.6 μM |
| dbacp00536 | [K8R]cGm | GCRRLCYRQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | HeLa | Chronic myeloid Leukemia | CC50 : 39.4 ± 2.6 μM |
| dbacp00537 | [K8R]cGm | GCRRLCYRQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | HeLa | Gastric cancer | CC50 : 39.4 ± 2.6 μM |
| dbacp00538 | [K8R]cGm | GCRRLCYRQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | HeLa | Breast cancer | CC50 : 39.4 ± 2.6 μM |
| dbacp00539 | [K8R]cGm | GCRRLCYRQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | HeLa | Cervical cancer | CC50 : 39.4 ± 2.6 μM |
| dbacp00540 | [K8R]cGm | GCRRLCYRQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | K-562 | Epithelial cancer | CC50 : 3.1 ± 0.1 μM |
| dbacp00541 | [K8R]cGm | GCRRLCYRQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | K-562 | Chronic myeloid Leukemia | CC50 : 3.1 ± 0.1 μM |
| dbacp00542 | [K8R]cGm | GCRRLCYRQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | K-562 | Gastric cancer | CC50 : 3.1 ± 0.1 μM |
| dbacp00543 | [K8R]cGm | GCRRLCYRQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | K-562 | Breast cancer | CC50 : 3.1 ± 0.1 μM |
| dbacp00544 | [K8R]cGm | GCRRLCYRQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | K-562 | Cervical cancer | CC50 : 3.1 ± 0.1 μM |
| dbacp00545 | [L5W]cGm | GCRRWCYKQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | CRL-1739 | Epithelial cancer | CC50 : 18.3 ± 1.4 μM |
| dbacp00546 | [L5W]cGm | GCRRWCYKQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | CRL-1739 | Chronic myeloid Leukemia | CC50 : 18.3 ± 1.4 μM |
| dbacp00547 | [L5W]cGm | GCRRWCYKQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | CRL-1739 | Gastric cancer | CC50 : 18.3 ± 1.4 μM |
| dbacp00548 | [L5W]cGm | GCRRWCYKQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | CRL-1739 | Breast cancer | CC50 : 18.3 ± 1.4 μM |
| dbacp00549 | [L5W]cGm | GCRRWCYKQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | CRL-1739 | Cervical cancer | CC50 : 18.3 ± 1.4 μM |
| dbacp00550 | [L5W]cGm | GCRRWCYKQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | MM96L | Epithelial cancer | CC50 : 4.0 ± 0.1 μM |
| dbacp00551 | [L5W]cGm | GCRRWCYKQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | MM96L | Chronic myeloid Leukemia | CC50 : 4.0 ± 0.1 μM |
| dbacp00552 | [L5W]cGm | GCRRWCYKQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | MM96L | Gastric cancer | CC50 : 4.0 ± 0.1 μM |
| dbacp00553 | [L5W]cGm | GCRRWCYKQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | MM96L | Breast cancer | CC50 : 4.0 ± 0.1 μM |
| dbacp00554 | [L5W]cGm | GCRRWCYKQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | MM96L | Cervical cancer | CC50 : 4.0 ± 0.1 μM |
| dbacp00555 | [L5W]cGm | GCRRWCYKQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | HFF-1 | Epithelial cancer | CC50 : 25.0 ± 2.9 μM |
| dbacp00556 | [L5W]cGm | GCRRWCYKQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | HFF-1 | Chronic myeloid Leukemia | CC50 : 25.0 ± 2.9 μM |
| dbacp00557 | [L5W]cGm | GCRRWCYKQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | HFF-1 | Gastric cancer | CC50 : 25.0 ± 2.9 μM |
| dbacp00558 | [L5W]cGm | GCRRWCYKQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | HFF-1 | Breast cancer | CC50 : 25.0 ± 2.9 μM |
| dbacp00559 | [L5W]cGm | GCRRWCYKQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | HFF-1 | Cervical cancer | CC50 : 25.0 ± 2.9 μM |
| dbacp00560 | [L5W]cGm | GCRRWCYKQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | HeLa | Epithelial cancer | CC50 : 17.1 ± 0.7 μM |
| dbacp00561 | [L5W]cGm | GCRRWCYKQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | HeLa | Chronic myeloid Leukemia | CC50 : 17.1 ± 0.7 μM |
| dbacp00562 | [L5W]cGm | GCRRWCYKQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | HeLa | Gastric cancer | CC50 : 17.1 ± 0.7 μM |
| dbacp00563 | [L5W]cGm | GCRRWCYKQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | HeLa | Breast cancer | CC50 : 17.1 ± 0.7 μM |
| dbacp00564 | [L5W]cGm | GCRRWCYKQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | HeLa | Cervical cancer | CC50 : 17.1 ± 0.7 μM |
| dbacp00565 | [L5W]cGm | GCRRWCYKQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | K-562 | Epithelial cancer | CC50 : 1.0 ± 0.1 μM |
| dbacp00566 | [L5W]cGm | GCRRWCYKQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | K-562 | Chronic myeloid Leukemia | CC50 : 1.0 ± 0.1 μM |
| dbacp00567 | [L5W]cGm | GCRRWCYKQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | K-562 | Gastric cancer | CC50 : 1.0 ± 0.1 μM |
| dbacp00568 | [L5W]cGm | GCRRWCYKQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | K-562 | Breast cancer | CC50 : 1.0 ± 0.1 μM |
| dbacp00569 | [L5W]cGm | GCRRWCYKQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | K-562 | Cervical cancer | CC50 : 1.0 ± 0.1 μM |
| dbacp00573 | [R4A, R18A]cGm | GCRALCYKQRCVTYCRGA | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | CRL-1739 | Epithelial cancer | CC50 : > 64 μM |
| dbacp00574 | [R4A, R18A]cGm | GCRALCYKQRCVTYCRGA | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | CRL-1739 | Chronic myeloid Leukemia | CC50 : > 64 μM |
| dbacp00575 | [R4A, R18A]cGm | GCRALCYKQRCVTYCRGA | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | CRL-1739 | Gastric cancer | CC50 : > 64 μM |
| dbacp00576 | [R4A, R18A]cGm | GCRALCYKQRCVTYCRGA | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | CRL-1739 | Breast cancer | CC50 : > 64 μM |
| dbacp00577 | [R4A, R18A]cGm | GCRALCYKQRCVTYCRGA | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | CRL-1739 | Cervical cancer | CC50 : > 64 μM |
| dbacp00578 | [R4A, R18A]cGm | GCRALCYKQRCVTYCRGA | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | MM96L | Epithelial cancer | CC50 : 10.3 ± 1.1 μM |
| dbacp00579 | [R4A, R18A]cGm | GCRALCYKQRCVTYCRGA | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | MM96L | Chronic myeloid Leukemia | CC50 : 10.3 ± 1.1 μM |
| dbacp00580 | [R4A, R18A]cGm | GCRALCYKQRCVTYCRGA | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | MM96L | Gastric cancer | CC50 : 10.3 ± 1.1 μM |
| dbacp00581 | [R4A, R18A]cGm | GCRALCYKQRCVTYCRGA | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | MM96L | Breast cancer | CC50 : 10.3 ± 1.1 μM |
