109 result(s) have been found!
| Accession | Name | Sequence | Source/Organism | Mechanism | Assay Type | Cell Line | Cancer Type | Activity |
|---|---|---|---|---|---|---|---|---|
| dbacp02819 | Dual-functional peptide LPLTPLP | LPLTPLP | Not found | Inducing apoptosis | CCK-8 assay | A549 | Lung cancer | IC50 : 0.00022 M |
| dbacp02820 | Dual-functional peptide LPLTPLP | LPLTPLP | Not found | Inducing apoptosis | CCK-8 assay | WI-38 | Lung cancer | IC50 : 0.035 M |
| dbacp04337 | LVTX-8 | IWLTALKFLGKNLGKHLAKQQLSKL-NH2 | True tarantula | Promote apoptosis; Inhibits the proliferation and migration of lung cancer cells both in vitro and in vivo | CCK-8 assay, Flow cytometry, Colony formation assay, Transwell invasion and migration assay | A549 | Lung cancer | IC50 : approx. 8 µM |
| dbacp04338 | LVTX-8 | IWLTALKFLGKNLGKHLAKQQLSKL-NH2 | True tarantula | Promote apoptosis; Inhibits the proliferation and migration of lung cancer cells both in vitro and in vivo | CCK-8 assay, Flow cytometry, Colony formation assay, Transwell invasion and migration assay | H461 | Lung cancer | IC50 : approx. 8 µM |
| dbacp04339 | LVTX-9 | ASIGALIQKAIALIKAKAA-NH2 | True tarantula | Promote apoptosis; Inhibits the proliferation and migration of lung cancer cells both in vitro and in vivo | CCK-8 assay, Flow cytometry, Colony formation assay, Transwell invasion and migration assay | A549 | Lung cancer | IC50 : approx. 8 µM |
| dbacp04340 | LVTX-9 | ASIGALIQKAIALIKAKAA-NH2 | True tarantula | Promote apoptosis; Inhibits the proliferation and migration of lung cancer cells both in vitro and in vivo | CCK-8 assay, Flow cytometry, Colony formation assay, Transwell invasion and migration assay | H460 | Lung cancer | IC50 : approx. 8 µM |
| dbacp04698 | MP06 | LAVISWKCQEWNSLWKKRKRKT | Green algae | Apoptosis inducing | CCK-8 assay | MRC5 | Lung cancer | IC50 : 10 μM |
| dbacp06058 | Sepia ink oligopeptide (SIO) | QPK | Not found | Inducing apoptosis | CCK-8 assay | DU-145 | Prostate cancer | IC50 : < 5 mg/mL |
| dbacp06059 | Sepia ink oligopeptide (SIO) | QPK | Not found | Inducing apoptosis | CCK-8 assay | PC-3 | Prostate cancer | IC50 : < 5 mg/mL |
| dbacp06060 | Sepia ink oligopeptide (SIO) | QPK | Not found | Inducing apoptosis | CCK-8 assay | LNCaP | Prostate cancer | IC50 : < 10 mg/mL |
| dbacp06208 | TAT-DV3-BH3 | YGRKKRRQRRRGGGLGASWHRPDKGGGGLRRMADDLNAQY | BH3-only, Direct activators (PUMA, Bid) | Inducing apoptosis | CCK-8 assay | HCT116p53–/– | Colon cancer | Survival rate : 32.19 ± 6.42% |
