dbACP: A Comprehensive Database of Anti-Cancer Peptides

238 result(s) have been found!

Accession Name Sequence Source/Organism Mechanism Assay Type Cell Line Cancer Type Activity
dbacp00004 Citropin modified peptide-3 GLFAVIKKVASVIGGL Amphibian skin secretions Penetration and disruption of the membrane Sulforhodamine B assay Brain tumor cell line Brain tumor IC50 : 6 M
dbacp00013 Citropin modified peptide-5 GLFDVIKAVASVIGGL Amphibian skin secretions Penetration and disruption of the membrane Sulforhodamine B assay Brain tumor cell line Brain tumor IC50 : 5 M
dbacp00022 Citropin modified peptide-7 GLFDVIKKVAAVIGGL Amphibian skin secretions Penetration and disruption of the membrane Sulforhodamine B assay Brain tumor cell line Brain tumor IC50 : 5 M
dbacp00101 Citropin modified peptide-11 GLFDVIKKVASVIKGL Amphibian skin secretions Penetration and disruption of the membrane Sulforhodamine B assay Brain tumor cell line Brain tumor IC50 : 5 M
dbacp00110 Citropin modified peptide-13 GLFDVIKKVASVIKKL Amphibian skin secretions Penetration and disruption of the membrane Sulforhodamine B assay Brain tumor cell line Brain tumor IC50 : 5 M
dbacp00119 Citropin modified peptide-14 GLFDVIAKVASVIKKL Amphibian skin secretions Penetration and disruption of the membrane Sulforhodamine B assay Brain tumor cell line Brain tumor IC50 : 5 M
dbacp00153 Citropin modified peptide-15 GLFAVIKKVASVIKGL Amphibian skin secretions Penetration and disruption of the membrane Sulforhodamine B assay Brain tumor cell line Brain tumor IC50 : 5 M
dbacp00186 Citropin modified peptide-16 GLFAVIKKVASVIKKL Amphibian skin secretions Penetration and disruption of the membrane Sulforhodamine B assay Brain tumor cell line Brain tumor IC50 : 5 M
dbacp00220 Citropin modified peptide-17 GLFAVIKKVAAVIKKL Amphibian skin secretions Penetration and disruption of the membrane Sulforhodamine B assay Brain tumor cell line Brain tumor IC50 : 5 M
dbacp00255 Citropin modified peptide-18 GLFAVIKKVAAVIRRL Amphibian skin secretions Penetration and disruption of the membrane Sulforhodamine B assay Brain tumor cell line Brain tumor IC50 : 5 M
dbacp00264 Citropin modified peptide-19 GLFAVIKKVAKVIKKL Amphibian skin secretions Penetration and disruption of the membrane Sulforhodamine B assay Brain tumor cell line Brain tumor IC50 : 5 M
dbacp00273 Citropin modified peptide-22 GLFKVIKKVASVIGGL Amphibian skin secretions Penetration and disruption of the membrane Sulforhodamine B assay Brain tumor cell line Brain tumor IC50 : 5 M
dbacp00295 Citropin modified peptide-23 GLFKVIKKVAKVIKKL Amphibian skin secretions Penetration and disruption of the membrane Sulforhodamine B assay Brain tumor cell line Brain tumor IC50 : 5 M
dbacp00312 (HHPHG)2 HHPHGHHPHG Synthetic Peptide Antiangiogenesis Tropomyosin binding assay Not found Tumor IC50 : 11.6 µM
dbacp00313 (HHPHG)2 HHPHGHHPHG Synthetic Peptide Antiangiogenesis Tropomyosin binding assay Not found Tumor IC50 : 26.9 µM
dbacp00314 (HHPHG)3 HHPHGHHPHGHHPHG Synthetic Peptide Antiangiogenesis Tropomyosin binding assay Not found Tumor IC50 : 1.25 µM
dbacp00315 (HHPHG)3 HHPHGHHPHGHHPHG Synthetic Peptide Antiangiogenesis Tropomyosin binding assay Not found Tumor IC50 : 1.56 µM
dbacp00316 (HHPHG)4 HHPHGHHPHGHHPHGHHPHG Synthetic Peptide Antiangiogenesis Tropomyosin binding assay Not found Tumor IC50 : 0.256 µM
dbacp00317 (HHPHG)4 HHPHGHHPHGHHPHGHHPHG Synthetic Peptide Antiangiogenesis Tropomyosin binding assay Not found Tumor IC50 : 0.245 µM
dbacp00750 9R RRRRRNWMWC Not found Cell membrane disintegration; Apoptosis MTT/MTS assay J774A.1 Tumor IC50 : 47 µM
dbacp00751 9R RRRRRNWMWC Not found Cell membrane disintegration; Apoptosis MTT/MTS assay J774A.1 Tumor IC50 : 12 µM
dbacp00763 9S1R RRRRRWCMNW Nullomer derived anticancer peptides (NulloPs) Cell membrane disintegration; Apoptosis MTT/MTS assay J774A.1 Tumor IC50 : 26 µM
dbacp00764 9S1R RRRRRWCMNW Nullomer derived anticancer peptides (NulloPs) Cell membrane disintegration; Apoptosis MTT/MTS assay J774A.1 Tumor IC50 : 17 µM
dbacp00816 AAD (or Aa-Pri1) MDSNKDERAYAQWVIIILHNVGSSPFKIANLGLSWGKLYADGNKDKEVYPSDYNGKTVGPDEKIQINSCGRENASSGTEGSFDIVDPNDGNKTIRHFYWECPWGSKRNTWTPSGSNTKWMVEWSGQNLDSGALGTITVDVLRKGN Purified from chestnut mushroom Apoptosis inducing MTT/MTS assay SH-SY5Y Brain tumor At 2.5 µM concentration,decrease in cell vibility: 70%
dbacp01174 AP ACDCRGDCFCGGGGIVRRADRAAVP Endostatin derived synthetic peptide Necrosis; Antiangiogenesis MTT/MTS assay BAE Tumor 50% inhibition at 2.5 µg/ml
dbacp01175 AP ACDCRGDCFCGGGGIVRRADRAAVP Endostatin derived synthetic peptide Necrosis; Antiangiogenesis MTT/MTS assay BAE Tumor 40% inhibition at 5 µg/ml
dbacp01176 AP ACDCRGDCFCGGGGIVRRADRAAVP Endostatin derived synthetic peptide Necrosis; Antiangiogenesis MTT/MTS assay BAE Tumor 75% inhibition at 10 µg/ml