| dbacp00582 | [R4A, R18A]cGm | GCRALCYKQRCVTYCRGA | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | MM96L | Cervical cancer | CC50 : 10.3 ± 1.1 μM |
| dbacp00583 | [R4A, R18A]cGm | GCRALCYKQRCVTYCRGA | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | HFF-1 | Epithelial cancer | CC50 : 51.2 ± 4.0 μM |
| dbacp00584 | [R4A, R18A]cGm | GCRALCYKQRCVTYCRGA | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | HFF-1 | Chronic myeloid Leukemia | CC50 : 51.2 ± 4.0 μM |
| dbacp00585 | [R4A, R18A]cGm | GCRALCYKQRCVTYCRGA | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | HFF-1 | Gastric cancer | CC50 : 51.2 ± 4.0 μM |
| dbacp00586 | [R4A, R18A]cGm | GCRALCYKQRCVTYCRGA | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | HFF-1 | Breast cancer | CC50 : 51.2 ± 4.0 μM |
| dbacp00587 | [R4A, R18A]cGm | GCRALCYKQRCVTYCRGA | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | HFF-1 | Cervical cancer | CC50 : 51.2 ± 4.0 μM |
| dbacp00588 | [R4A, R18A]cGm | GCRALCYKQRCVTYCRGA | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | HeLa | Epithelial cancer | CC50 : > 64 μM |
| dbacp00589 | [R4A, R18A]cGm | GCRALCYKQRCVTYCRGA | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | HeLa | Chronic myeloid Leukemia | CC50 : > 64 μM |
| dbacp00590 | [R4A, R18A]cGm | GCRALCYKQRCVTYCRGA | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | HeLa | Gastric cancer | CC50 : > 64 μM |
| dbacp00591 | [R4A, R18A]cGm | GCRALCYKQRCVTYCRGA | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | HeLa | Breast cancer | CC50 : > 64 μM |
| dbacp00592 | [R4A, R18A]cGm | GCRALCYKQRCVTYCRGA | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | HeLa | Cervical cancer | CC50 : > 64 μM |
| dbacp00593 | [R4A, R18A]cGm | GCRALCYKQRCVTYCRGA | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | MCF-7 | Epithelial cancer | CC50 : 48.4 ± 0.7 μM |
| dbacp00594 | [R4A, R18A]cGm | GCRALCYKQRCVTYCRGA | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | MCF-7 | Chronic myeloid Leukemia | CC50 : 48.4 ± 0.7 μM |
| dbacp00595 | [R4A, R18A]cGm | GCRALCYKQRCVTYCRGA | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | MCF-7 | Gastric cancer | CC50 : 48.4 ± 0.7 μM |
| dbacp00596 | [R4A, R18A]cGm | GCRALCYKQRCVTYCRGA | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | MCF-7 | Breast cancer | CC50 : 48.4 ± 0.7 μM |
| dbacp00597 | [R4A, R18A]cGm | GCRALCYKQRCVTYCRGA | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | MCF-7 | Cervical cancer | CC50 : 48.4 ± 0.7 μM |
| dbacp00598 | [R4A, R18A]cGm | GCRALCYKQRCVTYCRGA | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | K-562 | Epithelial cancer | CC50 : 11.5 ± 0.6 μM |
| dbacp00599 | [R4A, R18A]cGm | GCRALCYKQRCVTYCRGA | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | K-562 | Chronic myeloid Leukemia | CC50 : 11.5 ± 0.6 μM |
| dbacp00600 | [R4A, R18A]cGm | GCRALCYKQRCVTYCRGA | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | K-562 | Gastric cancer | CC50 : 11.5 ± 0.6 μM |
| dbacp00601 | [R4A, R18A]cGm | GCRALCYKQRCVTYCRGA | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | K-562 | Breast cancer | CC50 : 11.5 ± 0.6 μM |
| dbacp00602 | [R4A, R18A]cGm | GCRALCYKQRCVTYCRGA | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | K-562 | Cervical cancer | CC50 : 11.5 ± 0.6 μM |
| dbacp00603 | [R4A, R18A]cGm | GCRALCYKQRCVTYCRGA | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | HL-60 | Epithelial cancer | CC50 : 34.1 ± 3.9 μM |
| dbacp00604 | [R4A, R18A]cGm | GCRALCYKQRCVTYCRGA | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | HL-60 | Chronic myeloid Leukemia | CC50 : 34.1 ± 3.9 μM |
| dbacp00605 | [R4A, R18A]cGm | GCRALCYKQRCVTYCRGA | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | HL-60 | Gastric cancer | CC50 : 34.1 ± 3.9 μM |
| dbacp00606 | [R4A, R18A]cGm | GCRALCYKQRCVTYCRGA | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | HL-60 | Breast cancer | CC50 : 34.1 ± 3.9 μM |
| dbacp00607 | [R4A, R18A]cGm | GCRALCYKQRCVTYCRGA | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | HL-60 | Cervical cancer | CC50 : 34.1 ± 3.9 μM |
| dbacp00608 | [R4A, R18A]cGm | GCRALCYKQRCVTYCRGA | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | PBMCs | Epithelial cancer | CC50 : 30.8 ± 2.5 μM |
| dbacp00609 | [R4A, R18A]cGm | GCRALCYKQRCVTYCRGA | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | PBMCs | Chronic myeloid Leukemia | CC50 : 30.8 ± 2.5 μM |
| dbacp00610 | [R4A, R18A]cGm | GCRALCYKQRCVTYCRGA | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | PBMCs | Gastric cancer | CC50 : 30.8 ± 2.5 μM |
| dbacp00611 | [R4A, R18A]cGm | GCRALCYKQRCVTYCRGA | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | PBMCs | Breast cancer | CC50 : 30.8 ± 2.5 μM |
| dbacp00612 | [R4A, R18A]cGm | GCRALCYKQRCVTYCRGA | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | PBMCs | Cervical cancer | CC50 : 30.8 ± 2.5 μM |
| dbacp00621 | [Y14W]cGm | GCRRLCYKQRCVTWCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | CRL-1739 | Epithelial cancer | CC50 : 30.3 ± 1.1 μM |
| dbacp00622 | [Y14W]cGm | GCRRLCYKQRCVTWCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | CRL-1739 | Chronic myeloid Leukemia | CC50 : 30.3 ± 1.1 μM |
| dbacp00623 | [Y14W]cGm | GCRRLCYKQRCVTWCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | CRL-1739 | Gastric cancer | CC50 : 30.3 ± 1.1 μM |
| dbacp00624 | [Y14W]cGm | GCRRLCYKQRCVTWCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | CRL-1739 | Breast cancer | CC50 : 30.3 ± 1.1 μM |
| dbacp00625 | [Y14W]cGm | GCRRLCYKQRCVTWCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | CRL-1739 | Cervical cancer | CC50 : 30.3 ± 1.1 μM |
| dbacp00626 | [Y14W]cGm | GCRRLCYKQRCVTWCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | MM96L | Epithelial cancer | CC50 : 4.0 ± 0.1 μM |
| dbacp00627 | [Y14W]cGm | GCRRLCYKQRCVTWCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | MM96L | Chronic myeloid Leukemia | CC50 : 4.0 ± 0.1 μM |
| dbacp00628 | [Y14W]cGm | GCRRLCYKQRCVTWCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | MM96L | Gastric cancer | CC50 : 4.0 ± 0.1 μM |
