dbACP: A Comprehensive Database of Anti-Cancer Peptides

109 result(s) have been found!

Accession Name Sequence Source/Organism Mechanism Assay Type Cell Line Cancer Type Activity
dbacp02819 Dual-functional peptide LPLTPLP LPLTPLP Not found Inducing apoptosis CCK-8 assay A549 Lung cancer IC50 : 0.00022 M
dbacp02820 Dual-functional peptide LPLTPLP LPLTPLP Not found Inducing apoptosis CCK-8 assay WI-38 Lung cancer IC50 : 0.035 M
dbacp04337 LVTX-8 IWLTALKFLGKNLGKHLAKQQLSKL-NH2 True tarantula Promote apoptosis; Inhibits the proliferation and migration of lung cancer cells both in vitro and in vivo CCK-8 assay, Flow cytometry, Colony formation assay, Transwell invasion and migration assay A549 Lung cancer IC50 : approx. 8 µM
dbacp04338 LVTX-8 IWLTALKFLGKNLGKHLAKQQLSKL-NH2 True tarantula Promote apoptosis; Inhibits the proliferation and migration of lung cancer cells both in vitro and in vivo CCK-8 assay, Flow cytometry, Colony formation assay, Transwell invasion and migration assay H461 Lung cancer IC50 : approx. 8 µM
dbacp04339 LVTX-9 ASIGALIQKAIALIKAKAA-NH2 True tarantula Promote apoptosis; Inhibits the proliferation and migration of lung cancer cells both in vitro and in vivo CCK-8 assay, Flow cytometry, Colony formation assay, Transwell invasion and migration assay A549 Lung cancer IC50 : approx. 8 µM
dbacp04340 LVTX-9 ASIGALIQKAIALIKAKAA-NH2 True tarantula Promote apoptosis; Inhibits the proliferation and migration of lung cancer cells both in vitro and in vivo CCK-8 assay, Flow cytometry, Colony formation assay, Transwell invasion and migration assay H460 Lung cancer IC50 : approx. 8 µM
dbacp04698 MP06 LAVISWKCQEWNSLWKKRKRKT Green algae Apoptosis inducing CCK-8 assay MRC5 Lung cancer IC50 : 10 μM
dbacp06058 Sepia ink oligopeptide (SIO) QPK Not found Inducing apoptosis CCK-8 assay DU-145 Prostate cancer IC50 : < 5 mg/mL
dbacp06059 Sepia ink oligopeptide (SIO) QPK Not found Inducing apoptosis CCK-8 assay PC-3 Prostate cancer IC50 : < 5 mg/mL
dbacp06060 Sepia ink oligopeptide (SIO) QPK Not found Inducing apoptosis CCK-8 assay LNCaP Prostate cancer IC50 : < 10 mg/mL
dbacp06208 TAT-DV3-BH3 YGRKKRRQRRRGGGLGASWHRPDKGGGGLRRMADDLNAQY BH3-only, Direct activators (PUMA, Bid) Inducing apoptosis CCK-8 assay HCT116p53–/– Colon cancer Survival rate : 32.19 ± 6.42%
dbacp06209 TAT-DV3-BH3 YGRKKRRQRRRGGGLGASWHRPDKGGGGLRRMADDLNAQY BH3-only, Direct activators (PUMA, Bid) Inducing apoptosis CCK-8 assay HCT116p53+/+ Colon cancer Survival rate : 34.28 ± 8.93%