dbacp01177 AP(O) ACDCRGDCFCGGGGIVRRADRAAVP Endostatin derived synthetic peptide Necrosis; Antiangiogenesis MTT/MTS assay BAE Tumor 40% inhibition at 2.5 µg/ml
dbacp01178 AP(O) ACDCRGDCFCGGGGIVRRADRAAVP Endostatin derived synthetic peptide Necrosis; Antiangiogenesis MTT/MTS assay BAE Tumor 42% inhibition at 5 µg/ml
dbacp01179 AP(O) ACDCRGDCFCGGGGIVRRADRAAVP Endostatin derived synthetic peptide Necrosis; Antiangiogenesis MTT/MTS assay BAE Tumor 52% inhibition at 10 µg/ml
dbacp01255 Aurein 3.1 GLFDIVKKIAGHIAGSI Southern bell frog, Australia Cell membrane disruption Not specified Brain tumor cell line Brain tumor LC50 : 10-100 µM
dbacp01264 Aurein 3.1 GLFDIVKKIAGHIAGSI Southern bell frog, Australia Cell membrane disruption Not specified Brain tumor cell line Brain tumor LC50 : 10-100 µM
dbacp01274 Aurein 3.2 GLFDIVKKIAGHIASSI Southern bell frog, Australia Cell membrane disruption Not specified Brain tumor cell line Brain tumor LC50 : 10 µM
dbacp01284 Aurein 3.3 GLFDIVKKIAGHIVSSI Southern bell frog, Australia Cell membrane disruption Not specified Brain tumor cell line Brain tumor LC50 : 10 µM
dbacp01409 Aurein1.2 GLFDIIKKIAESF Southern bell frog Cell membrane disruption Not specified Brain tumor cell line Brain tumor LC50 : 10 µM
dbacp01418 Aurein2.5 GLFDIVKKVVGAFGSL Southern bell frog Cell membrane disruption Not specified Brain tumor cell line Brain tumor LC50 : 10 µM
dbacp01427 Aurein2.6 GLFDIAKKVIGVIGSL Southern bell frog Cell membrane disruption Not specified Brain tumor cell line Brain tumor LC50 : 10 µM
dbacp01914 BpirLAAO-I ADDKNPLEEFRETNYEVFLEIAKNGLKATSNPKRVVIVGAGMAGLSAAY Venom base Inducing apoptosis MTT assay EAT Erlich ascitic tumor Not found
dbacp01915 BpirLAAO-I ADDKNPLEEFRETNYEVFLEIAKNGLKATSNPKRVVIVGAGMAGLSAAY Venom base Inducing apoptosis MTT assay S180 Tumor Not found
dbacp01916 BPP-II MTLTG Immunomodulatory bursal-derived Pentapeptide-II Inducing apoptosis MTT/MTS assay CEF Tumor Not found
dbacp02012 Buforin IIb RAGLQFPVGRLLRRLLRRLLR Histone H2A Inducing mitochondria-dependent apoptosis MTT/MTS assay SF-268 Brain tumor IC50 : 12.4 µg/ml
dbacp02013 Buforin IIb RAGLQFPVGRLLRRLLRRLLR Histone H2A Inducing mitochondria-dependent apoptosis MTT/MTS assay SF-295 Brain tumor IC50 : 12.9 µg/ml
dbacp02014 Buforin IIb RAGLQFPVGRLLRRLLRRLLR Histone H2A Inducing mitochondria-dependent apoptosis MTT/MTS assay SF-539 Brain tumor IC50 : 9.5 µg/ml
dbacp02015 Buforin IIb RAGLQFPVGRLLRRLLRRLLR Histone H2A Inducing mitochondria-dependent apoptosis MTT/MTS assay SNB-19 Brain tumor IC50 : 13.8 µg/ml
dbacp02016 Buforin IIb RAGLQFPVGRLLRRLLRRLLR Histone H2A Inducing mitochondria-dependent apoptosis MTT/MTS assay SNB-75 Brain tumor IC50 : 15.5 µg/ml
dbacp02017 Buforin IIb RAGLQFPVGRLLRRLLRRLLR Histone H2A Inducing mitochondria-dependent apoptosis MTT/MTS assay U-251 Brain tumor IC50 : 10.6 µg/ml
dbacp02294 Carcinoembryonic antigen glypican-3 GPC3(144-152) FVGEFFTDV Carcinoembryonic antigen glypican-3 GPC3(144-152) Immune response to tumor cell recognition Cytotoxicity assay G-401 Wilm's tumor Not found
dbacp02295 Carcinoembryonic antigen glypican-3 GPC3(144-152) FVGEFFTDV Carcinoembryonic antigen glypican-3 GPC3(144-152) Immune response to tumor cell recognition Cytotoxicity assay SK-N-DZ Wilm's tumor Not found
dbacp02296 Carcinoembryonic antigen glypican-3 GPC3(144-152) FVGEFFTDV Carcinoembryonic antigen glypican-3 GPC3(144-152) Immune response to tumor cell recognition Cytotoxicity assay HuH-6 Wilm's tumor Not found
dbacp02491 Citropin 1.1 GLFDVIKKVASVIGGL Amphibian skin secretions Penetration and disruption of the membranes Sulforhodamine B assay Brain tumor cell line Brain tumor IC50 : 5 M
dbacp02502 Citropin 1.1D glfdvikkvasviggl Amphibian skin secretions Penetration and disruption of the membranes Sulforhodamine B assay Brain tumor cell line Brain tumor IC50 : 5 M
dbacp02693 Dermaseptin-PH (DRS-PH) MDILKKSLFLILFLGVVSLSICEEEKRENEEEMEQDDEQSEMKRALWKEVLKNAGKAALNEINNLVQGGQ Northern orange-legged leaf frog Disruption of cell membranes MTT assay MCF-7 Brain tumor IC50 : 7.44 μM
dbacp02698 Dermaseptin-PH (DRS-PH) MDILKKSLFLILFLGVVSLSICEEEKRENEEEMEQDDEQSEMKRALWKEVLKNAGKAALNEINNLVQGGQ Northern orange-legged leaf frog Disruption of cell membranes MTT assay U251MG Brain tumor IC50 : 49.51 μM
dbacp02703 Dermaseptin-PH (DRS-PH) MDILKKSLFLILFLGVVSLSICEEEKRENEEEMEQDDEQSEMKRALWKEVLKNAGKAALNEINNLVQGGQ Northern orange-legged leaf frog Disruption of cell membranes MTT assay H157 Brain tumor IC50 : 25.51 μM
dbacp02708 Dermaseptin-PH (DRS-PH) MDILKKSLFLILFLGVVSLSICEEEKRENEEEMEQDDEQSEMKRALWKEVLKNAGKAALNEINNLVQGGQ Northern orange-legged leaf frog Disruption of cell membranes MTT assay PC-3 Brain tumor IC50 : 21.78 μM