| dbacp06209 | TAT-DV3-BH3 | YGRKKRRQRRRGGGLGASWHRPDKGGGGLRRMADDLNAQY | BH3-only, Direct activators (PUMA, Bid) | Inducing apoptosis | CCK-8 assay | HCT116p53+/+ | Colon cancer | Survival rate : 34.28 ± 8.93% |
| dbacp06210 | TAT-DV3-BH3 | YGRKKRRQRRRGGGLGASWHRPDKGGGGLRRMADDLNAQY | BH3-only, Direct activators (PUMA, Bid) | Inducing apoptosis | CCK-8 assay | GLC-82 | Colon cancer | Survival rate : 63.64 ± 4.80% |
| dbacp06211 | TAT-DV3-BH3 | YGRKKRRQRRRGGGLGASWHRPDKGGGGLRRMADDLNAQY | BH3-only, Direct activators (PUMA, Bid) | Inducing apoptosis | CCK-8 assay | SGC-7901 | Colon cancer | Survival rate : 64.75 ± 33.48% |
| dbacp06212 | TAT-DV3-BH3 | YGRKKRRQRRRGGGLGASWHRPDKGGGGLRRMADDLNAQY | BH3-only, Direct activators (PUMA, Bid) | Inducing apoptosis | CCK-8 assay | MDA-MB-231 | Colon cancer | Survival rate : 69.79 ± 6.71% |
| dbacp06213 | TAT-DV3-BH3 | YGRKKRRQRRRGGGLGASWHRPDKGGGGLRRMADDLNAQY | BH3-only, Direct activators (PUMA, Bid) | Inducing apoptosis | CCK-8 assay | HEK293 | Colon cancer | Survival rate : 115.85 ± 23.03% |
| dbacp06214 | TAT-DV3-BH3 | YGRKKRRQRRRGGGLGASWHRPDKGGGGLRRMADDLNAQY | BH3-only, Direct activators (PUMA, Bid) | Inducing apoptosis | CCK-8 assay | 2BS | Colon cancer | Survival rate : 124.38 ± 22.05% |
| dbacp06743 | M1-20 | grrrqrrkkrlgpfsidllikslsdnmtdl | Synthetic | Inhibits FOXM1 transcriptional activities | CCK-8 assay | MDA-MB-231 | Breast Cancer | IC50 = 18.15 µM |
| dbacp06744 | M1-20 | grrrqrrkkrlgpfsidllikslsdnmtdl | Synthetic | Inhibits FOXM1 transcriptional activities | CCK-8 assay | MCF-7 | Breast Cancer | IC50 = 31.05 µM |
| dbacp06745 | M1-20 | grrrqrrkkrlgpfsidllikslsdnmtdl | Synthetic | Inhibits FOXM1 transcriptional activities | CCK-8 assay | ZR-75-30 | Breast Cancer | IC50 = 23.57 µM |
| dbacp06746 | M1-20 | grrrqrrkkrlgpfsidllikslsdnmtdl | Synthetic | Inhibits FOXM1 transcriptional activities | CCK-8 assay | HeLa | Cervical Cancer | IC50 = 42.95 µM |
| dbacp06747 | M1-20 | grrrqrrkkrlgpfsidllikslsdnmtdl | Synthetic | Inhibits FOXM1 transcriptional activities | CCK-8 assay | U-2 OS | Bone Cancer | IC50 = 25.65 µM |
| dbacp06748 | M1-20 | grrrqrrkkrlgpfsidllikslsdnmtdl | Synthetic | Inhibits FOXM1 transcriptional activities | CCK-8 assay | A-549 | Lung Cancer | IC50 = 32.47 µM |
| dbacp06942 | HTDT-6-2-3-2 | GPLGAGP | Enteromorpha prolifera | Apoptosis inducing | CCK-8 assay | NCI-H-460 | Lung Cancer | IC50 = 0.3686 ± 0.0935 mg/mL |
| dbacp06943 | HTDT-6-2-3-2 | GPLGAGP | Enteromorpha prolifera | Apoptosis inducing | CCK-8 assay | HepG-2 | Liver Cancer | IC50 = 1.2564 ± 0.0548 mg/mL |
| dbacp06944 | HTDT-6-2-3-2 | GPLGAGP | Enteromorpha prolifera | Apoptosis inducing | CCK-8 assay | A-549 | Lung Cancer | IC50 = 0.9867 ± 0.0857 mg/mL |