dbacp06210 TAT-DV3-BH3 YGRKKRRQRRRGGGLGASWHRPDKGGGGLRRMADDLNAQY BH3-only, Direct activators (PUMA, Bid) Inducing apoptosis CCK-8 assay GLC-82 Colon cancer Survival rate : 63.64 ± 4.80%
dbacp06211 TAT-DV3-BH3 YGRKKRRQRRRGGGLGASWHRPDKGGGGLRRMADDLNAQY BH3-only, Direct activators (PUMA, Bid) Inducing apoptosis CCK-8 assay SGC-7901 Colon cancer Survival rate : 64.75 ± 33.48%
dbacp06212 TAT-DV3-BH3 YGRKKRRQRRRGGGLGASWHRPDKGGGGLRRMADDLNAQY BH3-only, Direct activators (PUMA, Bid) Inducing apoptosis CCK-8 assay MDA-MB-231 Colon cancer Survival rate : 69.79 ± 6.71%
dbacp06213 TAT-DV3-BH3 YGRKKRRQRRRGGGLGASWHRPDKGGGGLRRMADDLNAQY BH3-only, Direct activators (PUMA, Bid) Inducing apoptosis CCK-8 assay HEK293 Colon cancer Survival rate : 115.85 ± 23.03%
dbacp06214 TAT-DV3-BH3 YGRKKRRQRRRGGGLGASWHRPDKGGGGLRRMADDLNAQY BH3-only, Direct activators (PUMA, Bid) Inducing apoptosis CCK-8 assay 2BS Colon cancer Survival rate : 124.38 ± 22.05%
dbacp06743 M1-20 grrrqrrkkrlgpfsidllikslsdnmtdl Synthetic Inhibits FOXM1 transcriptional activities CCK-8 assay MDA-MB-231 Breast Cancer IC50 = 18.15 µM
dbacp06744 M1-20 grrrqrrkkrlgpfsidllikslsdnmtdl Synthetic Inhibits FOXM1 transcriptional activities CCK-8 assay MCF-7 Breast Cancer IC50 = 31.05 µM
dbacp06745 M1-20 grrrqrrkkrlgpfsidllikslsdnmtdl Synthetic Inhibits FOXM1 transcriptional activities CCK-8 assay ZR-75-30 Breast Cancer IC50 = 23.57 µM
dbacp06746 M1-20 grrrqrrkkrlgpfsidllikslsdnmtdl Synthetic Inhibits FOXM1 transcriptional activities CCK-8 assay HeLa Cervical Cancer IC50 = 42.95 µM
dbacp06747 M1-20 grrrqrrkkrlgpfsidllikslsdnmtdl Synthetic Inhibits FOXM1 transcriptional activities CCK-8 assay U-2 OS Bone Cancer IC50 = 25.65 µM
dbacp06748 M1-20 grrrqrrkkrlgpfsidllikslsdnmtdl Synthetic Inhibits FOXM1 transcriptional activities CCK-8 assay A-549 Lung Cancer IC50 = 32.47 µM
dbacp06942 HTDT-6-2-3-2 GPLGAGP Enteromorpha prolifera Apoptosis inducing CCK-8 assay NCI-H-460 Lung Cancer IC50 = 0.3686 ± 0.0935 mg/mL
dbacp06943 HTDT-6-2-3-2 GPLGAGP Enteromorpha prolifera Apoptosis inducing CCK-8 assay HepG-2 Liver Cancer IC50 = 1.2564 ± 0.0548 mg/mL
dbacp06944 HTDT-6-2-3-2 GPLGAGP Enteromorpha prolifera Apoptosis inducing CCK-8 assay A-549 Lung Cancer IC50 = 0.9867 ± 0.0857 mg/mL
dbacp07097 K2F6K2 KKFFFFFFKK Synthetic Positive charge–driven membrane disruption apoptosis CCK-8 assay A-549 Lung Cancer IC50 = 1146.23 ± 346.83 μg/mL