dbacp02713 Dermaseptin-PH (DRS-PH) MDILKKSLFLILFLGVVSLSICEEEKRENEEEMEQDDEQSEMKRALWKEVLKNAGKAALNEINNLVQGGQ Northern orange-legged leaf frog Disruption of cell membranes MTT assay PANC-1 Brain tumor IC50 : 28.95 μM
dbacp02718 Dermaseptin-PH (DRS-PH) MDILKKSLFLILFLGVVSLSICEEEKRENEEEMEQDDEQSEMKRALWKEVLKNAGKAALNEINNLVQGGQ Northern orange-legged leaf frog Disruption of cell membranes MTT assay HMEC-1 Brain tumor IC50 : 51.04 μM
dbacp02783 dLL-37(17-32)c FKRiVQRiKDFlRNLV LL-37, a series of peptide fragments Cell membrane disintegration MTT/MTS assay KBv Tumor Not found
dbacp02914 ES-2 IVRRADRAAVP Endostatin derived synthetic peptide Necrosis; Anti-angiogenesis MTT/MTS assay BAE Tumor 60% inhibition at 2.5µg/ml
dbacp02915 ES-2 IVRRADRAAVP Endostatin derived synthetic peptide Necrosis; Anti-angiogenesis MTT/MTS assay BAE Tumor 60% inhibition at 5µg/ml
dbacp02916 ES-2 IVRRADRAAVP Endostatin derived synthetic peptide Necrosis; Anti-angiogenesis MTT/MTS assay BAE Tumor 60% inhibition at 10µg/ml
dbacp03297 HHPHG HHPHG Synthetic Peptide Anti-angiogenesis Tropomyosin binding assay Not found Tumor IC50 : 92 µM
dbacp03363 Hα-Defensin HNPs-1 NA Not found Cellular necrosis Cell viability assay RCCs, HLA-DRB1*10301 Tumor Inhibition at 12.5 µg/ml
dbacp03364 Hα-Defensin HNPs-2 NA Not found Cellular necrosis Cell viability assay RCCs, HLA-DRB1*10301 Tumor Inhibition at 12.5 µg/ml
dbacp03365 Hα-Defensin HNPs-3 NA Not found Cellular necrosis Cell viability assay RCCs, HLA-DRB1*10301 Tumor Inhibition at 12.5 µg/ml
dbacp03376 IL-4Rα-lytic hybrid peptide KQLIRFLKRLDRNGGGKLlLKlLkkLLKlLKKK Interleukin-4 receptor a (IL-4Ra) chain Induction of apoptosis WST-1 assay T98G Brain tumor IC50 : 18.5 µMol/L
dbacp03377 IL-4Rα-lytic hybrid peptide KQLIRFLKRLDRNGGGKLlLKlLkkLLKlLKKK Interleukin-4 receptor a (IL-4Ra) chain Induction of apoptosis WST-1 assay A-172 Brain tumor IC50 : 6.8 µMol/L
dbacp03485 K8, 23-DPT9 MDILKKSKFLILFLGVVSLSICKEEKRENEEEMEQDDEQSEMKRALWKEVLKNAGKAALNEINNLVQGGQ Northern orange-legged leaf frog Disruption of cell membranes MTT assay MCF-7 Brain tumor IC50 : 8.64μM
dbacp03490 K8, 23-DPT9 MDILKKSKFLILFLGVVSLSICKEEKRENEEEMEQDDEQSEMKRALWKEVLKNAGKAALNEINNLVQGGQ Northern orange-legged leaf frog Disruption of cell membranes MTT assay U251MG Brain tumor IC50 : 18.51μM
dbacp03495 K8, 23-DPT9 MDILKKSKFLILFLGVVSLSICKEEKRENEEEMEQDDEQSEMKRALWKEVLKNAGKAALNEINNLVQGGQ Northern orange-legged leaf frog Disruption of cell membranes MTT assay H157 Brain tumor IC50 : 9.88μM
dbacp03500 K8, 23-DPT9 MDILKKSKFLILFLGVVSLSICKEEKRENEEEMEQDDEQSEMKRALWKEVLKNAGKAALNEINNLVQGGQ Northern orange-legged leaf frog Disruption of cell membranes MTT assay PC-3 Brain tumor IC50 : 9.97μM
dbacp03505 K8, 23-DPT9 MDILKKSKFLILFLGVVSLSICKEEKRENEEEMEQDDEQSEMKRALWKEVLKNAGKAALNEINNLVQGGQ Northern orange-legged leaf frog Disruption of cell membranes MTT assay PANC-1 Brain tumor IC50 : 11.17μM
dbacp03510 K8, 23-DPT9 MDILKKSKFLILFLGVVSLSICKEEKRENEEEMEQDDEQSEMKRALWKEVLKNAGKAALNEINNLVQGGQ Northern orange-legged leaf frog Disruption of cell membranes MTT assay HMEC-1 Brain tumor IC50 : 48.80μM
dbacp03638 Lactoferricin B FKCRRWQWRMKKLGA Temporins family Inducing mitochondria-dependent apoptosis MTT/MTS assay Kelly Brain tumor IC50 : 15.5 µM
dbacp03639 Lactoferricin B FKCRRWQWRMKKLGA Temporins family Inducing mitochondria-dependent apoptosis MTT/MTS assay IMR-32 Brain tumor IC50 : 29 µM
dbacp03640 Lactoferricin B FKCRRWQWRMKKLGA Temporins family Inducing mitochondria-dependent apoptosis MTT/MTS assay SK-N-DZ Brain tumor IC50 : 37 µM
dbacp03641 Lactoferricin B FKCRRWQWRMKKLGA Temporins family Inducing mitochondria-dependent apoptosis MTT/MTS assay SHEP-12 Brain tumor IC50 : 45 µM
dbacp03642 Lactoferricin B FKCRRWQWRMKKLGA Temporins family Inducing mitochondria-dependent apoptosis MTT/MTS assay SH-SY-5Y2 Brain tumor IC50 : 60 µM
dbacp03732 LfcinB FKCRRWQWRMKK Bovine lactoferrin (Lf-B) Cell membrane disintegration; Regulation of immune response; Apoptosis MTT/MTS assay Kelly Brain tumor IC50 : 141 ± 3 µM
dbacp04155 LL-37(1-12) LLGDFFRKSKEK LL-37,a series of peptide fragments Cell membrane disintegration MTT/MTS assay KBv Tumor Not found
dbacp04158 LL-37(1-4,17-27) LLGDFKRIVQRIKDF LL-37,a series of peptide fragments Cell membrane disintegration MTT/MTS assay KBv Tumor Not found
dbacp04161 LL-37(13-37) IGKEFKRIVQRIKDFLRNLVPRTES LL-37,a series of peptide fragments Cell membrane disintegration MTT/MTS assay KBv Tumor LC50 : 39 µM
dbacp04164 LL-37(13-37)(C-terminal fragment of LL-37; Human, mammals, animals) IGKEFKRIVQRIKDFLRNLVPRTES Human Not specified MTT assay KBv Tumor LC50 : 39 ± 0 μM
dbacp04167 LL-37(17-29) FKRIVQRIKDFLR LL-37,a series of peptide fragments Cell membrane disintegration MTT/MTS assay KBv Tumor LC50 : 60 µM