| dbacp00629 | [Y14W]cGm | GCRRLCYKQRCVTWCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | MM96L | Breast cancer | CC50 : 4.0 ± 0.1 μM |
| dbacp00630 | [Y14W]cGm | GCRRLCYKQRCVTWCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | MM96L | Cervical cancer | CC50 : 4.0 ± 0.1 μM |
| dbacp00631 | [Y14W]cGm | GCRRLCYKQRCVTWCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | HFF-1 | Epithelial cancer | CC50 : 68.4 ± 9.6 μM |
| dbacp00632 | [Y14W]cGm | GCRRLCYKQRCVTWCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | HFF-1 | Chronic myeloid Leukemia | CC50 : 68.4 ± 9.6 μM |
| dbacp00633 | [Y14W]cGm | GCRRLCYKQRCVTWCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | HFF-1 | Gastric cancer | CC50 : 68.4 ± 9.6 μM |
| dbacp00634 | [Y14W]cGm | GCRRLCYKQRCVTWCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | HFF-1 | Breast cancer | CC50 : 68.4 ± 9.6 μM |
| dbacp00635 | [Y14W]cGm | GCRRLCYKQRCVTWCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | HFF-1 | Cervical cancer | CC50 : 68.4 ± 9.6 μM |
| dbacp00636 | [Y14W]cGm | GCRRLCYKQRCVTWCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | HeLa | Epithelial cancer | CC50 : 50.4 ± 2.4 μM |
| dbacp00637 | [Y14W]cGm | GCRRLCYKQRCVTWCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | HeLa | Chronic myeloid Leukemia | CC50 : 50.4 ± 2.4 μM |
| dbacp00638 | [Y14W]cGm | GCRRLCYKQRCVTWCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | HeLa | Gastric cancer | CC50 : 50.4 ± 2.4 μM |
| dbacp00639 | [Y14W]cGm | GCRRLCYKQRCVTWCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | HeLa | Breast cancer | CC50 : 50.4 ± 2.4 μM |
| dbacp00640 | [Y14W]cGm | GCRRLCYKQRCVTWCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | HeLa | Cervical cancer | CC50 : 50.4 ± 2.4 μM |
| dbacp00641 | [Y14W]cGm | GCRRLCYKQRCVTWCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | K-562 | Epithelial cancer | CC50 : 2.7 ± 0.1 μM |
| dbacp00642 | [Y14W]cGm | GCRRLCYKQRCVTWCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | K-562 | Chronic myeloid Leukemia | CC50 : 2.7 ± 0.1 μM |
| dbacp00643 | [Y14W]cGm | GCRRLCYKQRCVTWCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | K-562 | Gastric cancer | CC50 : 2.7 ± 0.1 μM |
| dbacp00644 | [Y14W]cGm | GCRRLCYKQRCVTWCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | K-562 | Breast cancer | CC50 : 2.7 ± 0.1 μM |
| dbacp00645 | [Y14W]cGm | GCRRLCYKQRCVTWCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | K-562 | Cervical cancer | CC50 : 2.7 ± 0.1 μM |
| dbacp00646 | [Y7W, K8R, Y14W]cGm | GCRRLCWRQRCVTWCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | CRL-1739 | Epithelial cancer | CC50 : 31.6 ± 1.3 μM |
| dbacp00647 | [Y7W, K8R, Y14W]cGm | GCRRLCWRQRCVTWCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | CRL-1739 | Chronic myeloid Leukemia | CC50 : 31.6 ± 1.3 μM |
| dbacp00648 | [Y7W, K8R, Y14W]cGm | GCRRLCWRQRCVTWCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | CRL-1739 | Gastric cancer | CC50 : 31.6 ± 1.3 μM |
| dbacp00649 | [Y7W, K8R, Y14W]cGm | GCRRLCWRQRCVTWCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | CRL-1739 | Breast cancer | CC50 : 31.6 ± 1.3 μM |
| dbacp00650 | [Y7W, K8R, Y14W]cGm | GCRRLCWRQRCVTWCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | CRL-1739 | Cervical cancer | CC50 : 31.6 ± 1.3 μM |
| dbacp00651 | [Y7W, K8R, Y14W]cGm | GCRRLCWRQRCVTWCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | MM96L | Epithelial cancer | CC50 : 5.4 ± 0.3 μM |
| dbacp00652 | [Y7W, K8R, Y14W]cGm | GCRRLCWRQRCVTWCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | MM96L | Chronic myeloid Leukemia | CC50 : 5.4 ± 0.3 μM |
| dbacp00653 | [Y7W, K8R, Y14W]cGm | GCRRLCWRQRCVTWCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | MM96L | Gastric cancer | CC50 : 5.4 ± 0.3 μM |
| dbacp00654 | [Y7W, K8R, Y14W]cGm | GCRRLCWRQRCVTWCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | MM96L | Breast cancer | CC50 : 5.4 ± 0.3 μM |
| dbacp00655 | [Y7W, K8R, Y14W]cGm | GCRRLCWRQRCVTWCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | MM96L | Cervical cancer | CC50 : 5.4 ± 0.3 μM |
| dbacp00656 | [Y7W, K8R, Y14W]cGm | GCRRLCWRQRCVTWCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | HFF-1 | Epithelial cancer | CC50 : 31.3 ± 2.6 μM |
| dbacp00657 | [Y7W, K8R, Y14W]cGm | GCRRLCWRQRCVTWCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | HFF-1 | Chronic myeloid Leukemia | CC50 : 31.3 ± 2.6 μM |
| dbacp00658 | [Y7W, K8R, Y14W]cGm | GCRRLCWRQRCVTWCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | HFF-1 | Gastric cancer | CC50 : 31.3 ± 2.6 μM |
| dbacp00659 | [Y7W, K8R, Y14W]cGm | GCRRLCWRQRCVTWCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | HFF-1 | Breast cancer | CC50 : 31.3 ± 2.6 μM |
| dbacp00660 | [Y7W, K8R, Y14W]cGm | GCRRLCWRQRCVTWCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | HFF-1 | Cervical cancer | CC50 : 31.3 ± 2.6 μM |
| dbacp00661 | [Y7W, K8R, Y14W]cGm | GCRRLCWRQRCVTWCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | HeLa | Epithelial cancer | CC50 : 41.0 ± 4.2 μM |
| dbacp00662 | [Y7W, K8R, Y14W]cGm | GCRRLCWRQRCVTWCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | HeLa | Chronic myeloid Leukemia | CC50 : 41.0 ± 4.2 μM |
| dbacp00663 | [Y7W, K8R, Y14W]cGm | GCRRLCWRQRCVTWCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | HeLa | Gastric cancer | CC50 : 41.0 ± 4.2 μM |
| dbacp00664 | [Y7W, K8R, Y14W]cGm | GCRRLCWRQRCVTWCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | HeLa | Breast cancer | CC50 : 41.0 ± 4.2 μM |
| dbacp00665 | [Y7W, K8R, Y14W]cGm | GCRRLCWRQRCVTWCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | HeLa | Cervical cancer | CC50 : 41.0 ± 4.2 μM |
| dbacp00666 | [Y7W, K8R, Y14W]cGm | GCRRLCWRQRCVTWCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | MCF-7 | Epithelial cancer | CC50 : 15.1 ± 1.4 μM |
| dbacp00667 | [Y7W, K8R, Y14W]cGm | GCRRLCWRQRCVTWCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | MCF-7 | Chronic myeloid Leukemia | CC50 : 15.1 ± 1.4 μM |
| dbacp00668 | [Y7W, K8R, Y14W]cGm | GCRRLCWRQRCVTWCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | MCF-7 | Gastric cancer | CC50 : 15.1 ± 1.4 μM |