dbacp07098 K3F6K3 KKKFFFFFFKKK Synthetic Positive charge–driven membrane disruption apoptosis CCK-8 assay A-549 Lung Cancer IC50 = 123.10 ± 35.19 μg/mL
dbacp07099 K4F6K4 KKKKFFFFFFKKKK Synthetic Positive charge–driven membrane disruption apoptosis CCK-8 assay A-549 Lung Cancer IC50 = 62.64 ± 9.55 μg/mL
dbacp07101 K4F8K4 KKKKFFFFFFFFKKKK Synthetic Positive charge–driven membrane disruption apoptosis CCK-8 assay A-549 Lung Cancer IC50 = 571.87 ± 66.23 μg/mL
dbacp07246 ATX-101 MDRWLVKWKKKRKIRRRRRRRRRRR Synthetic PCNA interference disrupts DNA repair. CCK-8 assay U87-MG Brain Tumor IC50 = 4.3 ± 0.3 μM
dbacp07247 ATX-101 MDRWLVKWKKKRKIRRRRRRRRRRR Synthetic PCNA interference disrupts DNA repair. CCK-8 assay U-251 Brain Tumor IC50 = 4.9 ± 0.3 μM
dbacp07248 ATX-101 MDRWLVKWKKKRKIRRRRRRRRRRR Synthetic PCNA interference disrupts DNA repair. CCK-8 assay A-172 Brain Tumor IC50 = 6.4 ± 0.4 μM
dbacp07249 ATX-101 MDRWLVKWKKKRKIRRRRRRRRRRR Synthetic PCNA interference disrupts DNA repair. CCK-8 assay T98G Brain Tumor IC50 = 7.1 ± 0.2 μM
dbacp07250 ATX-101 MDRWLVKWKKKRKIRRRRRRRRRRR Synthetic PCNA interference disrupts DNA repair. CCK-8 assay U-373 Brain Tumor IC50 = 5.0 ± 0.2 μM
dbacp07251 ATX-101 MDRWLVKWKKKRKIRRRRRRRRRRR Synthetic PCNA interference disrupts DNA repair. CCK-8 assay U-118 Brain Tumor IC50 = 6.8 ± 0.2 μM
dbacp07252 ATX-101 MDRWLVKWKKKRKIRRRRRRRRRRR Synthetic PCNA interference disrupts DNA repair. CCK-8 assay D54 Brain Tumor IC50 = 8.4 ± 0.1 μM
dbacp07253 ATX-101 MDRWLVKWKKKRKIRRRRRRRRRRR Synthetic PCNA interference disrupts DNA repair. CCK-8 assay SW-1783 Brain Tumor IC50 = 4.8 ± 0.2 μM
dbacp07254 ATX-101 MDRWLVKWKKKRKIRRRRRRRRRRR Synthetic PCNA interference disrupts DNA repair. CCK-8 assay LN229 Brain Tumor IC50 = 4.7 ± 0.2 μM
dbacp07255 ATX-101 MDRWLVKWKKKRKIRRRRRRRRRRR Synthetic PCNA interference disrupts DNA repair. CCK-8 assay U-138 Brain Tumor IC50 = 7.5 ± 0.3 μM
dbacp07256 ATX-101 MDRWLVKWKKKRKIRRRRRRRRRRR Synthetic PCNA interference disrupts DNA repair. CCK-8 assay SF-268 Brain Tumor IC50 = 4.8 ± 0.1 μM
dbacp07257 ATX-101 MDRWLVKWKKKRKIRRRRRRRRRRR Synthetic PCNA interference disrupts DNA repair. CCK-8 assay SNB-19 Brain Tumor IC50 = 12.0 ± 0.6 μM
dbacp07437 A4K14 - Citropin 1.1 - Sp 7 GLFAVR8KKVASVS5KGL Synthetic Stapled peptide enhances helical apoptosis CCK-8 assay C4-2B Prostate Cancer IC50 = 10.23 µM