| dbacp07097 | K2F6K2 | KKFFFFFFKK | Synthetic | Positive charge–driven membrane disruption apoptosis | CCK-8 assay | A-549 | Lung Cancer | IC50 = 1146.23 ± 346.83 μg/mL |
| dbacp07098 | K3F6K3 | KKKFFFFFFKKK | Synthetic | Positive charge–driven membrane disruption apoptosis | CCK-8 assay | A-549 | Lung Cancer | IC50 = 123.10 ± 35.19 μg/mL |
| dbacp07099 | K4F6K4 | KKKKFFFFFFKKKK | Synthetic | Positive charge–driven membrane disruption apoptosis | CCK-8 assay | A-549 | Lung Cancer | IC50 = 62.64 ± 9.55 μg/mL |
| dbacp07101 | K4F8K4 | KKKKFFFFFFFFKKKK | Synthetic | Positive charge–driven membrane disruption apoptosis | CCK-8 assay | A-549 | Lung Cancer | IC50 = 571.87 ± 66.23 μg/mL |
| dbacp07246 | ATX-101 | MDRWLVKWKKKRKIRRRRRRRRRRR | Synthetic | PCNA interference disrupts DNA repair. | CCK-8 assay | U87-MG | Brain Tumor | IC50 = 4.3 ± 0.3 μM |
| dbacp07247 | ATX-101 | MDRWLVKWKKKRKIRRRRRRRRRRR | Synthetic | PCNA interference disrupts DNA repair. | CCK-8 assay | U-251 | Brain Tumor | IC50 = 4.9 ± 0.3 μM |
| dbacp07248 | ATX-101 | MDRWLVKWKKKRKIRRRRRRRRRRR | Synthetic | PCNA interference disrupts DNA repair. | CCK-8 assay | A-172 | Brain Tumor | IC50 = 6.4 ± 0.4 μM |
| dbacp07249 | ATX-101 | MDRWLVKWKKKRKIRRRRRRRRRRR | Synthetic | PCNA interference disrupts DNA repair. | CCK-8 assay | T98G | Brain Tumor | IC50 = 7.1 ± 0.2 μM |
| dbacp07250 | ATX-101 | MDRWLVKWKKKRKIRRRRRRRRRRR | Synthetic | PCNA interference disrupts DNA repair. | CCK-8 assay | U-373 | Brain Tumor | IC50 = 5.0 ± 0.2 μM |
| dbacp07251 | ATX-101 | MDRWLVKWKKKRKIRRRRRRRRRRR | Synthetic | PCNA interference disrupts DNA repair. | CCK-8 assay | U-118 | Brain Tumor | IC50 = 6.8 ± 0.2 μM |
| dbacp07252 | ATX-101 | MDRWLVKWKKKRKIRRRRRRRRRRR | Synthetic | PCNA interference disrupts DNA repair. | CCK-8 assay | D54 | Brain Tumor | IC50 = 8.4 ± 0.1 μM |
| dbacp07253 | ATX-101 | MDRWLVKWKKKRKIRRRRRRRRRRR | Synthetic | PCNA interference disrupts DNA repair. | CCK-8 assay | SW-1783 | Brain Tumor | IC50 = 4.8 ± 0.2 μM |
| dbacp07254 | ATX-101 | MDRWLVKWKKKRKIRRRRRRRRRRR | Synthetic | PCNA interference disrupts DNA repair. | CCK-8 assay | LN229 | Brain Tumor | IC50 = 4.7 ± 0.2 μM |
| dbacp07255 | ATX-101 | MDRWLVKWKKKRKIRRRRRRRRRRR | Synthetic | PCNA interference disrupts DNA repair. | CCK-8 assay | U-138 | Brain Tumor | IC50 = 7.5 ± 0.3 μM |
| dbacp07256 | ATX-101 | MDRWLVKWKKKRKIRRRRRRRRRRR | Synthetic | PCNA interference disrupts DNA repair. | CCK-8 assay | SF-268 | Brain Tumor | IC50 = 4.8 ± 0.1 μM |
| dbacp07257 | ATX-101 | MDRWLVKWKKKRKIRRRRRRRRRRR | Synthetic | PCNA interference disrupts DNA repair. | CCK-8 assay | SNB-19 | Brain Tumor | IC50 = 12.0 ± 0.6 μM |