| dbacp00669 | [Y7W, K8R, Y14W]cGm | GCRRLCWRQRCVTWCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | MCF-7 | Breast cancer | CC50 : 15.1 ± 1.4 μM |
| dbacp00670 | [Y7W, K8R, Y14W]cGm | GCRRLCWRQRCVTWCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | MCF-7 | Cervical cancer | CC50 : 15.1 ± 1.4 μM |
| dbacp00671 | [Y7W, K8R, Y14W]cGm | GCRRLCWRQRCVTWCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | K-562 | Epithelial cancer | CC50 : 3.9 ± 0.1 μM |
| dbacp00672 | [Y7W, K8R, Y14W]cGm | GCRRLCWRQRCVTWCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | K-562 | Chronic myeloid Leukemia | CC50 : 3.9 ± 0.1 μM |
| dbacp00673 | [Y7W, K8R, Y14W]cGm | GCRRLCWRQRCVTWCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | K-562 | Gastric cancer | CC50 : 3.9 ± 0.1 μM |
| dbacp00674 | [Y7W, K8R, Y14W]cGm | GCRRLCWRQRCVTWCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | K-562 | Breast cancer | CC50 : 3.9 ± 0.1 μM |
| dbacp00675 | [Y7W, K8R, Y14W]cGm | GCRRLCWRQRCVTWCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | K-562 | Cervical cancer | CC50 : 3.9 ± 0.1 μM |
| dbacp00676 | [Y7W]cGm | GCRRLCWKQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | CRL-1739 | Epithelial cancer | CC50 : 23.3 ± 0.4 μM |
| dbacp00677 | [Y7W]cGm | GCRRLCWKQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | CRL-1739 | Chronic myeloid Leukemia | CC50 : 23.3 ± 0.4 μM |
| dbacp00678 | [Y7W]cGm | GCRRLCWKQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | CRL-1739 | Gastric cancer | CC50 : 23.3 ± 0.4 μM |
| dbacp00679 | [Y7W]cGm | GCRRLCWKQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | CRL-1739 | Breast cancer | CC50 : 23.3 ± 0.4 μM |
| dbacp00680 | [Y7W]cGm | GCRRLCWKQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | CRL-1739 | Cervical cancer | CC50 : 23.3 ± 0.4 μM |
| dbacp00681 | [Y7W]cGm | GCRRLCWKQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | MM96L | Epithelial cancer | CC50 : 5.1 ± 0.3 μM |
| dbacp00682 | [Y7W]cGm | GCRRLCWKQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | MM96L | Chronic myeloid Leukemia | CC50 : 5.1 ± 0.3 μM |
| dbacp00683 | [Y7W]cGm | GCRRLCWKQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | MM96L | Gastric cancer | CC50 : 5.1 ± 0.3 μM |
| dbacp00684 | [Y7W]cGm | GCRRLCWKQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | MM96L | Breast cancer | CC50 : 5.1 ± 0.3 μM |
| dbacp00685 | [Y7W]cGm | GCRRLCWKQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | MM96L | Cervical cancer | CC50 : 5.1 ± 0.3 μM |
| dbacp00686 | [Y7W]cGm | GCRRLCWKQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | HFF-1 | Epithelial cancer | CC50 : 39.7 ± 3.8 μM |
| dbacp00687 | [Y7W]cGm | GCRRLCWKQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | HFF-1 | Chronic myeloid Leukemia | CC50 : 39.7 ± 3.8 μM |
| dbacp00688 | [Y7W]cGm | GCRRLCWKQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | HFF-1 | Gastric cancer | CC50 : 39.7 ± 3.8 μM |
| dbacp00689 | [Y7W]cGm | GCRRLCWKQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | HFF-1 | Breast cancer | CC50 : 39.7 ± 3.8 μM |
| dbacp00690 | [Y7W]cGm | GCRRLCWKQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | HFF-1 | Cervical cancer | CC50 : 39.7 ± 3.8 μM |
| dbacp00691 | [Y7W]cGm | GCRRLCWKQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | HeLa | Epithelial cancer | CC50 : > 64 μM |
| dbacp00692 | [Y7W]cGm | GCRRLCWKQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | HeLa | Chronic myeloid Leukemia | CC50 : > 64 μM |
| dbacp00693 | [Y7W]cGm | GCRRLCWKQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | HeLa | Gastric cancer | CC50 : > 64 μM |
| dbacp00694 | [Y7W]cGm | GCRRLCWKQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | HeLa | Breast cancer | CC50 : > 64 μM |
| dbacp00695 | [Y7W]cGm | GCRRLCWKQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | HeLa | Cervical cancer | CC50 : > 64 μM |
| dbacp00696 | [Y7W]cGm | GCRRLCWKQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | K-562 | Epithelial cancer | CC50 : 3.9 ± 0.2 μM |
| dbacp00697 | [Y7W]cGm | GCRRLCWKQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | K-562 | Chronic myeloid Leukemia | CC50 : 3.9 ± 0.2 μM |
| dbacp00698 | [Y7W]cGm | GCRRLCWKQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | K-562 | Gastric cancer | CC50 : 3.9 ± 0.2 μM |
| dbacp00699 | [Y7W]cGm | GCRRLCWKQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | K-562 | Breast cancer | CC50 : 3.9 ± 0.2 μM |
| dbacp00700 | [Y7W]cGm | GCRRLCWKQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | K-562 | Cervical cancer | CC50 : 3.9 ± 0.2 μM |
| dbacp00805 | A4K14-citropin1.1 | GLFAVIKKVASVIKGL | Synthetic construct | Cell membrane disintegration | CCK-8 test | C4-2B | Prostate cancer | IC50 : 29.05 μM |
| dbacp00806 | A4K14-citropin1.1 | GLFAVIKKVASVIKGL | Synthetic construct | Cell membrane disintegration | CCK-8 test | C4-2B | Lung cancer | IC50 : 29.05 μM |
| dbacp00807 | A4K14-citropin1.1 | GLFAVIKKVASVIKGL | Synthetic construct | Cell membrane disintegration | CCK-8 test | A549 | Prostate cancer | IC50 : 14.97 μM |
| dbacp00808 | A4K14-citropin1.1 | GLFAVIKKVASVIKGL | Synthetic construct | Cell membrane disintegration | CCK-8 test | A549 | Lung cancer | IC50 : 14.97 μM |
| dbacp00809 | A4K14-citropin1.1 | GLFAVIKKVASVIKGL | Synthetic construct | Cell membrane disintegration | CCK-8 test | U87 | Prostate cancer | IC50 : 14.8 μM |
| dbacp00810 | A4K14-citropin1.1 | GLFAVIKKVASVIKGL | Synthetic construct | Cell membrane disintegration | CCK-8 test | U87 | Lung cancer | IC50 : 14.8 μM |
| dbacp00811 | A4K14-citropin1.1 | GLFAVIKKVASVIKGL | Synthetic construct | Cell membrane disintegration | CCK-8 test | MCF-7 | Prostate cancer | IC50 : 14.16 μM |
| dbacp00812 | A4K14-citropin1.1 | GLFAVIKKVASVIKGL | Synthetic construct | Cell membrane disintegration | CCK-8 test | MCF-7 | Lung cancer | IC50 : 14.16 μM |
| dbacp00951 | ABP-dHC-Cecropin A | RWKIFKKIERVGQNVRDGIIKAGPAIQVLGTAKALGK | Synthetic construct | Apoptosis inducing | MTT assay | K562 cells | Leukemia | IC50 : 349.5 μM |