dbacp07438 A4K14 - Citropin 1.1 - Sp 7 GLFAVR8KKVASVS5KGL Synthetic Stapled peptide enhances helical apoptosis CCK-8 assay A-549 Lung Cancer IC50 = 16.37 µM
dbacp07439 A4K14 - Citropin 1.1 - Sp 7 GLFAVR8KKVASVS5KGL Synthetic Stapled peptide enhances helical apoptosis CCK-8 assay U-87 Brain Tumor IC50 = 14.72 µM
dbacp07440 A4K14 - Citropin 1.1 - Sp 7 GLFAVR8KKVASVS5KGL Synthetic Stapled peptide enhances helical apoptosis CCK-8 assay MCF-7 Breast Cancer IC50 = 12.1 µM
dbacp07441 A4K14 - Citropin 1.1 - Sp 6 GR8FAVIKKS5ASVIKGL Synthetic Stapled peptide enhances helical apoptosis CCK-8 assay C4-2B Prostate Cancer IC50 = 35.84 µM
dbacp07442 A4K14 - Citropin 1.1 - Sp 6 GR8FAVIKKS5ASVIKGL Synthetic Stapled peptide enhances helical apoptosis CCK-8 assay A-549 Lung Cancer IC50 = 30.19 µM
dbacp07443 A4K14 - Citropin 1.1 - Sp 6 GR8FAVIKKS5ASVIKGL Synthetic Stapled peptide enhances helical apoptosis CCK-8 assay U-87 Brain Tumor IC50 = 34.49 µM
dbacp07444 A4K14 - Citropin 1.1 - Sp 6 GR8FAVIKKS5ASVIKGL Synthetic Stapled peptide enhances helical apoptosis CCK-8 assay MCF-7 Breast Cancer IC50 = 23.78 µM
dbacp07445 A4K14 - Citropin 1.1 - Sp 5 GLFAVIKKVAS5VIKS5L Synthetic Stapled peptide enhances helical apoptosis CCK-8 assay C4-2B Prostate Cancer IC50 = 11.9 µM
dbacp07446 A4K14 - Citropin 1.1 - Sp 5 GLFAVIKKVAS5VIKS5L Synthetic Stapled peptide enhances helical apoptosis CCK-8 assay A-549 Lung Cancer IC50 = 9.899 µM
dbacp07447 A4K14 - Citropin 1.1 - Sp 5 GLFAVIKKVAS5VIKS5L Synthetic Stapled peptide enhances helical apoptosis CCK-8 assay U-87 Brain Tumor IC50 = 8.229 µM
dbacp07448 A4K14 - Citropin 1.1 - Sp 5 GLFAVIKKVAS5VIKS5L Synthetic Stapled peptide enhances helical apoptosis CCK-8 assay MCF-7 Breast Cancer IC50 = 12.42 µM
dbacp07449 A4K14 - Citropin 1.1 - Sp 4 GLFAVIKKS5ASVS5KGL Synthetic Stapled peptide enhances helical apoptosis CCK-8 assay C4-2B Prostate Cancer IC50 = 8.9 µM
dbacp07450 A4K14 - Citropin 1.1 - Sp 4 GLFAVIKKS5ASVS5KGL Synthetic Stapled peptide enhances helical apoptosis CCK-8 assay A-549 Lung Cancer IC50 = 10.51 µM
dbacp07451 A4K14 - Citropin 1.1 - Sp 4 GLFAVIKKS5ASVS5KGL Synthetic Stapled peptide enhances helical apoptosis CCK-8 assay U-87 Brain Tumor IC50 = 7.277 µM
dbacp07452 A4K14 - Citropin 1.1 - Sp 4 GLFAVIKKS5ASVS5KGL Synthetic Stapled peptide enhances helical apoptosis CCK-8 assay MCF-7 Breast Cancer IC50 = 10.49 µM
dbacp07453 A4K14 - Citropin 1.1 - Sp 3 GLFAVS5KKVS5SVIKGL Synthetic Stapled peptide enhances helical apoptosis CCK-8 assay C4-2B Prostate Cancer IC50 = 17.89 µM