| dbacp07437 | A4K14 - Citropin 1.1 - Sp 7 | GLFAVR8KKVASVS5KGL | Synthetic | Stapled peptide enhances helical apoptosis | CCK-8 assay | C4-2B | Prostate Cancer | IC50 = 10.23 µM |
| dbacp07438 | A4K14 - Citropin 1.1 - Sp 7 | GLFAVR8KKVASVS5KGL | Synthetic | Stapled peptide enhances helical apoptosis | CCK-8 assay | A-549 | Lung Cancer | IC50 = 16.37 µM |
| dbacp07439 | A4K14 - Citropin 1.1 - Sp 7 | GLFAVR8KKVASVS5KGL | Synthetic | Stapled peptide enhances helical apoptosis | CCK-8 assay | U-87 | Brain Tumor | IC50 = 14.72 µM |
| dbacp07440 | A4K14 - Citropin 1.1 - Sp 7 | GLFAVR8KKVASVS5KGL | Synthetic | Stapled peptide enhances helical apoptosis | CCK-8 assay | MCF-7 | Breast Cancer | IC50 = 12.1 µM |
| dbacp07441 | A4K14 - Citropin 1.1 - Sp 6 | GR8FAVIKKS5ASVIKGL | Synthetic | Stapled peptide enhances helical apoptosis | CCK-8 assay | C4-2B | Prostate Cancer | IC50 = 35.84 µM |
| dbacp07442 | A4K14 - Citropin 1.1 - Sp 6 | GR8FAVIKKS5ASVIKGL | Synthetic | Stapled peptide enhances helical apoptosis | CCK-8 assay | A-549 | Lung Cancer | IC50 = 30.19 µM |
| dbacp07443 | A4K14 - Citropin 1.1 - Sp 6 | GR8FAVIKKS5ASVIKGL | Synthetic | Stapled peptide enhances helical apoptosis | CCK-8 assay | U-87 | Brain Tumor | IC50 = 34.49 µM |
| dbacp07444 | A4K14 - Citropin 1.1 - Sp 6 | GR8FAVIKKS5ASVIKGL | Synthetic | Stapled peptide enhances helical apoptosis | CCK-8 assay | MCF-7 | Breast Cancer | IC50 = 23.78 µM |
| dbacp07445 | A4K14 - Citropin 1.1 - Sp 5 | GLFAVIKKVAS5VIKS5L | Synthetic | Stapled peptide enhances helical apoptosis | CCK-8 assay | C4-2B | Prostate Cancer | IC50 = 11.9 µM |
| dbacp07446 | A4K14 - Citropin 1.1 - Sp 5 | GLFAVIKKVAS5VIKS5L | Synthetic | Stapled peptide enhances helical apoptosis | CCK-8 assay | A-549 | Lung Cancer | IC50 = 9.899 µM |
| dbacp07447 | A4K14 - Citropin 1.1 - Sp 5 | GLFAVIKKVAS5VIKS5L | Synthetic | Stapled peptide enhances helical apoptosis | CCK-8 assay | U-87 | Brain Tumor | IC50 = 8.229 µM |
| dbacp07448 | A4K14 - Citropin 1.1 - Sp 5 | GLFAVIKKVAS5VIKS5L | Synthetic | Stapled peptide enhances helical apoptosis | CCK-8 assay | MCF-7 | Breast Cancer | IC50 = 12.42 µM |
| dbacp07449 | A4K14 - Citropin 1.1 - Sp 4 | GLFAVIKKS5ASVS5KGL | Synthetic | Stapled peptide enhances helical apoptosis | CCK-8 assay | C4-2B | Prostate Cancer | IC50 = 8.9 µM |
| dbacp07450 | A4K14 - Citropin 1.1 - Sp 4 | GLFAVIKKS5ASVS5KGL | Synthetic | Stapled peptide enhances helical apoptosis | CCK-8 assay | A-549 | Lung Cancer | IC50 = 10.51 µM |