dbacp04171 LL-37(17-29)(C-terminal fragment of LL-37; Human, mammals, animals) FKRIVQRIKDFLRNLV Human Not specified MTT assay KBv Tumor LC50 : 60 ± 0 μM
dbacp04174 LL-37(17-32)(C-terminal fragment of LL-37; Human, mammals, animals) FKRIVQRIKDFLRNLV Human Not specified MTT assay KBv Tumor LC50 : 30 ± 0 μM
dbacp04177 LL-37(17-32)b FKRIVQRIKDFLRNLV LL-37,a series of peptide fragments Cell membrane disintegration MTT/MTS assay KBv Tumor LC50 : 30 µM
dbacp04298 LTX-302 WKKW-Dip-KKWK Synthetic peptide Cell membrane disintegration MTT/MTS assay Kelly Brain tumor IC50 : 28 ± 0 µM
dbacp04301 LTX-315 KKWWKKW-Dip-K Synthetic peptide Cell membrane disintegration MTT/MTS assay Kelly Brain tumor IC50 : 14 ± 1 µM
dbacp04307 LTX-318 OOW-Dip-OOWWO Synthetic peptide Cell membrane disintegration MTT/MTS assay Kelly Brain tumor IC50 : 78 ± 7 µM
dbacp04350 Lytic KLlLKlLkkLLKlLKKK Interleukin-4 receptor a (IL-4Ra) chain Induction of apoptosis WST-1 assay T98G Brain tumor IC50 : 77.3 µMol/L
dbacp04351 Lytic KLlLKlLkkLLKlLKKK Interleukin-4 receptor a (IL-4Ra) chain Induction of apoptosis WST-1 assay A-172 Brain tumor IC50 : 30.5 µMol/L
dbacp04360 Lytic KLlLKlLkkLLKlLKKK Transferrin receptor (TfR) Disintegration of cell membrane WST-1 assay SF-295 Brain tumor IC50 : 19.1 µM
dbacp04361 Lytic KLlLKlLkkLLKlLKKK Transferrin receptor (TfR) Disintegration of cell membrane WST-1 assay SN-19 Brain tumor IC50 : 21.9 µM
dbacp04362 Lytic KLlLKlLkkLLKlLKKK Transferrin receptor (TfR) Disintegration of cell membrane WST-1 assay U-251 Brain tumor IC50 : 17.0 µM
dbacp04865 NK-2 KILRGVCKKIMRTFLRRISKDILTGKK NK-lysin Cell membrane disintegration PI-uptake assay SH-SY5Y Brain tumor LD50 : 1-4 µM
dbacp05061 P369-CTL-A2xFVB KIFGSLAFL Synthetic Peptide Antiangiogenis; Immune regulation Peptide dose curve assay N202.A2 Tumor 8% Inhibition at 10-10 M
dbacp05062 P369-CTL-A2xFVB KIFGSLAFL Synthetic Peptide Antiangiogenis; Immune regulation Peptide dose curve assay N202.A2 Tumor 25% Inhibition at 10-9 M
dbacp05063 P369-CTL-A2xFVB KIFGSLAFL Synthetic Peptide Antiangiogenis; Immune regulation Peptide dose curve assay N202.A2 Tumor 80% Inhibition at 10-8 M
dbacp05064 P369-CTL-A2xFVB KIFGSLAFL Synthetic Peptide Antiangiogenis; Immune regulation Peptide dose curve assay N202.A2 Tumor 85% Inhibition at 10-7 M
dbacp05065 P369-CTL-A2xFVB KIFGSLAFL Synthetic Peptide Antiangiogenis; Immune regulation Peptide dose curve assay N202.A2 Tumor 92% Inhibition at 10-6 M
dbacp05066 P369-CTL-A2xneu KIFGSLAFL Synthetic Peptide Antiangiogenis; Immune regulation Peptide dose curve assay N202.A2 Tumor 0.1% Inhibition at 10-10 M
dbacp05067 P369-CTL-A2xneu KIFGSLAFL Synthetic Peptide Antiangiogenis; Immune regulation Peptide dose curve assay N202.A2 Tumor 1% Inhibition at 10-9 M
dbacp05068 P369-CTL-A2xneu KIFGSLAFL Synthetic Peptide Antiangiogenis; Immune regulation Peptide dose curve assay N202.A2 Tumor 5% Inhibition at 10-8 M
dbacp05069 P369-CTL-A2xneu KIFGSLAFL Synthetic Peptide Antiangiogenis; Immune regulation Peptide dose curve assay N202.A2 Tumor 10% Inhibition at 10-7 M
dbacp05070 P369-CTL-A2xneu KIFGSLAFL Synthetic Peptide Antiangiogenis; Immune regulation Peptide dose curve assay N202.A2 Tumor 20% Inhibition at 10-6 M
dbacp05098 p776 GVGSPYVSRLLGICL Synthetic Peptide Inducing apoptosis ELISPOT assay Not found Tumor Not found
dbacp05102 p85 LIAHNQVRQV Synthetic Peptide Inducing apoptosis ELISPOT assay Not found Tumor Not found
dbacp05825 R8-BadBH3 rrrrrrrrGNLWAAQRYGRELRRMSDEFVDSFKK Synthetic Peptide Inducing mitochondrial apoptosis MTT/MTS assay SK-N-AS Brain tumor 0% apoptosis at 10 µM
dbacp05826 R8-BadBH3 rrrrrrrrGNLWAAQRYGRELRRMSDEFVDSFKK Synthetic Peptide Inducing mitochondrial apoptosis MTT/MTS assay SK-N-AS Brain tumor 10% apoptosis at 20 µM
dbacp05827 R8-BadBH3 rrrrrrrrGNLWAAQRYGRELRRMSDEFVDSFKK Synthetic Peptide Inducing mitochondrial apoptosis MTT/MTS assay SK-N-AS Brain tumor 30% apoptosis at 50 µM
dbacp05828 R8-BadBH3 rrrrrrrrGNLWAAQRYGRELRRMSDEFVDSFKK Synthetic Peptide Inducing mitochondrial apoptosis MTT/MTS assay NB69 Brain tumor 30% apoptosis at 10 µM
dbacp05829 R8-BadBH3 rrrrrrrrGNLWAAQRYGRELRRMSDEFVDSFKK Synthetic Peptide Inducing mitochondrial apoptosis MTT/MTS assay NB69 Brain tumor 80% apoptosis at 20 µM
dbacp05830 R8-BadBH3 rrrrrrrrGNLWAAQRYGRELRRMSDEFVDSFKK Synthetic Peptide Inducing mitochondrial apoptosis MTT/MTS assay NB69 Brain tumor 80% apoptosis at 50 µM
dbacp05831 R8-BadBH3 rrrrrrrrGNLWAAQRYGRELRRMSDEFVDSFKK Synthetic Peptide Inducing mitochondrial apoptosis MTT/MTS assay NGP Tumor 20% apoptosis at 10 µM
dbacp05832 R8-BadBH3 rrrrrrrrGNLWAAQRYGRELRRMSDEFVDSFKK Synthetic Peptide Inducing mitochondrial apoptosis MTT/MTS assay NGP Tumor > 50% apoptosis at 20 µM