| dbacp00952 | ABP-dHC-Cecropin A | RWKIFKKIERVGQNVRDGIIKAGPAIQVLGTAKALGK | Synthetic construct | Apoptosis inducing | MTT assay | U937 cells | Leukemia | IC50 : 303.2 μM |
| dbacp00953 | ABP-dHC-Cecropin A | RWKIFKKIERVGQNVRDGIIKAGPAIQVLGTAKALGK | Synthetic construct | Apoptosis inducing | MTT assay | THP-1 cells | Leukemia | IC50 : 228.5 μM |
| dbacp00954 | ABP-dHC-Cecropin A-K | RWKIFKKIERVGQNVRDGIIKAGKAIQVLGTAKALGK | Synthetic construct | Apoptosis inducing | MTT assay | K562 cells | Leukemia | IC50 : 349.5 μM |
| dbacp00955 | ABP-dHC-Cecropin A-K | RWKIFKKIERVGQNVRDGIIKAGKAIQVLGTAKALGK | Synthetic construct | Apoptosis inducing | MTT assay | U937 cells | Leukemia | IC50 : 303.2 μM |
| dbacp00956 | ABP-dHC-Cecropin A-K | RWKIFKKIERVGQNVRDGIIKAGKAIQVLGTAKALGK | Synthetic construct | Apoptosis inducing | MTT assay | THP-1 cells | Leukemia | IC50 : 228.5 μM |
| dbacp01186 | APQQ | NA | Synthetic construct | Cell metatstasis inhibition | Transwell assay | MDA-MB-231 | Breast cancer | Not found |
| dbacp01187 | APQQ | NA | Synthetic construct | Cell metatstasis inhibition | Transwell assay | MCF-7 | Breast cancer | Not found |
| dbacp01188 | APQQ | NA | Synthetic construct | Cell metatstasis inhibition | Transwell assay | U251 | Brain cancer | Not found |
| dbacp01192 | Ascaphin-8 [T16A] | GFKDLLKGAAKALVKAVLF | Synthetic construct | Not specified | Not specified | Not found | Liver cancer | Not found |
| dbacp01442 | Baceridin | cyclo(L-Trp-D-Ala-D-allo-Ile-L-Val-D-Leu-L-Leu-) | Synthetic construct | Apoptosis inducing | MTT assay | HCT116 | Not specified | Not found |
| dbacp01443 | Baceridin | cyclo(L-Trp-D-Ala-D-allo-Ile-L-Val-D-Leu-L-Leu-) | Synthetic construct | Apoptosis inducing | MTT assay | RKO | Not specified | Not found |
| dbacp01444 | Baceridin | cyclo(L-Trp-D-Ala-D-allo-Ile-L-Val-D-Leu-L-Leu-) | Synthetic construct | Apoptosis inducing | MTT assay | HeLa | Not specified | Not found |
| dbacp02108 | cMastoparan-C(cMP-C) | CLNLKALLAVAKKILC | Synthetic construct | Apoptosis | MTT assay | H157 | Non-small cell Lung cancer | IC50 : 7.02 μM |
| dbacp02109 | cMastoparan-C(cMP-C) | CLNLKALLAVAKKILC | Synthetic construct | Apoptosis | MTT assay | MBD-MB-435S | Melanocyte | IC50 : 13.87 μM |
| dbacp02110 | cMastoparan-C(cMP-C) | CLNLKALLAVAKKILC | Synthetic construct | Apoptosis | MTT assay | PC-3 | Human prostate carcinoma | IC50 : 13.87 μM |
| dbacp02111 | cMastoparan-C(cMP-C) | CLNLKALLAVAKKILC | Synthetic construct | Apoptosis | MTT assay | U251-MG | Human glioblastoma astrocytoma | IC50 : 8.56 μM |
| dbacp02112 | cMastoparan-C(cMP-C) | CLNLKALLAVAKKILC | Synthetic construct | Apoptosis | MTT assay | MCF-7 | Human breast cancer | IC50 : 13.66 μM |
| dbacp02145 | C1 | KKWβ2,2WKK | Synthetic construct | Membrane disruptive mode of action | MTT/MTS assay | Ramos | Lymphoma cancer | IC50 : 10 ±2 µMol/L |
| dbacp02146 | C1 | KKWβ2,2WKK | Synthetic construct | Membrane disruptive mode of action | MTT/MTS assay | Ramos | Lymphoma cancer | IC50 : 22 ±5 µMol/L |
| dbacp02148 | C2 | KWβ2,2WKK | Synthetic construct | Membrane disruptive mode of action | MTT/MTS assay | Ramos | Lymphoma cancer | IC50 : 7.9 ± 0.3 µMol/L |
| dbacp02149 | C2 | KWβ2,2WKK | Synthetic construct | Membrane disruptive mode of action | MTT/MTS assay | Ramos | Lymphoma cancer | IC50 : 1.71 ± 0.6 µMol/L |
| dbacp02150 | C3 | KKβ2,2WKK | Synthetic construct | Membrane disruptive mode of action | MTT/MTS assay | Ramos | Lymphoma cancer | IC50 : 15 ± 2 µMol/L |
| dbacp02151 | C3 | KKβ2,2WKK | Synthetic construct | Membrane disruptive mode of action | MTT/MTS assay | Ramos | Lymphoma cancer | IC50 : 92 ± 2 µMol/L |
| dbacp02152 | C4 | KWβ2,2KK | Synthetic construct | Membrane disruptive mode of action | MTT/MTS assay | Ramos | Lymphoma cancer | IC50 : 12.6 ± 0.6 µMol/L |
| dbacp02153 | C4 | KWβ2,2KK | Synthetic construct | Membrane disruptive mode of action | MTT/MTS assay | Ramos | Lymphoma cancer | IC50 : 99 ± 15 µMol/L |
| dbacp02154 | C5 | KKWβ2,2WKK | Synthetic construct | Membrane disruptive mode of action | MTT/MTS assay | Ramos | Lymphoma cancer | IC50 : 11 ± 2 µMol/L |
| dbacp02155 | C5 | KKWβ2,2WKK | Synthetic construct | Membrane disruptive mode of action | MTT/MTS assay | Ramos | Lymphoma cancer | IC50 : 23 ± 3 µMol/L |
| dbacp02156 | C6 | KWβ2,2WKK | Synthetic construct | Membrane disruptive mode of action | MTT/MTS assay | Ramos | Lymphoma cancer | IC50 : 8 ± 1 µMol/L |
| dbacp02157 | C6 | KWβ2,2WKK | Synthetic construct | Membrane disruptive mode of action | MTT/MTS assay | Ramos | Lymphoma cancer | IC50 : 26 ± 2 µMol/L |
| dbacp02158 | C7 | KKβ2,2WKK | Synthetic construct | Membrane disruptive mode of action | MTT/MTS assay | Ramos | Lymphoma cancer | IC50 : 16 ± 5 µMol/L |
| dbacp02159 | C7 | KKβ2,2WKK | Synthetic construct | Membrane disruptive mode of action | MTT/MTS assay | Ramos | Lymphoma cancer | IC50 : 157 ± 30 µMol/L |
| dbacp02395 | cGm (Derived from Gm) | GCRRLCYKQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | CRL-1739 | Epithelial cancer | CC50 : 39.8 ± 1.0 μM |
| dbacp02396 | cGm (Derived from Gm) | GCRRLCYKQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | CRL-1739 | Chronic myeloid leukemia | CC50 : 39.8 ± 1.0 μM |
| dbacp02397 | cGm (Derived from Gm) | GCRRLCYKQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | CRL-1739 | Gastric cancer | CC50 : 39.8 ± 1.0 μM |
| dbacp02398 | cGm (Derived from Gm) | GCRRLCYKQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | CRL-1739 | Breast cancer | CC50 : 39.8 ± 1.0 μM |
| dbacp02399 | cGm (Derived from Gm) | GCRRLCYKQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | CRL-1739 | Cervical cancer | CC50 : 39.8 ± 1.0 μM |
| dbacp02400 | cGm (Derived from Gm) | GCRRLCYKQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | MM96L | Epithelial cancer | CC50 : 2.9 ± 0.1 μM |
| dbacp02401 | cGm (Derived from Gm) | GCRRLCYKQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | MM96L | Chronic myeloid leukemia | CC50 : 2.9 ± 0.1 μM |
| dbacp02402 | cGm (Derived from Gm) | GCRRLCYKQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | MM96L | Gastric cancer | CC50 : 2.9 ± 0.1 μM |