| dbacp07451 | A4K14 - Citropin 1.1 - Sp 4 | GLFAVIKKS5ASVS5KGL | Synthetic | Stapled peptide enhances helical apoptosis | CCK-8 assay | U-87 | Brain Tumor | IC50 = 7.277 µM |
| dbacp07452 | A4K14 - Citropin 1.1 - Sp 4 | GLFAVIKKS5ASVS5KGL | Synthetic | Stapled peptide enhances helical apoptosis | CCK-8 assay | MCF-7 | Breast Cancer | IC50 = 10.49 µM |
| dbacp07453 | A4K14 - Citropin 1.1 - Sp 3 | GLFAVS5KKVS5SVIKGL | Synthetic | Stapled peptide enhances helical apoptosis | CCK-8 assay | C4-2B | Prostate Cancer | IC50 = 17.89 µM |
| dbacp07454 | A4K14 - Citropin 1.1 - Sp 3 | GLFAVS5KKVS5SVIKGL | Synthetic | Stapled peptide enhances helical apoptosis | CCK-8 assay | A-549 | Lung Cancer | IC50 = 12.11 µM |
| dbacp07455 | A4K14 - Citropin 1.1 - Sp 3 | GLFAVS5KKVS5SVIKGL | Synthetic | Stapled peptide enhances helical apoptosis | CCK-8 assay | U-87 | Brain Tumor | IC50 = 11.93 µM |
| dbacp07456 | A4K14 - Citropin 1.1 - Sp 3 | GLFAVS5KKVS5SVIKGL | Synthetic | Stapled peptide enhances helical apoptosis | CCK-8 assay | MCF-7 | Breast Cancer | IC50 = 11.92 µM |
| dbacp07457 | A4K14 - Citropin 1.1 - Sp 2 | GLFAS5IKKS5ASVIKGL | Synthetic | Stapled peptide enhances helical apoptosis | CCK-8 assay | C4-2B | Prostate Cancer | IC50 = 10.14 µM |
| dbacp07458 | A4K14 - Citropin 1.1 - Sp 2 | GLFAS5IKKS5ASVIKGL | Synthetic | Stapled peptide enhances helical apoptosis | CCK-8 assay | A-549 | Lung Cancer | IC50 = 12.55 µM |
| dbacp07459 | A4K14 - Citropin 1.1 - Sp 2 | GLFAS5IKKS5ASVIKGL | Synthetic | Stapled peptide enhances helical apoptosis | CCK-8 assay | U-87 | Brain Tumor | IC50 = 14.76 µM |
| dbacp07460 | A4K14 - Citropin 1.1 - Sp 2 | GLFAS5IKKS5ASVIKGL | Synthetic | Stapled peptide enhances helical apoptosis | CCK-8 assay | MCF-7 | Breast Cancer | IC50 = 12.65 µM |
| dbacp07461 | A4K14 - Citropin 1.1 - Sp 1 | GS5FAVS5KKVASVIKGL | Synthetic | Stapled peptide enhances helical apoptosis | CCK-8 assay | C4-2B | Prostate Cancer | IC50 = 8.94 µM |
| dbacp07462 | A4K14 - Citropin 1.1 - Sp 1 | GS5FAVS5KKVASVIKGL | Synthetic | Stapled peptide enhances helical apoptosis | CCK-8 assay | A-549 | Lung Cancer | IC50 = 12.48 µM |
| dbacp07463 | A4K14 - Citropin 1.1 - Sp 1 | GS5FAVS5KKVASVIKGL | Synthetic | Stapled peptide enhances helical apoptosis | CCK-8 assay | U-87 | Brain Tumor | IC50 = 11.88 µM |
| dbacp07464 | A4K14 - Citropin 1.1 - Sp 1 | GS5FAVS5KKVASVIKGL | Synthetic | Stapled peptide enhances helical apoptosis | CCK-8 assay | MCF-7 | Breast Cancer | IC50 = 11.26 µM |
| dbacp07475 | Latcripin-7A | MTTESKVKNATTLLHSGKVKERQEGLSALRNIFSQNSSIERFYNVAGRDGRKPSHEIWAPILDGLQTCIRSEKSAFVTAKKSTDVIEKRLAAAAGTYRWFVEKSMMHFAKKTVLEICHFLYREMKVRETLIPSVALDFIKAYECVASHPPHLARLEEDEIEWEE | Lentinula edodes | Cell-cycle arrest, apoptosis, autophagy induction | CCK-8 assay | MCF-7 | Breast Cancer | IC50 = 91 μg/mL |