dbacp05833 R8-BadBH3 rrrrrrrrGNLWAAQRYGRELRRMSDEFVDSFKK Synthetic Peptide Inducing mitochondrial apoptosis MTT/MTS assay NGP Tumor 30% apoptosis at 50 µM
dbacp05834 R8-BadBH3 rrrrrrrrGNLWAAQRYGRELRRMSDEFVDSFKK Synthetic Peptide Inducing mitochondrial apoptosis MTT/MTS assay IMR5 Tumor 15% apoptosis at 10 µM
dbacp05835 R8-BadBH3 rrrrrrrrGNLWAAQRYGRELRRMSDEFVDSFKK Synthetic Peptide Inducing mitochondrial apoptosis MTT/MTS assay IMR5 Tumor 20% apoptosis at 20 µM
dbacp05836 R8-BadBH3 rrrrrrrrGNLWAAQRYGRELRRMSDEFVDSFKK Synthetic Peptide Inducing mitochondrial apoptosis MTT/MTS assay IMR5 Tumor 50% apoptosis at 50 µM
dbacp05839 R8-BidBH3 rrrrrrrrGEDIIRNIARHLAQVGDSMDR Synthetic Peptide Inducing mitochondrial apoptosis MTT/MTS assay SK-N-AS Brain tumor 8% apoptosis at 10 µM
dbacp05840 R8-BidBH3 rrrrrrrrGEDIIRNIARHLAQVGDSMDR Synthetic Peptide Inducing mitochondrial apoptosis MTT/MTS assay SK-N-AS Brain tumor 45% apoptosis at 20 µM
dbacp05841 R8-BidBH3 rrrrrrrrGEDIIRNIARHLAQVGDSMDR Synthetic Peptide Inducing mitochondrial apoptosis MTT/MTS assay SK-N-AS Brain tumor 65% apoptosis at 50 µM
dbacp05842 R8-BidBH3 rrrrrrrrGEDIIRNIARHLAQVGDSMDR Synthetic Peptide Inducing mitochondrial apoptosis MTT/MTS assay NB69 Brain tumor 25% apoptosis at 10 µM
dbacp05843 R8-BidBH3 rrrrrrrrGEDIIRNIARHLAQVGDSMDR Synthetic Peptide Inducing mitochondrial apoptosis MTT/MTS assay NB69 Brain tumor 66% apoptosis at 20 µM
dbacp05844 R8-BidBH3 rrrrrrrrGEDIIRNIARHLAQVGDSMDR Synthetic Peptide Inducing mitochondrial apoptosis MTT/MTS assay NB69 Brain tumor 68% apoptosis at 50 µM
dbacp05845 R8-BidBH3 rrrrrrrrGEDIIRNIARHLAQVGDSMDR Synthetic Peptide Inducing mitochondrial apoptosis MTT/MTS assay NGP Tumor 43% apoptosis at 10 µM
dbacp05846 R8-BidBH3 rrrrrrrrGEDIIRNIARHLAQVGDSMDR Synthetic Peptide Inducing mitochondrial apoptosis MTT/MTS assay NGP Tumor 46% apoptosis at 20 µM
dbacp05847 R8-BidBH3 rrrrrrrrGEDIIRNIARHLAQVGDSMDR Synthetic Peptide Inducing mitochondrial apoptosis MTT/MTS assay NGP Tumor 79% apoptosis at 50 µM
dbacp05848 R8-BidBH3 rrrrrrrrGEDIIRNIARHLAQVGDSMDR Synthetic Peptide Inducing mitochondrial apoptosis MTT/MTS assay IMR5 Tumor 23% apoptosis at 10 µM
dbacp05849 R8-BidBH3 rrrrrrrrGEDIIRNIARHLAQVGDSMDR Synthetic Peptide Inducing mitochondrial apoptosis MTT/MTS assay IMR5 Tumor 35% apoptosis at 20 µM
dbacp05850 R8-BidBH3 rrrrrrrrGEDIIRNIARHLAQVGDSMDR Synthetic Peptide Inducing mitochondrial apoptosis MTT/MTS assay IMR5 Tumor 55% apoptosis at 50 µM
dbacp05851 R8-BidBH3Alt rrrrrrrrGEDIIRNIARHAAQVGASMDR Synthetic Peptide Inducing mitochondrial apoptosis MTT/MTS assay SK-N-AS Brain tumor 1% apoptosis at 10 µM
dbacp05852 R8-BidBH3Alt rrrrrrrrGEDIIRNIARHAAQVGASMDR Synthetic Peptide Inducing mitochondrial apoptosis MTT/MTS assay SK-N-AS Brain tumor 2% apoptosis at 20 µM
dbacp05853 R8-BidBH3Alt rrrrrrrrGEDIIRNIARHAAQVGASMDR Synthetic Peptide Inducing mitochondrial apoptosis MTT/MTS assay SK-N-AS Brain tumor 3% apoptosis at 50 µM
dbacp05854 R8-BidBH3Alt rrrrrrrrGEDIIRNIARHAAQVGASMDR Synthetic Peptide Inducing mitochondrial apoptosis MTT/MTS assay NB69 Brain tumor 2% apoptosis at 10 µM
dbacp05855 R8-BidBH3Alt rrrrrrrrGEDIIRNIARHAAQVGASMDR Synthetic Peptide Inducing mitochondrial apoptosis MTT/MTS assay NB69 Brain tumor 1% apoptosis at 20 µM
dbacp05856 R8-BidBH3Alt rrrrrrrrGEDIIRNIARHAAQVGASMDR Synthetic Peptide Inducing mitochondrial apoptosis MTT/MTS assay NB69 Brain tumor 5% apoptosis at 50 µM
dbacp05857 R8-BidBH3Alt rrrrrrrrGEDIIRNIARHAAQVGASMDR Synthetic Peptide Inducing mitochondrial apoptosis MTT/MTS assay NGP Tumor 1% apoptosis at 10 µM
dbacp05858 R8-BidBH3Alt rrrrrrrrGEDIIRNIARHAAQVGASMDR Synthetic Peptide Inducing mitochondrial apoptosis MTT/MTS assay NGP Tumor 2% apoptosis at 20 µM
dbacp05859 R8-BidBH3Alt rrrrrrrrGEDIIRNIARHAAQVGASMDR Synthetic Peptide Inducing mitochondrial apoptosis MTT/MTS assay NGP Tumor 3% apoptosis at 50 µM
dbacp05860 R8-BidBH3Alt rrrrrrrrGEDIIRNIARHAAQVGASMDR Synthetic Peptide Inducing mitochondrial apoptosis MTT/MTS assay IMR5 Tumor 0% apoptosis at 10 µM
dbacp05861 R8-BidBH3Alt rrrrrrrrGEDIIRNIARHAAQVGASMDR Synthetic Peptide Inducing mitochondrial apoptosis MTT/MTS assay IMR5 Tumor 1% apoptosis at 20 µM
dbacp05862 R8-BidBH3Alt rrrrrrrrGEDIIRNIARHAAQVGASMDR Synthetic Peptide Inducing mitochondrial apoptosis MTT/MTS assay IMR5 Tumor 2% apoptosis at 50 µM
dbacp05937 Retro LGGIVSAVKKIVDFLG Amphibian skin secretions Penetration and disruption of the membranes Sulforhodamine B assay Brain tumor cell line Brain tumor IC50 : 5 M
dbacp05962 RGD-mda-7 MNFQQRLQSLWTLARPFCPPLLATASQMQMVVLPCLGFTLLLWSQVSGAQGQEFHFGPCQVKGVVPQKLWEAFWAVKDTMQAQDNITSARLLQQEVLQNVSDAESCYLVHTLLEFYLKTVFKNYHNRTVEVRTLKSFSTLANNFVLIVSQLQPSQENEMFSIRGDSAHRRFLLFRRAFKQLDVEAALTKALGEVDILLTWMQKFYKL Derived from wtmda-7/IL-24 by insertion or a glycine residue between Arg(164) and Asp(165). Apoptosis inducing MTT/MTS assay Ket-3 Tumor Cell viability(% of control): 0.5 at concentration 8 µg/ml