| dbacp02403 | cGm (Derived from Gm) | GCRRLCYKQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | MM96L | Breast cancer | CC50 : 2.9 ± 0.1 μM |
| dbacp02404 | cGm (Derived from Gm) | GCRRLCYKQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | MM96L | Cervical cancer | CC50 : 2.9 ± 0.1 μM |
| dbacp02405 | cGm (Derived from Gm) | GCRRLCYKQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | HFF-1 | Epithelial cancer | CC50 : 71.7 ± 9.2 μM |
| dbacp02406 | cGm (Derived from Gm) | GCRRLCYKQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | HFF-1 | Chronic myeloid leukemia | CC50 : 71.7 ± 9.2 μM |
| dbacp02407 | cGm (Derived from Gm) | GCRRLCYKQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | HFF-1 | Gastric cancer | CC50 : 71.7 ± 9.2 μM |
| dbacp02408 | cGm (Derived from Gm) | GCRRLCYKQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | HFF-1 | Breast cancer | CC50 : 71.7 ± 9.2 μM |
| dbacp02409 | cGm (Derived from Gm) | GCRRLCYKQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | HFF-1 | Cervical cancer | CC50 : 71.7 ± 9.2 μM |
| dbacp02410 | cGm (Derived from Gm) | GCRRLCYKQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | HeLa | Epithelial cancer | CC50 : > 64 μM |
| dbacp02411 | cGm (Derived from Gm) | GCRRLCYKQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | HeLa | Chronic myeloid leukemia | CC50 : > 64 μM |
| dbacp02412 | cGm (Derived from Gm) | GCRRLCYKQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | HeLa | Gastric cancer | CC50 : > 64 μM |
| dbacp02413 | cGm (Derived from Gm) | GCRRLCYKQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | HeLa | Breast cancer | CC50 : > 64 μM |
| dbacp02414 | cGm (Derived from Gm) | GCRRLCYKQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | HeLa | Cervical cancer | CC50 : > 64 μM |
| dbacp02415 | cGm (Derived from Gm) | GCRRLCYKQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | MCF-7 | Epithelial cancer | CC50 : 15.3 ± 1.4 μM |
| dbacp02416 | cGm (Derived from Gm) | GCRRLCYKQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | MCF-7 | Chronic myeloid leukemia | CC50 : 15.3 ± 1.4 μM |
| dbacp02417 | cGm (Derived from Gm) | GCRRLCYKQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | MCF-7 | Gastric cancer | CC50 : 15.3 ± 1.4 μM |
| dbacp02418 | cGm (Derived from Gm) | GCRRLCYKQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | MCF-7 | Breast cancer | CC50 : 15.3 ± 1.4 μM |
| dbacp02419 | cGm (Derived from Gm) | GCRRLCYKQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | MCF-7 | Cervical cancer | CC50 : 15.3 ± 1.4 μM |
| dbacp02420 | cGm (Derived from Gm) | GCRRLCYKQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | K-562 | Epithelial cancer | CC50 : 2.7 ± 0.1 μM |
| dbacp02421 | cGm (Derived from Gm) | GCRRLCYKQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | K-562 | Chronic myeloid leukemia | CC50 : 2.7 ± 0.1 μM |
| dbacp02422 | cGm (Derived from Gm) | GCRRLCYKQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | K-562 | Gastric cancer | CC50 : 2.7 ± 0.1 μM |
| dbacp02423 | cGm (Derived from Gm) | GCRRLCYKQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | K-562 | Breast cancer | CC50 : 2.7 ± 0.1 μM |
| dbacp02424 | cGm (Derived from Gm) | GCRRLCYKQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | K-562 | Cervical cancer | CC50 : 2.7 ± 0.1 μM |
| dbacp02425 | cGm (Derived from Gm) | GCRRLCYKQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | PBMCs | Epithelial cancer | CC50 : 12.7 ± 1.1 μM |
| dbacp02426 | cGm (Derived from Gm) | GCRRLCYKQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | PBMCs | Chronic myeloid leukemia | CC50 : 12.7 ± 1.1 μM |
| dbacp02427 | cGm (Derived from Gm) | GCRRLCYKQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | PBMCs | Gastric cancer | CC50 : 12.7 ± 1.1 μM |
| dbacp02428 | cGm (Derived from Gm) | GCRRLCYKQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | PBMCs | Breast cancer | CC50 : 12.7 ± 1.1 μM |
| dbacp02429 | cGm (Derived from Gm) | GCRRLCYKQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | PBMCs | Cervical cancer | CC50 : 12.7 ± 1.1 μM |
| dbacp03067 | GLK-19 | GLKKLLGKLLKKLGKLLLK | Synthetic construct | Not specified | Not specified | Not found | Not found | Not found |
| dbacp03177 | H-11 | IKLSPETKKNLKKVLKGAIKGAIAVAKMV | Synthetic construct | Inducing apoptosis | MTT assay | A549 | Not found | IC50 : 1.82 ± 0.23 μM |
| dbacp03178 | H-11 | IKLSPETKKNLKKVLKGAIKGAIAVAKMV | Synthetic construct | Inducing apoptosis | MTT assay | HCT116 | Not found | IC50 : 6.50 ± 0.32 μM |
| dbacp03179 | H-11 | IKLSPETKKNLKKVLKGAIKGAIAVAKMV | Synthetic construct | Inducing apoptosis | MTT assay | HepG2 | Not found | IC50 : 4.96 ± 0.43 μM |
| dbacp03180 | H-12 | IKLSKETKDNLKKVLKGAIKGAIAVAKMV | Synthetic construct | Inducing apoptosis | MTT assay | A549 | Not found | IC50 : 2.35 ± 0.31 μM |
| dbacp03181 | H-12 | IKLSKETKDNLKKVLKGAIKGAIAVAKMV | Synthetic construct | Inducing apoptosis | MTT assay | HCT116 | Not found | IC50 : 8.09 ± 0.40 μM |
| dbacp03182 | H-12 | IKLSKETKDNLKKVLKGAIKGAIAVAKMV | Synthetic construct | Inducing apoptosis | MTT assay | HepG2 | Not found | IC50 : 4.28 ± 0.38 μM |
| dbacp03183 | H-13 | IKLSKETKKNLKKVLKGAIKGAIAVAKMV | Synthetic construct | Inducing apoptosis | MTT assay | A549 | Not found | IC50 : 1.17 ± 0.23 μM |
| dbacp03184 | H-13 | IKLSKETKKNLKKVLKGAIKGAIAVAKMV | Synthetic construct | Inducing apoptosis | MTT assay | HCT116 | Not found | IC50 : 4.93 ± 0.51 μM |
| dbacp03185 | H-13 | IKLSKETKKNLKKVLKGAIKGAIAVAKMV | Synthetic construct | Inducing apoptosis | MTT assay | HepG2 | Not found | IC50 : 2.46 ± 0.32 μM |
| dbacp03186 | H-14 | IKLSKKTKKNLKKVLKGAIKGAIAVAKMV | Synthetic construct | Inducing apoptosis | MTT assay | A549 | Not found | IC50 : 0.98 ± 0.11 μM |
| dbacp03187 | H-14 | IKLSKKTKKNLKKVLKGAIKGAIAVAKMV | Synthetic construct | Inducing apoptosis | MTT assay | HCT116 | Not found | IC50 : 1.841 ± 0.34 μM |
| dbacp03188 | H-14 | IKLSKKTKKNLKKVLKGAIKGAIAVAKMV | Synthetic construct | Inducing apoptosis | MTT assay | HepG2 | Not found | IC50 : 4.54 ± 0.25 μM |