| dbacp07476 | Latcripin-7A | MTTESKVKNATTLLHSGKVKERQEGLSALRNIFSQNSSIERFYNVAGRDGRKPSHEIWAPILDGLQTCIRSEKSAFVTAKKSTDVIEKRLAAAAGTYRWFVEKSMMHFAKKTVLEICHFLYREMKVRETLIPSVALDFIKAYECVASHPPHLARLEEDEIEWEE | Lentinula edodes | Cell-cycle arrest, apoptosis, autophagy induction | CCK-8 assay | MDA-MB-231 | Breast Cancer | IC50 = 122 μg/mL |
| dbacp07865 | R-Lycosin I derivative 8a | RGWFRAMRSIARFIARERLRGHL | Monosaccharide Analogue of Anticancer Peptide R-Lycosin-I | GLUT1-mediated uptake enhances cytotoxicity | CCK-8 assay | MDA-MB-231 | Breast Cancer | IC50 = 10.1 ± 0.2 µM |
| dbacp07866 | R-Lycosin I derivative 8a | RGWFRAMRSIARFIARERLRGHL | Monosaccharide Analogue of Anticancer Peptide R-Lycosin-I | GLUT1-mediated uptake enhances cytotoxicity | CCK-8 assay | A-549 | Lung Cancer | IC50 = 9.6 ± 0.3 µM |
| dbacp07867 | R-Lycosin I derivative 8a | RGWFRAMRSIARFIARERLRGHL | Monosaccharide Analogue of Anticancer Peptide R-Lycosin-I | GLUT1-mediated uptake enhances cytotoxicity | CCK-8 assay | H-460 | Lung Cancer | IC50 = 8.5 ± 0.4 µM |
| dbacp07868 | R-Lycosin I derivative 8a | RGWFRAMRSIARFIARERLRGHL | Monosaccharide Analogue of Anticancer Peptide R-Lycosin-I | GLUT1-mediated uptake enhances cytotoxicity | CCK-8 assay | H-1437 | Lung Cancer | IC50 = 13.0 ± 0.2 µM |
| dbacp07869 | R-Lycosin I derivative 8a | RGWFRAMRSIARFIARERLRGHL | Monosaccharide Analogue of Anticancer Peptide R-Lycosin-I | GLUT1-mediated uptake enhances cytotoxicity | CCK-8 assay | HGC-27 | Gastric Cancer | IC50 = 12.6 ± 0.6 µM |
| dbacp07870 | R-Lycosin I derivative 8a | RGWFRAMRSIARFIARERLRGHL | Monosaccharide Analogue of Anticancer Peptide R-Lycosin-I | GLUT1-mediated uptake enhances cytotoxicity | CCK-8 assay | PC-3 | Prostate Cancer | IC50 = 6.9 ± 0.4 µM |
| dbacp07871 | R-Lycosin I derivative 8b | RGWFRAMRSIARFIARERLRGHL | Monosaccharide Analogue of Anticancer Peptide R-Lycosin-I | GLUT1-mediated uptake enhances cytotoxicity | CCK-8 assay | MDA-MB-231 | Breast Cancer | IC50 = 6.0 ± 0.2 µM |
| dbacp07872 | R-Lycosin I derivative 8b | RGWFRAMRSIARFIARERLRGHL | Monosaccharide Analogue of Anticancer Peptide R-Lycosin-I | GLUT1-mediated uptake enhances cytotoxicity | CCK-8 assay | A-549 | Lung Cancer | IC50 = 7.0 ± 0.3 µM |
| dbacp07873 | R-Lycosin I derivative 8b | RGWFRAMRSIARFIARERLRGHL | Monosaccharide Analogue of Anticancer Peptide R-Lycosin-I | GLUT1-mediated uptake enhances cytotoxicity | CCK-8 assay | H-460 | Lung Cancer | IC50 = 4.9 ± 0.9 µM |