dbacp05964 RGD-mda-7 MNFQQRLQSLWTLARPFCPPLLATASQMQMVVLPCLGFTLLLWSQVSGAQGQEFHFGPCQVKGVVPQKLWEAFWAVKDTMQAQDNITSARLLQQEVLQNVSDAESCYLVHTLLEFYLKTVFKNYHNRTVEVRTLKSFSTLANNFVLIVSQLQPSQENEMFSIRDSAHRRFLLFRRAFKQL Derived from wtmda-7/IL-24 by insertion or a glycine residue between Arg(164) and Asp(165). Apoptosis inducing MTT/MTS assay Ket-3 Tumor Apoptotic rate(%): >50% at concentration of 8 µg/ml
dbacp06335 Transferrin receptor (TfR)-lytic hybrid peptide THRPPMWSPVWPGGGKLlLKlLkkLLKlLKKK Transferrin receptor (TfR) Disintegration of cell membrane WST-1 assay SF-295 Brain tumor IC50 : 6.3 µM
dbacp06336 Transferrin receptor (TfR)-lytic hybrid peptide THRPPMWSPVWPGGGKLlLKlLkkLLKlLKKK Transferrin receptor (TfR) Disintegration of cell membrane WST-1 assay SN-19 Brain tumor IC50 : 7.8 µM
dbacp06337 Transferrin receptor (TfR)-lytic hybrid peptide THRPPMWSPVWPGGGKLlLKlLkkLLKlLKKK Transferrin receptor (TfR) Disintegration of cell membrane WST-1 assay U-251 Brain tumor IC50 :7.0 µM
dbacp06364 TsAP-2 FLGMIPGLIGGLISAFK Venom-derived cDNAlibrary of the Brazilian yellow scorpion Not specified MTT/MTS assay U251-MG Brain tumor IC50 : 15.4 µM
dbacp06372 TsAP-S1 FLSLIPKLVKKIIKAFK Derivative of TsAP-1, Brazilian yellow scorpion venom peptide Not specified MTT/MTS assay U251-MG Brain tumor IC50 : 2.9 µM
dbacp06380 TsAP-S2 FLGMIPKLIKKLIKAFK Derivative of TsAP-1, Brazilian yellow scorpion venom peptide Not specified MTT/MTS assay U251-MG Brain tumor IC50 : 2.0 µM
dbacp06535 wtmda-7/IL-24 MNFQQRLQSLWTLARPFCPPLLATASQMQMVVLPCLGFTLLLWSQVSGAQGQEFHFGPCQVKGVVPQKLWEAFWAVKDTMQAQDNITSARLLQQEVLQNVSDAESCYLVHTLLEFYLKTVFKNYHNRTVEVRTLKSFSTLANNFVLIVSQLQPSQENEMFSIRDSAHRRFLLFRRAFKQL Not found Apoptosis inducing MTT/MTS assay Ket-3 Tumor Cell viability (% of control): 0.5 at concentration 8 µg/ml
dbacp06537 wtmda-7/IL-24 MNFQQRLQSLWTLARPFCPPLLATASQMQMVVLPCLGFTLLLWSQVSGAQGQEFHFGPCQVKGVVPQKLWEAFWAVKDTMQAQDNITSARLLQQEVLQNVSDAESCYLVHTLLEFYLKTVFKNYHNRTVEVRTLKSFSTLANNFVLIVSQLQPSQENEMFSIRDSAHRRFLLFRRAFKQL Not found Apoptosis inducing MTT/MTS assay Ket-3 Tumor Apoptotic rate(%) : > 30% at concentration of 8 µg/ml
dbacp06576 Z44 ALSKALSKALSKALSKALSKALSK African clawed frog Dissipate ion gradients;Induce osmotic lysis; Membrane damage Trypan blue assay Daudi Brain tumor IC50 : 115 µg/ml
dbacp06671 Crabrolin FLPLILRKIVTAL European hornet (Vespa crabro) Not available MTT assay U-251-MG Brain Tumor IC50 = 20.13 μM
dbacp06676 Crabrolin-4R FLPRILRKIVTAL Synthetic Analog of Crabrolin Not available MTT assay U-251-MG Brain Tumor IC50 = 25.09 μM
dbacp06681 Crabrolin-4K FLPKILRKIVTAL Synthetic Analog of Crabrolin Not available MTT assay U-251-MG Brain Tumor IC50 = 23.51 μM
dbacp06686 Crabrolin-TR FLPRILRKIVRAL Synthetic Analog of Crabrolin Not available MTT assay U-251-MG Brain Tumor IC50 = 12.40 μM
dbacp06691 Crabrolin-FR RLPRILRKIVRAL Synthetic Analog of Crabrolin Not available MTT assay U-251-MG Brain Tumor IC50 = 62.17 μM
dbacp06696 Crabrolin-AR RLPRILRKIVRRL Synthetic Analog of Crabrolin Not available MTT assay U-251-MG Brain Tumor IC50 = 52.01 μM
dbacp06701 Crabrolin-PR RLRRILRKIVRRL Synthetic Analog of Crabrolin Not available MTT assay U-251-MG Brain Tumor IC50 = 17.70 μM
dbacp06750 mPNC-NLS QETFSDLWKLLVQRKRQKLMP Synthetic p53-mediated apoptosis MTT assay U-87 Brain Tumor IC50 = 56.9 μM
dbacp06769 M1-21 rrrqrrkkrg-QTQPRLGPPQTPAGGCSILIF Synthetic FOXM1 inhibitor Cell Viability assay U-251 BrainTumor IC50 = 18.17 µM
dbacp07006 ST101 vaeareelerlearlgqargelkkwkmrrnqfwlklqr Synthetic Prevents C/EBPβ dimerization, induces degradation Annexin V/ PI staining assay U-251 Brain Tumor mean EC50 value of 2.1 ± 0.4 μmol/L
dbacp07011 ST101 vaeareelerlearlgqargelkkwkmrrnqfwlklqr Synthetic Prevents C/EBPβ dimerization, induces degradation Annexin V/ PI staining assay T98G Brain Tumor mean EC50 value of 2.1 ± 0.4 μmol/L
dbacp07050 Temporin-PKE FLPLIIGALSSLLPKIF skin secretion of Pelophylax kl. esculentus Charge-optimized membranolysis induces apoptosis. MTT assay U251-MG Brain Tumor IC50 = 23.24 μM
dbacp07055 Temporin-PKE-2K FLPLIIGKLSSLLPKIF Synthetic Charge-optimized membranolysis induces apoptosis. MTT assay U251-MG Brain Tumor IC50 = 2.49 μM
dbacp07060 Temporin-PKE-K12 FLPLIIGALSSKLPKIF Synthetic Charge-optimized membranolysis induces apoptosis. MTT assay U251-MG Brain Tumor IC50 = 25.75 μM
dbacp07065 Temporin-PKE-3K FLPKIIGKLSSLLPKIF Synthetic Charge-optimized membranolysis induces apoptosis. MTT assay U251-MG Brain Tumor IC50 = 2.83 μM
dbacp07070 Temporin-PKE-4K FLPKIIGKLSSKLPKIF Synthetic Charge-optimized membranolysis induces apoptosis. MTT assay U251-MG Brain Tumor IC50 = 85.52 μM