| dbacp04130 | LK1 (Temporin-1CEa Analog peptide) | FVDLKKIANIINSIFKK | Synthetic construct | Cell membrane disintegration | MTT-assay | MCF-7 | Breast cancer | IC50 : 20.97 µM |
| dbacp04131 | LK1 (Temporin-1CEa Analog peptide) | FVDLKKIANIINSIFKK | Synthetic construct | Cell membrane disintegration | MTT-assay | Bcap-37 | Breast cancer | IC50 : 18.7 µM |
| dbacp04132 | LK1 (Temporin-1CEa Analog peptide) | FVDLKKIANIINSIFKK | Synthetic construct | Cell membrane disintegration | MTT-assay | MDA-MB-231 | Breast cancer | IC50 : 66.4µM |
| dbacp04133 | LK2(5) (Temporin-1CEa Analog peptide) | FKDLKKIANIINSIFKK | Synthetic construct | Cell membrane disintegration | MTT-assay | MCF-7 | Breast cancer | IC50 : 44.7 µM |
| dbacp04134 | LK2(5) (Temporin-1CEa Analog peptide) | FKDLKKIANIINSIFKK | Synthetic construct | Cell membrane disintegration | MTT-assay | Bcap-37 | Breast cancer | IC50 : 83.49 µM |
| dbacp04135 | LK2(5) (Temporin-1CEa Analog peptide) | FKDLKKIANIINSIFKK | Synthetic construct | Cell membrane disintegration | MTT-assay | MDA-MB-231 | Breast cancer | IC50 : 894.7 µM |
| dbacp04136 | LK2(6) (Temporin-1CEa Analog peptide) | FVKLKKIANIINSIFKK | Synthetic construct | Cell membrane disintegration | MTT-assay | MCF-7 | Breast cancer | IC50 : 15.54 µM |
| dbacp04137 | LK2(6) (Temporin-1CEa Analog peptide) | FVKLKKIANIINSIFKK | Synthetic construct | Cell membrane disintegration | MTT-assay | Bcap-37 | Breast cancer | IC50 : 18.9 µM |
| dbacp04138 | LK2(6) (Temporin-1CEa Analog peptide) | FVKLKKIANIINSIFKK | Synthetic construct | Cell membrane disintegration | MTT-assay | MDA-MB-231 | Breast cancer | IC50 : 85.41 µM |
| dbacp04139 | LK2(6)A(L) (Temporin-1CEa Analog peptide) | FVKLKKILNIINSIFKK | Synthetic construct | Cell membrane disintegration | MTT-assay | MCF-7 | Breast cancer | IC50 : 9.01 µM |
| dbacp04140 | LK2(6)A(L) (Temporin-1CEa Analog peptide) | FVKLKKILNIINSIFKK | Synthetic construct | Cell membrane disintegration | MTT-assay | Bcap-37 | Breast cancer | IC50 : 10.52 µM |
| dbacp04141 | LK2(6)A(L) (Temporin-1CEa Analog peptide) | FVKLKKILNIINSIFKK | Synthetic construct | Cell membrane disintegration | MTT-assay | MDA-MB-231 | Breast cancer | IC50 : 34.74 µM |
| dbacp04142 | LK2(6)AN(2L) (Temporin-1CEa Analog peptide) | FVKLKKILNIILSIFKK | Synthetic construct | Cell membrane disintegration | MTT-assay | MCF-7 | Breast cancer | IC50 : 11 µM |
| dbacp04143 | LK2(6)AN(2L) (Temporin-1CEa Analog peptide) | FVKLKKILNIILSIFKK | Synthetic construct | Cell membrane disintegration | MTT-assay | Bcap-37 | Breast cancer | IC50 : 9.39 µM |
| dbacp04144 | LK2(6)AN(2L) (Temporin-1CEa Analog peptide) | FVKLKKILNIILSIFKK | Synthetic construct | Cell membrane disintegration | MTT-assay | MDA-MB-231 | Breast cancer | IC50 : 41.55 µM |
| dbacp04145 | LK3 (Temporin-1CEa Analog peptide) | FKKLKKIANIINSIFKK | Synthetic construct | Cell membrane disintegration | MTT-assay | MCF-7 | Breast cancer | IC50 : 27.72 µM |
| dbacp04146 | LK3 (Temporin-1CEa Analog peptide) | FKKLKKIANIINSIFKK | Synthetic construct | Cell membrane disintegration | MTT-assay | Bcap-37 | Breast cancer | IC50 : 25.04 µM |
| dbacp04147 | LK3 (Temporin-1CEa Analog peptide) | FKKLKKIANIINSIFKK | Synthetic construct | Cell membrane disintegration | MTT-assay | MDA-MB-231 | Breast cancer | IC50 : 224.8 µM |
| dbacp04872 | NK-dpro (Derived from NK-2) | KILPGVCKKIMRPFLRRISKDILTGKK | Synthetic construct | Not specified | MTT assay | EJ | Not found | IC50 : 28.7 μM |
| dbacp04873 | NK-dpro (Derived from NK-2) | KILPGVCKKIMRPFLRRISKDILTGKK | Synthetic construct | Not specified | MTT assay | PC-3 | Not found | IC50 : 9.6 μM |
| dbacp04874 | NK-dpro (Derived from NK-2) | KILPGVCKKIMRPFLRRISKDILTGKK | Synthetic construct | Not specified | MTT assay | T24 | Not found | IC50 : 39.6 μM |
| dbacp04875 | NK-dpro (Derived from NK-2) | KILPGVCKKIMRPFLRRISKDILTGKK | Synthetic construct | Not specified | MTT assay | HL-60 | Not found | IC50 : 48.4 μM |
| dbacp04876 | NK-pro (Derived from NK-2) | KILRGVCKKIMRPFLRRISKDILTGKK | Synthetic construct | Not specified | MTT assay | EJ | Not found | IC50 : 23.3 μM |
| dbacp04877 | NK-pro (Derived from NK-2) | KILRGVCKKIMRPFLRRISKDILTGKK | Synthetic construct | Not specified | MTT assay | PC-3 | Not found | IC50 : 9.3 μM |
| dbacp04878 | NK-pro (Derived from NK-2) | KILRGVCKKIMRPFLRRISKDILTGKK | Synthetic construct | Not specified | MTT assay | T24 | Not found | IC50 : 33.0 μM |
| dbacp04879 | NK-pro (Derived from NK-2) | KILRGVCKKIMRPFLRRISKDILTGKK | Synthetic construct | Not specified | MTT assay | HL-60 | Not found | IC50 : 26.1 μM |
| dbacp05051 | P18 (Cecropin A(1-8)-Magainin 2(112) hybrid peptide Analogue) | KWKLFKKIPKFLHLAKKF | Synthetic construct | Not specified | Not specified | Not found | Not found | Not found |
| dbacp05103 | PA10 | RQIKIWFQNRRMKWKKGGGGNNETTSIQIAGSLHHHHHH | Synthetic construct | Cell proliferation inhibition; Cell penetration; Apoptosis | Cell viability assay | MDA-MB231 | Breast cancer | MIC : 10 μM |
| dbacp05104 | PA10 | RQIKIWFQNRRMKWKKGGGGNNETTSIQIAGSLHHHHHH | Synthetic construct | Cell proliferation inhibition; Cell penetration; Apoptosis | Cell viability assay | HCC1806 | Breast cancer | MIC : 10 μM |
| dbacp05105 | PA10 | RQIKIWFQNRRMKWKKGGGGNNETTSIQIAGSLHHHHHH | Synthetic construct | Cell proliferation inhibition; Cell penetration; Apoptosis | Cell viability assay | 184B5 | Breast cancer | MIC : 10 μM |
| dbacp05106 | PA10 | RQIKIWFQNRRMKWKKGGGGNNETTSIQIAGSLHHHHHH | Synthetic construct | Cell proliferation inhibition; Cell penetration; Apoptosis | Cell viability assay | MCF10A | Breast cancer | MIC : 10 μM |
| dbacp05107 | PA15 | RQIKIWFQNRRMKWKKGGSLSAACHEQWSLGAQHHHHHH | Synthetic construct | Cell proliferation inhibition; Cell penetration; Apoptosis | Cell viability assay | MDA-MB231 | Breast cancer | MIC : 10 μM |
| dbacp05108 | PA15 | RQIKIWFQNRRMKWKKGGSLSAACHEQWSLGAQHHHHHH | Synthetic construct | Cell proliferation inhibition; Cell penetration; Apoptosis | Cell viability assay | HCC1806 | Breast cancer | MIC : 10 μM |