dbacp07454 A4K14 - Citropin 1.1 - Sp 3 GLFAVS5KKVS5SVIKGL Synthetic Stapled peptide enhances helical apoptosis CCK-8 assay A-549 Lung Cancer IC50 = 12.11 µM
dbacp07455 A4K14 - Citropin 1.1 - Sp 3 GLFAVS5KKVS5SVIKGL Synthetic Stapled peptide enhances helical apoptosis CCK-8 assay U-87 Brain Tumor IC50 = 11.93 µM
dbacp07456 A4K14 - Citropin 1.1 - Sp 3 GLFAVS5KKVS5SVIKGL Synthetic Stapled peptide enhances helical apoptosis CCK-8 assay MCF-7 Breast Cancer IC50 = 11.92 µM
dbacp07457 A4K14 - Citropin 1.1 - Sp 2 GLFAS5IKKS5ASVIKGL Synthetic Stapled peptide enhances helical apoptosis CCK-8 assay C4-2B Prostate Cancer IC50 = 10.14 µM
dbacp07458 A4K14 - Citropin 1.1 - Sp 2 GLFAS5IKKS5ASVIKGL Synthetic Stapled peptide enhances helical apoptosis CCK-8 assay A-549 Lung Cancer IC50 = 12.55 µM
dbacp07459 A4K14 - Citropin 1.1 - Sp 2 GLFAS5IKKS5ASVIKGL Synthetic Stapled peptide enhances helical apoptosis CCK-8 assay U-87 Brain Tumor IC50 = 14.76 µM
dbacp07460 A4K14 - Citropin 1.1 - Sp 2 GLFAS5IKKS5ASVIKGL Synthetic Stapled peptide enhances helical apoptosis CCK-8 assay MCF-7 Breast Cancer IC50 = 12.65 µM
dbacp07461 A4K14 - Citropin 1.1 - Sp 1 GS5FAVS5KKVASVIKGL Synthetic Stapled peptide enhances helical apoptosis CCK-8 assay C4-2B Prostate Cancer IC50 = 8.94 µM
dbacp07462 A4K14 - Citropin 1.1 - Sp 1 GS5FAVS5KKVASVIKGL Synthetic Stapled peptide enhances helical apoptosis CCK-8 assay A-549 Lung Cancer IC50 = 12.48 µM
dbacp07463 A4K14 - Citropin 1.1 - Sp 1 GS5FAVS5KKVASVIKGL Synthetic Stapled peptide enhances helical apoptosis CCK-8 assay U-87 Brain Tumor IC50 = 11.88 µM
dbacp07464 A4K14 - Citropin 1.1 - Sp 1 GS5FAVS5KKVASVIKGL Synthetic Stapled peptide enhances helical apoptosis CCK-8 assay MCF-7 Breast Cancer IC50 = 11.26 µM
dbacp07475 Latcripin-7A MTTESKVKNATTLLHSGKVKERQEGLSALRNIFSQNSSIERFYNVAGRDGRKPSHEIWAPILDGLQTCIRSEKSAFVTAKKSTDVIEKRLAAAAGTYRWFVEKSMMHFAKKTVLEICHFLYREMKVRETLIPSVALDFIKAYECVASHPPHLARLEEDEIEWEE Lentinula edodes Cell-cycle arrest, apoptosis, autophagy induction CCK-8 assay MCF-7 Breast Cancer IC50 = 91 μg/mL
dbacp07476 Latcripin-7A MTTESKVKNATTLLHSGKVKERQEGLSALRNIFSQNSSIERFYNVAGRDGRKPSHEIWAPILDGLQTCIRSEKSAFVTAKKSTDVIEKRLAAAAGTYRWFVEKSMMHFAKKTVLEICHFLYREMKVRETLIPSVALDFIKAYECVASHPPHLARLEEDEIEWEE Lentinula edodes Cell-cycle arrest, apoptosis, autophagy induction CCK-8 assay MDA-MB-231 Breast Cancer IC50 = 122 μg/mL