dbacp07075 Temporin-PKE-i FLPLIIGALSSLLPKiF Synthetic Charge-optimized membranolysis induces apoptosis. MTT assay U251-MG Brain Tumor IC50 = 4.46 μM
dbacp07080 Temporin-PKE-3i FLPLiiGALSSLLPKiF Synthetic Charge-optimized membranolysis induces apoptosis. MTT assay U251-MG Brain Tumor IC50 = 120.6 μM
dbacp07109 Nigrocin-M1 GLLGKILGAGKKVLLGVSGLL Synthetic Membrane disruption mediates selective cytotoxicity. MTT assay U-251-MG Brain Tumor IC50 = 25.06 μM
dbacp07241 RB4 MADSERLSAPGCWAACTNFSRTRK Derived from protein PLP2 F-actin modulation induces necrotic death. MTT assay U-87 Brain Tumor EC50 = 0.427 ± 0.053 mol/L × 10-3
dbacp07246 ATX-101 MDRWLVKWKKKRKIRRRRRRRRRRR Synthetic PCNA interference disrupts DNA repair. CCK-8 assay U87-MG Brain Tumor IC50 = 4.3 ± 0.3 μM
dbacp07247 ATX-101 MDRWLVKWKKKRKIRRRRRRRRRRR Synthetic PCNA interference disrupts DNA repair. CCK-8 assay U-251 Brain Tumor IC50 = 4.9 ± 0.3 μM
dbacp07248 ATX-101 MDRWLVKWKKKRKIRRRRRRRRRRR Synthetic PCNA interference disrupts DNA repair. CCK-8 assay A-172 Brain Tumor IC50 = 6.4 ± 0.4 μM
dbacp07249 ATX-101 MDRWLVKWKKKRKIRRRRRRRRRRR Synthetic PCNA interference disrupts DNA repair. CCK-8 assay T98G Brain Tumor IC50 = 7.1 ± 0.2 μM
dbacp07250 ATX-101 MDRWLVKWKKKRKIRRRRRRRRRRR Synthetic PCNA interference disrupts DNA repair. CCK-8 assay U-373 Brain Tumor IC50 = 5.0 ± 0.2 μM
dbacp07251 ATX-101 MDRWLVKWKKKRKIRRRRRRRRRRR Synthetic PCNA interference disrupts DNA repair. CCK-8 assay U-118 Brain Tumor IC50 = 6.8 ± 0.2 μM
dbacp07252 ATX-101 MDRWLVKWKKKRKIRRRRRRRRRRR Synthetic PCNA interference disrupts DNA repair. CCK-8 assay D54 Brain Tumor IC50 = 8.4 ± 0.1 μM
dbacp07253 ATX-101 MDRWLVKWKKKRKIRRRRRRRRRRR Synthetic PCNA interference disrupts DNA repair. CCK-8 assay SW-1783 Brain Tumor IC50 = 4.8 ± 0.2 μM
dbacp07254 ATX-101 MDRWLVKWKKKRKIRRRRRRRRRRR Synthetic PCNA interference disrupts DNA repair. CCK-8 assay LN229 Brain Tumor IC50 = 4.7 ± 0.2 μM
dbacp07255 ATX-101 MDRWLVKWKKKRKIRRRRRRRRRRR Synthetic PCNA interference disrupts DNA repair. CCK-8 assay U-138 Brain Tumor IC50 = 7.5 ± 0.3 μM
dbacp07256 ATX-101 MDRWLVKWKKKRKIRRRRRRRRRRR Synthetic PCNA interference disrupts DNA repair. CCK-8 assay SF-268 Brain Tumor IC50 = 4.8 ± 0.1 μM
dbacp07257 ATX-101 MDRWLVKWKKKRKIRRRRRRRRRRR Synthetic PCNA interference disrupts DNA repair. CCK-8 assay SNB-19 Brain Tumor IC50 = 12.0 ± 0.6 μM
dbacp07262 t-DPH1-K4 GLWKKIKNVAAAAGKAALGAL Analogue of t-DPH1 Membrane disruption induces apoptotic signaling. MTT assay U251-MG Brain Tumor IC50 = 32.18 μM
dbacp07266 t-DPH1-5K GLWKKIKNVAKAAGKAALGAL Analogue of t-DPH1 Membrane disruption induces apoptotic signaling. MTT assay U251-MG Brain Tumor IC50 = 2.679 μM
dbacp07270 t-DPH1-6K GLWKKIKNVAKAAGKAAKGAL Analogue of t-DPH1 Membrane disruption induces apoptotic signaling. MTT assay U251-MG Brain Tumor IC50 = 593.7 μM
dbacp07274 t-DPH1-6KW WLWKKIKNVAKAAGKAAKGAL Analogue of t-DPH1 Membrane disruption induces apoptotic signaling. MTT assay U251-MG Brain Tumor IC50 = 1499 μM
dbacp07314 B1OS-L FLPLIASLAGNVVPKIFCKITKRC B-1OS Not Available MTT assay U251-MG Brain Tumor IC50 = 8.629 µM
dbacp07319 B1OS-D-L FlPLIASLAGNVVPKIFCKITKRC B-1OS Not Available MTT assay U251-MG Brain Tumor IC50 = 3.492 µM
dbacp07408 Dermaseptin-TO ALWKDLLKNVGIAAGKAALNKVTDMVNQ Phyllomedusa tomopterna Membrane disruption induces cell death MTT assay U251-MG Brain Tumor Graph Figure-7
dbacp07439 A4K14 - Citropin 1.1 - Sp 7 GLFAVR8KKVASVS5KGL Synthetic Stapled peptide enhances helical apoptosis CCK-8 assay U-87 Brain Tumor IC50 = 14.72 µM
dbacp07443 A4K14 - Citropin 1.1 - Sp 6 GR8FAVIKKS5ASVIKGL Synthetic Stapled peptide enhances helical apoptosis CCK-8 assay U-87 Brain Tumor IC50 = 34.49 µM
dbacp07447 A4K14 - Citropin 1.1 - Sp 5 GLFAVIKKVAS5VIKS5L Synthetic Stapled peptide enhances helical apoptosis CCK-8 assay U-87 Brain Tumor IC50 = 8.229 µM
dbacp07451 A4K14 - Citropin 1.1 - Sp 4 GLFAVIKKS5ASVS5KGL Synthetic Stapled peptide enhances helical apoptosis CCK-8 assay U-87 Brain Tumor IC50 = 7.277 µM
dbacp07455 A4K14 - Citropin 1.1 - Sp 3 GLFAVS5KKVS5SVIKGL Synthetic Stapled peptide enhances helical apoptosis CCK-8 assay U-87 Brain Tumor IC50 = 11.93 µM
dbacp07459 A4K14 - Citropin 1.1 - Sp 2 GLFAS5IKKS5ASVIKGL Synthetic Stapled peptide enhances helical apoptosis CCK-8 assay U-87 Brain Tumor IC50 = 14.76 µM
dbacp07463 A4K14 - Citropin 1.1 - Sp 1 GS5FAVS5KKVASVIKGL Synthetic Stapled peptide enhances helical apoptosis CCK-8 assay U-87 Brain Tumor IC50 = 11.88 µM
dbacp07494 RA-3 RWrGGGGGLFDIIKKIAESF Synthetic Integrin-targeting, α-helix mediated lysis MTT assay U87-MG Brain Tumor IC50 = 32.27 μM
dbacp07515 Dermaseptin-PP ALWKDMLKGIGKLAGKAALGAVKTLV Phyllomedusa palliata Membrane disruption triggers dual apoptosis MTT assay U-251 Brain Tumor IC50 = 2.47 μM