| dbacp05109 | PA15 | RQIKIWFQNRRMKWKKGGSLSAACHEQWSLGAQHHHHHH | Synthetic construct | Cell proliferation inhibition; Cell penetration; Apoptosis | Cell viability assay | 184B5 | Breast cancer | MIC : 10 μM |
| dbacp05110 | PA15 | RQIKIWFQNRRMKWKKGGSLSAACHEQWSLGAQHHHHHH | Synthetic construct | Cell proliferation inhibition; Cell penetration; Apoptosis | Cell viability assay | MCF10A | Breast cancer | MIC : 10 μM |
| dbacp05111 | PA2 | RQIKIWFQNRRMKWKKGGATRPRVDTQPELCGMHHHHHH | Synthetic construct | Cell proliferation inhibition; Cell penetration; Apoptosis | Cell viability assay | MDA-MB231 | Breast cancer | MIC : 10 μM |
| dbacp05112 | PA2 | RQIKIWFQNRRMKWKKGGATRPRVDTQPELCGMHHHHHH | Synthetic construct | Cell proliferation inhibition; Cell penetration; Apoptosis | Cell viability assay | HCC1806 | Breast cancer | MIC : 10 μM |
| dbacp05113 | PA2 | RQIKIWFQNRRMKWKKGGATRPRVDTQPELCGMHHHHHH | Synthetic construct | Cell proliferation inhibition; Cell penetration; Apoptosis | Cell viability assay | 184B5 | Breast cancer | MIC : 10 μM |
| dbacp05114 | PA2 | RQIKIWFQNRRMKWKKGGATRPRVDTQPELCGMHHHHHH | Synthetic construct | Cell proliferation inhibition; Cell penetration; Apoptosis | Cell viability assay | MCF10A | Breast cancer | MIC : 10 μM |
| dbacp05115 | PA3 | RQIKIWFQNRRMKWKKGGDCLCISRRARLLRATHHHHHH | Synthetic construct | Cell proliferation inhibition; Cell penetration; Apoptosis | Cell viability assay | MDA-MB231 | Breast cancer | MIC : 10 μM |
| dbacp05116 | PA3 | RQIKIWFQNRRMKWKKGGDCLCISRRARLLRATHHHHHH | Synthetic construct | Cell proliferation inhibition; Cell penetration; Apoptosis | Cell viability assay | HCC1806 | Breast cancer | MIC : 10 μM |
| dbacp05117 | PA3 | RQIKIWFQNRRMKWKKGGDCLCISRRARLLRATHHHHHH | Synthetic construct | Cell proliferation inhibition; Cell penetration; Apoptosis | Cell viability assay | 184B5 | Breast cancer | MIC : 10 μM |
| dbacp05118 | PA3 | RQIKIWFQNRRMKWKKGGDCLCISRRARLLRATHHHHHH | Synthetic construct | Cell proliferation inhibition; Cell penetration; Apoptosis | Cell viability assay | MCF10A | Breast cancer | MIC : 10 μM |
| dbacp05119 | PA38 | RQIKIWFQNRRMKWKKGGKYNGRFTTHHLLHLLNHHHHHH | Synthetic construct | Cell proliferation inhibition; Cell penetration; Apoptosis | Cell viability assay | MDA-MB231 | Breast cancer | MIC : 10 μM |
| dbacp05120 | PA38 | RQIKIWFQNRRMKWKKGGKYNGRFTTHHLLHLLNHHHHHH | Synthetic construct | Cell proliferation inhibition; Cell penetration; Apoptosis | Cell viability assay | HCC1806 | Breast cancer | MIC : 10 μM |
| dbacp05121 | PA38 | RQIKIWFQNRRMKWKKGGKYNGRFTTHHLLHLLNHHHHHH | Synthetic construct | Cell proliferation inhibition; Cell penetration; Apoptosis | Cell viability assay | 184B5 | Breast cancer | MIC : 10 μM |
| dbacp05122 | PA38 | RQIKIWFQNRRMKWKKGGKYNGRFTTHHLLHLLNHHHHHH | Synthetic construct | Cell proliferation inhibition; Cell penetration; Apoptosis | Cell viability assay | MCF10A | Breast cancer | MIC : 10 μM |
| dbacp05123 | PA49 | RQIKIWFQNRRMKWKKGGAGVYTFLVGADNRGWEHHHHHH | Synthetic construct | Cell proliferation inhibition; Cell penetration; Apoptosis | Cell viability assay | MDA-MB231 | Breast cancer | MIC : 10 μM |
| dbacp05124 | PA49 | RQIKIWFQNRRMKWKKGGAGVYTFLVGADNRGWEHHHHHH | Synthetic construct | Cell proliferation inhibition; Cell penetration; Apoptosis | Cell viability assay | HCC1806 | Breast cancer | MIC : 10 μM |
| dbacp05125 | PA49 | RQIKIWFQNRRMKWKKGGAGVYTFLVGADNRGWEHHHHHH | Synthetic construct | Cell proliferation inhibition; Cell penetration; Apoptosis | Cell viability assay | 184B5 | Breast cancer | MIC : 10 μM |
| dbacp05126 | PA49 | RQIKIWFQNRRMKWKKGGAGVYTFLVGADNRGWEHHHHHH | Synthetic construct | Cell proliferation inhibition; Cell penetration; Apoptosis | Cell viability assay | MCF10A | Breast cancer | MIC : 10 μM |
| dbacp05434 | Peptide-1 | IELLQARGGC-Pem | Synthetic construct | Cell membrane disintegration | MTT/MTS assay | HL-60 | Leukemia cancer | IC50 : 2.17 µM |
| dbacp05435 | Peptide-1 | IELLQARGGC-Pem | Synthetic construct | Cell membrane disintegration | MTT/MTS assay | NCI-H358 | Lung cancer | IC50 : 4.63 mM |
| dbacp05436 | Peptide-2 | IELLQARGGC-Pem-GGRRRRRRRR | Synthetic construct | Cell membrane disintegration | MTT/MTS assay | HL-60 | Leukemia cancer | IC50 : 2.64 µM |
| dbacp05437 | Peptide-2 | IELLQARGGC-Pem-GGRRRRRRRR | Synthetic construct | Cell membrane disintegration | MTT/MTS assay | NCI-H358 | Lung cancer | IC50 : 2.19 µM |
| dbacp05445 | Peptide-3 | RRRRRRRRGGC-Pem | Synthetic construct | Cell membrane disintegration | MTT/MTS assay | HL-60 | Leukemia cancer | IC50 : 6.24 µM |
| dbacp05446 | Peptide-3 | RRRRRRRRGGC-Pem | Synthetic construct | Cell membrane disintegration | MTT/MTS assay | NCI-H358 | Lung cancer | IC50 : 8.41 µM |
| dbacp06183 | t Mastoparan-C(tMP-C, Tat (49-57)-Mastoparan-C) | RKKRRQRRRLNLKALLAVAKKIL | Synthetic construct | Apoptosis inducing | MTT assay | H157 | Non-small cell Lung cancer | IC50 : 2.79 μM |
| dbacp06184 | t Mastoparan-C(tMP-C, Tat (49-57)-Mastoparan-C) | RKKRRQRRRLNLKALLAVAKKIL | Synthetic construct | Apoptosis inducing | MTT assay | MBD-MB-435S | Melanocyte | IC50 : 3.86 μM |
| dbacp06185 | t Mastoparan-C(tMP-C, Tat (49-57)-Mastoparan-C) | RKKRRQRRRLNLKALLAVAKKIL | Synthetic construct | Apoptosis inducing | MTT assay | PC-3 | Human prostate carcinoma | IC50 : 3.86 μM |
| dbacp06186 | t Mastoparan-C(tMP-C, Tat (49-57)-Mastoparan-C) | RKKRRQRRRLNLKALLAVAKKIL | Synthetic construct | Apoptosis inducing | MTT assay | U251-MG | Human glioblastoma astrocytoma | IC50 : 3.36 μM |
| dbacp06187 | t Mastoparan-C(tMP-C, Tat (49-57)-Mastoparan-C) | RKKRRQRRRLNLKALLAVAKKIL | Synthetic construct | Apoptosis inducing | MTT assay | MCF-7 | Human breast cancer | IC50 : 3.70 μM |
| dbacp06196 | Tat (47-57) | YGRKKRRQRRR | Synthetic construct | Cell membrane disintegration | MTT/MTS assay | HeLa | Cervical cancer | At 1 µM 90 - 100% viablity |
| dbacp06197 | Tat (47-57) | YGRKKRRQRRR | Synthetic construct | Cell membrane disintegration | MTT/MTS assay | HeLa | Cervical cancer | At 10 µM 80% viablity |
| dbacp06198 | Tat (47-57) | YGRKKRRQRRR | Synthetic construct | Cell membrane disintegration | MTT/MTS assay | HeLa | Cervical cancer | At 100 µM 60% viablity |