dbacp07865 R-Lycosin I derivative 8a RGWFRAMRSIARFIARERLRGHL Monosaccharide Analogue of Anticancer Peptide R-Lycosin-I GLUT1-mediated uptake enhances cytotoxicity CCK-8 assay MDA-MB-231 Breast Cancer IC50 = 10.1 ± 0.2 µM
dbacp07866 R-Lycosin I derivative 8a RGWFRAMRSIARFIARERLRGHL Monosaccharide Analogue of Anticancer Peptide R-Lycosin-I GLUT1-mediated uptake enhances cytotoxicity CCK-8 assay A-549 Lung Cancer IC50 = 9.6 ± 0.3 µM
dbacp07867 R-Lycosin I derivative 8a RGWFRAMRSIARFIARERLRGHL Monosaccharide Analogue of Anticancer Peptide R-Lycosin-I GLUT1-mediated uptake enhances cytotoxicity CCK-8 assay H-460 Lung Cancer IC50 = 8.5 ± 0.4 µM
dbacp07868 R-Lycosin I derivative 8a RGWFRAMRSIARFIARERLRGHL Monosaccharide Analogue of Anticancer Peptide R-Lycosin-I GLUT1-mediated uptake enhances cytotoxicity CCK-8 assay H-1437 Lung Cancer IC50 = 13.0 ± 0.2 µM
dbacp07869 R-Lycosin I derivative 8a RGWFRAMRSIARFIARERLRGHL Monosaccharide Analogue of Anticancer Peptide R-Lycosin-I GLUT1-mediated uptake enhances cytotoxicity CCK-8 assay HGC-27 Gastric Cancer IC50 = 12.6 ± 0.6 µM
dbacp07870 R-Lycosin I derivative 8a RGWFRAMRSIARFIARERLRGHL Monosaccharide Analogue of Anticancer Peptide R-Lycosin-I GLUT1-mediated uptake enhances cytotoxicity CCK-8 assay PC-3 Prostate Cancer IC50 = 6.9 ± 0.4 µM
dbacp07871 R-Lycosin I derivative 8b RGWFRAMRSIARFIARERLRGHL Monosaccharide Analogue of Anticancer Peptide R-Lycosin-I GLUT1-mediated uptake enhances cytotoxicity CCK-8 assay MDA-MB-231 Breast Cancer IC50 = 6.0 ± 0.2 µM
dbacp07872 R-Lycosin I derivative 8b RGWFRAMRSIARFIARERLRGHL Monosaccharide Analogue of Anticancer Peptide R-Lycosin-I GLUT1-mediated uptake enhances cytotoxicity CCK-8 assay A-549 Lung Cancer IC50 = 7.0 ± 0.3 µM
dbacp07873 R-Lycosin I derivative 8b RGWFRAMRSIARFIARERLRGHL Monosaccharide Analogue of Anticancer Peptide R-Lycosin-I GLUT1-mediated uptake enhances cytotoxicity CCK-8 assay H-460 Lung Cancer IC50 = 4.9 ± 0.9 µM
dbacp07874 R-Lycosin I derivative 8b RGWFRAMRSIARFIARERLRGHL Monosaccharide Analogue of Anticancer Peptide R-Lycosin-I GLUT1-mediated uptake enhances cytotoxicity CCK-8 assay H-1437 Lung Cancer IC50 = 5.3 ± 0.2 µM
dbacp07875 R-Lycosin I derivative 8b RGWFRAMRSIARFIARERLRGHL Monosaccharide Analogue of Anticancer Peptide R-Lycosin-I GLUT1-mediated uptake enhances cytotoxicity CCK-8 assay HGC-27 Gastric Cancer IC50 = 5.3 ± 0.2 µM