dbacp07649 AP1-Z1 FLFSLIPHAISGLISAFK AcrAP1 from the venom of the Arabian scorpion Charge–hydrophobicity balance drives apoptosis MTT assay U-87 Brain Tumor IC50 = 10.21 μM
dbacp07652 AP1-Z5a FLFKLIPKAIKGLIKAFK Mutant of APR-Z1 Charge–hydrophobicity balance drives apoptosis MTT assay U-87 Brain Tumor Graph Figure 2C
dbacp07655 AP1-Z5b FLFKLIKHAIKGLIKAFK Mutant of APR-Z1 Charge–hydrophobicity balance drives apoptosis MTT assay U-87 Brain Tumor IC50 = 3.115 μM
dbacp07658 AP1-Z3a FLFSLIKHAIKGLISAFK Mutant of APR-Z1 Charge–hydrophobicity balance drives apoptosis MTT assay U-87 Brain Tumor Graph Figure 2C
dbacp07661 AP1-Z3b FLFSLIKHAISKLISAFK Mutant of APR-Z1 Charge–hydrophobicity balance drives apoptosis MTT assay U-87 Brain Tumor Graph Figure 2C
dbacp07664 AP1-Z7 FLFKLIKKAIKKLIKAFK Mutant of APR-Z1 Charge–hydrophobicity balance drives apoptosis MTT assay U-87 Brain Tumor Graph Figure 2C
dbacp07667 AP1-Z9 FLFKLIKKKIKKLIKKFK Mutant of APR-Z1 Charge–hydrophobicity balance drives apoptosis MTT assay U-87 Brain Tumor Graph Figure 2C
dbacp07850 Dermaseptin-PT9 GLWSKIKDAAKTAGKAALGFVNEMV Phyllomedusa tarsius Membrane disruption and cationic enhancement MTT assay U251-MG Brain Tumor IC50 = 49.51 µM
dbacp07855 K8, 23-DPT9 GLWSKIKKAAKTAGKAALGFVNKMV Synthetic Membrane disruption and cationic enhancement MTT assay U251-MG Brain Tumor IC50 = 18.51 µM
dbacp07934 LyeTx-I-b IWLTALKFLGKNLGKLAKQQLAKL Synthetic Membrane disruption, necroptosis, limited apoptosis MTT/Resazurin dye assay U-87-MG Brain Tumor IC50 = 29.20 ± 7.96 µM
dbacp07935 LyeTx-I-b IWLTALKFLGKNLGKLAKQQLAKL Synthetic Membrane disruption, necroptosis, limited apoptosis MTT/Resazurin dye assay U-373-MG Brain Tumor IC50 = 20.94 ± 5.18 µM
dbacp07936 LyeTx-I-b IWLTALKFLGKNLGKLAKQQLAKL Synthetic Membrane disruption, necroptosis, limited apoptosis MTT/Resazurin dye assay SH-SY5Y Brain Tumor IC50 = 93.80 ± 2.17 µM
dbacp07954 S-24-R2PLx GIMDTVKNAAKNLAGQLLDKLKCSITAC Synthetic Analogue of Ranatuerin-2PLx R2PLx induces caspase-dependent apoptosis MTT assay U-251-MG Brain Tumor IC50 = 278.30 µM
dbacp08022 Peptide4 Gonearrestide ADAPGNYPLDARGKSYYC Androctonus australis Gonearrestide induces G1 cell-cycle arrest MTT assay U-251 Brain tumor Not Available
dbacp08027 Peptide6 Gonearrestide KLSAIISKIRDE Androctonus australis Gonearrestide induces G1 cell-cycle arrest MTT assay U-251 Brain tumor Not Available
dbacp08032 Peptide10 Gonearrestide NDADKDEMQSVYRGKANDDNSRGSKTNHRF Androctonus mauritanicus Gonearrestide induces G1 cell-cycle arrest MTT assay U-251 Brain tumor Not Available
dbacp08037 Peptide13 Gonearrestide WCYKLPDRVSIKEKGRCN Androctonus mauritanicus Gonearrestide induces G1 cell-cycle arrest MTT assay U-251 Brain tumor Not Available
dbacp08044 Silk Fibroin peptide Not Available Silkworm Cocoons SFP induces S-phase cell-cycle arrest MTT assay LN229 Brain Tumor IC50 = 13.32 ± 1.15 mg/ml
dbacp08065 Temporin-PE FLPIVAKLLSGLL Pelophylax kl. esculentus Modulates membrane interactions MTT assay U251-MG Brain Tumor IC50 = 25.13 μM
dbacp08069 temporin-PEa FLYIVAKLLSGLL Synthetic analog of Temporin-PE Modulates membrane interactions MTT assay U251-MG Brain Tumor IC50 = 3.520 μM
dbacp08073 temporin-PEb FLPIVAKLLSGLLGRKKRRQRRR Synthetic analog of Temporin-PE Modulates membrane interactions MTT assay U251-MG Brain Tumor IC50 = 3.087 μM
dbacp08078 APETx4 GTTCYCGKTIGIYWFGKYSCPTNRGYTGSCPYFLGICCYPVD Anthopleura elegantissima Not Available CellTox Green Dye assay SH-SY5Y Brain Tumor Green object count = 400 /mm2 at 20 μM
dbacp08272 [Lys5,6] TG UGLUKKLUGI Trichogin GA Not Available MTT assay T-67 Brain Tumor EC50 = 7 µM
dbacp08274 [Lys6] TG UGLUGKLUGI Trichogin GA Not Available MTT assay T-67 Brain Tumor EC50 = 4 µM
dbacp08276 Trichogin GA UGLUGGLUGI Trichoderma longibrachiatum Not Available MTT assay T-67 Brain Tumor EC50 = 2 µM
dbacp08278 [TOAC1] TG XGLUGGLUGI Trichogin GA Not Available MTT assay T-67 Brain Tumor EC50 = 1 µM
dbacp08280 [TOAC1, Lys6] TG XGLUGKLUGI Trichogin GA Not Available MTT assay T-67 Brain Tumor EC50 = 1 µM
dbacp08282 [Arg2] TG URLUGGLUGI Trichogin GA Not Available MTT assay T-67 Brain Tumor EC50 = 8 µM
dbacp08284 [TOAC1, Arg2] TG XRLUGGLUGI Trichogin GA Not Available MTT assay T-67 Brain Tumor EC50 = 8 µM
dbacp08286 [TOAC1, Arg9] TG XGLUGGLURI Trichogin GA Not Available MTT assay T-67 Brain Tumor EC50 = 8 µM
dbacp08288 [TOAC1, Lys5,6] TG XGLUKKLUGI Trichogin GA Not Available MTT assay T-67 Brain Tumor EC50 = 10 µM
dbacp08290 [TOAC1, Api4] TG XGLZGGLUGI Trichogin GA Not Available MTT assay T-67 Brain Tumor EC50 = 13 µM
dbacp08294 CA4 CGPCFTTDHNMARKCDECCGGKGRGKCFGPQCLCR Synthetic Not Available MTT assay U-251 Brain Tumor Graph Figure 2
dbacp08295 CTX-23 VCMPCFTTDQQMARKCSDCCGGKGRGKCYGPQCLCR Synthetic Not Available MTT assay U-251 Brain Tumor Graph Figure 2