dbacp07876 R-Lycosin I derivative 8b RGWFRAMRSIARFIARERLRGHL Monosaccharide Analogue of Anticancer Peptide R-Lycosin-I GLUT1-mediated uptake enhances cytotoxicity CCK-8 assay PC-3 Prostate Cancer IC50 = 4.9 ± 0.2 µM
dbacp07985 R-C16 RGWFRAMRSIARFIARERLREHL R-Lycosin-I Fatty-acid modification enhances peptide apoptosis CCK-8 assay A-549 Lung Cancer IC50 ~ 5 µM
dbacp08014 Ec-LDP-hBD1 MANCVVGYIGERCQYRDLKWWELRGGGGSGGGGSAPAFSVSPASGLSDGQSVSVSVSGAAAGETYYIAQCAPVGGQDACNPATATSFTTDASGAASFSFVVRKSYTGSTPEGTPVGSVDCATAACNLGAGNSGLDLGHVALTFGGGGGSGGGGSDHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCKLEHHHHHH Synthetic EGFR-targeted defensin induces mitochondrial apoptosis CCK-8 assay A-431 Skin Cancer IC50 = 1.8 μM
dbacp08015 Ec-LDP-hBD1 MANCVVGYIGERCQYRDLKWWELRGGGGSGGGGSAPAFSVSPASGLSDGQSVSVSVSGAAAGETYYIAQCAPVGGQDACNPATATSFTTDASGAASFSFVVRKSYTGSTPEGTPVGSVDCATAACNLGAGNSGLDLGHVALTFGGGGGSGGGGSDHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCKLEHHHHHH Synthetic EGFR-targeted defensin induces mitochondrial apoptosis CCK-8 assay A-549 Lung Cancer IC50 = 11.9 μM
dbacp08016 Ec-LDP-hBD1 MANCVVGYIGERCQYRDLKWWELRGGGGSGGGGSAPAFSVSPASGLSDGQSVSVSVSGAAAGETYYIAQCAPVGGQDACNPATATSFTTDASGAASFSFVVRKSYTGSTPEGTPVGSVDCATAACNLGAGNSGLDLGHVALTFGGGGGSGGGGSDHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCKLEHHHHHH Synthetic EGFR-targeted defensin induces mitochondrial apoptosis CCK-8 assay H-460 Lung Cancer IC50 = 5.19 μM
dbacp08017 Ec-LDP-hBD1 MANCVVGYIGERCQYRDLKWWELRGGGGSGGGGSAPAFSVSPASGLSDGQSVSVSVSGAAAGETYYIAQCAPVGGQDACNPATATSFTTDASGAASFSFVVRKSYTGSTPEGTPVGSVDCATAACNLGAGNSGLDLGHVALTFGGGGGSGGGGSDHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCKLEHHHHHH Synthetic EGFR-targeted defensin induces mitochondrial apoptosis CCK-8 assay PG-BE1 Lung Cancer IC50 = 31.3 μM
dbacp08051 MEL-Pep GIGAVLKKLTTGLKALISWIKRKRQQ Synthetic analog of Melittin MEL-pep disrupts membrane, inhibits P-gp CCK-8 assay BEL-7402/5-FU Liver Cancer IC50 = 4.36 μM
dbacp08055 L-FP21-PEG-PEI/pGRO-α YTRDLVYGDPARPGIQGTGTF Synthetic D-FP21 delivers gene, inhibits proliferation CCK-8 assay HO-8910 Ovarian Cancer IC50 = 23.4 μg/mL
dbacp08056 D-FP21-PEG-PEI/pGRO-α ytrdlvygdparpgiqgtgtf Synthetic D-FP21 delivers gene, inhibits proliferation CCK-8 assay HO-8910 Ovarian Cancer IC50 = 21.6 μg/mL
dbacp08058 TAT-327 RKKRRQRRREFLDCFQKF Peptide-327 Peptide 327 blocks Eps8–EGFR CCK-8 assay A-549 Lung Cancer EC50 = 55.42 ± 0.84 μM
dbacp08059 TAT-327 RKKRRQRRREFLDCFQKF Peptide-327 Peptide 327 blocks Eps8–EGFR CCK-8 assay HepG-2 Liver Cancer EC50 = 68.52 ± 2.96 μM
dbacp08060 TAT-327 RKKRRQRRREFLDCFQKF Peptide-327 Peptide 327 blocks Eps8–EGFR CCK-8 assay Colo-320 Colon Cancer EC50 = 68.40 ± 0.42 μM
dbacp08061 TAT-327 RKKRRQRRREFLDCFQKF Peptide-327 Peptide 327 blocks Eps8–EGFR CCK-8 assay HT-29 Colon Cancer EC50 = 74.08 ± 0.63 μM
dbacp08062 TAT-327 RKKRRQRRREFLDCFQKF Peptide-327 Peptide 327 blocks Eps8–EGFR CCK-8 assay SW-620 Colorectal Cancer EC50 = 64.61 ± 1.63 μM
dbacp08063 E5 GGRSFFLLRRIQGCRFRNTVDD Synthetic E5 inhibits CXCR4–CXCL12 signaling CCK-8 assay 4T1 Breast Cancer 49% cell viability at 100 μM
dbacp08316 Sample Peptide 1 from US011339203B2 LTSVVFILICCFHLENIFVLLKKRTLRKNDRKKR Synthetic Not Available CCK-8 assay CAKI-2 Renal Cancer Cell Viability = 48% at 25 μM
dbacp08317 Sample Peptide 2 from US011339203B2 FIGNLALSDLLAGVAYTANLLLKKRTLRKNDRKKR Synthetic Not Available CCK-8 assay CAKI-2 Renal Cancer Cell Viability = 0.4% at 25 μM
dbacp08318 Sample Peptide 2 from US011339203B2 FIGNLALSDLLAGVAYTANLLLKKRTLRKNDRKKR Synthetic Not Available CCK-8 assay PC-3 Prostate Cancer Cell Viability = 2.5% at 25 μM
dbacp08319 Sample Peptide 2 from US011339203B2 FIGNLALSDLLAGVAYTANLLLKKRTLRKNDRKKR Synthetic Not Available CCK-8 assay A-2058 Skin Cancer Cell Viability = 0.2% at 25 μM
dbacp08320 Sample Peptide 2 from US011339203B2 FIGNLALSDLLAGVAYTANLLLKKRTLRKNDRKKR Synthetic Not Available CCK-8 assay NCI-H2444 Lung Cancer Cell Viability = 0.6% at 25 μM
dbacp08321 Sample Peptide 2 from US011339203B2 FIGNLALSDLLAGVAYTANLLLKKRTLRKNDRKKR Synthetic Not Available CCK-8 assay A-549 Lung Cancer Cell Viability = 1.4% at 25 μM
dbacp08322 Sample Peptide 3 from US011339203B2 WFLREGSMFVALSASVFSLLAIKKRTLRKNDRKKR Synthetic Not Available CCK-8 assay CAKI-2 Renal Cancer Cell Viability = 45.8% at 25 μM
dbacp08323 Sample Peptide 4 from US011339203B2 FLLISACWVISLILGGLPIMGWKKRTLRKNDRKKR Synthetic Not Available CCK-8 assay CAKI-2 Renal Cancer Cell Viability = 85.6% at 25 μM
dbacp08324 Sample Peptide 5 from US011339203B2 LYHKHYILECTTVFTLLLLSIVILYCRIKKRTLRKNDRKKR Synthetic Not Available CCK-8 assay CAKI-2 Renal Cancer Cell Viability = 77.6% at 25 μM
dbacp08325 Sample Peptide 6 from US011339203B2 VIIVLSVFIACWAPLFILLLLKKRTLRKNDRKKR Synthetic Not Available CCK-8 assay CAKI-2 Renal Cancer Cell Viability = 59.7% at 25 μM
dbacp08326 Sample Peptide 7 from US011339203B2 LFRAEYFLVLAVLNSGTNPIIKKRTLRKNDRKKR Synthetic Not Available CCK-8 assay CAKI-2 Renal Cancer Cell Viability = 66.3% at 25 μM