| dbacp07874 | R-Lycosin I derivative 8b | RGWFRAMRSIARFIARERLRGHL | Monosaccharide Analogue of Anticancer Peptide R-Lycosin-I | GLUT1-mediated uptake enhances cytotoxicity | CCK-8 assay | H-1437 | Lung Cancer | IC50 = 5.3 ± 0.2 µM |
| dbacp07875 | R-Lycosin I derivative 8b | RGWFRAMRSIARFIARERLRGHL | Monosaccharide Analogue of Anticancer Peptide R-Lycosin-I | GLUT1-mediated uptake enhances cytotoxicity | CCK-8 assay | HGC-27 | Gastric Cancer | IC50 = 5.3 ± 0.2 µM |
| dbacp07876 | R-Lycosin I derivative 8b | RGWFRAMRSIARFIARERLRGHL | Monosaccharide Analogue of Anticancer Peptide R-Lycosin-I | GLUT1-mediated uptake enhances cytotoxicity | CCK-8 assay | PC-3 | Prostate Cancer | IC50 = 4.9 ± 0.2 µM |
| dbacp07985 | R-C16 | RGWFRAMRSIARFIARERLREHL | R-Lycosin-I | Fatty-acid modification enhances peptide apoptosis | CCK-8 assay | A-549 | Lung Cancer | IC50 ~ 5 µM |
| dbacp08014 | Ec-LDP-hBD1 | MANCVVGYIGERCQYRDLKWWELRGGGGSGGGGSAPAFSVSPASGLSDGQSVSVSVSGAAAGETYYIAQCAPVGGQDACNPATATSFTTDASGAASFSFVVRKSYTGSTPEGTPVGSVDCATAACNLGAGNSGLDLGHVALTFGGGGGSGGGGSDHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCKLEHHHHHH | Synthetic | EGFR-targeted defensin induces mitochondrial apoptosis | CCK-8 assay | A-431 | Skin Cancer | IC50 = 1.8 μM |
| dbacp08015 | Ec-LDP-hBD1 | MANCVVGYIGERCQYRDLKWWELRGGGGSGGGGSAPAFSVSPASGLSDGQSVSVSVSGAAAGETYYIAQCAPVGGQDACNPATATSFTTDASGAASFSFVVRKSYTGSTPEGTPVGSVDCATAACNLGAGNSGLDLGHVALTFGGGGGSGGGGSDHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCKLEHHHHHH | Synthetic | EGFR-targeted defensin induces mitochondrial apoptosis | CCK-8 assay | A-549 | Lung Cancer | IC50 = 11.9 μM |
| dbacp08016 | Ec-LDP-hBD1 | MANCVVGYIGERCQYRDLKWWELRGGGGSGGGGSAPAFSVSPASGLSDGQSVSVSVSGAAAGETYYIAQCAPVGGQDACNPATATSFTTDASGAASFSFVVRKSYTGSTPEGTPVGSVDCATAACNLGAGNSGLDLGHVALTFGGGGGSGGGGSDHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCKLEHHHHHH | Synthetic | EGFR-targeted defensin induces mitochondrial apoptosis | CCK-8 assay | H-460 | Lung Cancer | IC50 = 5.19 μM |
| dbacp08017 | Ec-LDP-hBD1 | MANCVVGYIGERCQYRDLKWWELRGGGGSGGGGSAPAFSVSPASGLSDGQSVSVSVSGAAAGETYYIAQCAPVGGQDACNPATATSFTTDASGAASFSFVVRKSYTGSTPEGTPVGSVDCATAACNLGAGNSGLDLGHVALTFGGGGGSGGGGSDHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCKLEHHHHHH | Synthetic | EGFR-targeted defensin induces mitochondrial apoptosis | CCK-8 assay | PG-BE1 | Lung Cancer | IC50 = 31.3 μM |
| dbacp08051 | MEL-Pep | GIGAVLKKLTTGLKALISWIKRKRQQ | Synthetic analog of Melittin | MEL-pep disrupts membrane, inhibits P-gp | CCK-8 assay | BEL-7402/5-FU | Liver Cancer | IC50 = 4.36 μM |
| dbacp08055 | L-FP21-PEG-PEI/pGRO-α | YTRDLVYGDPARPGIQGTGTF | Synthetic | D-FP21 delivers gene, inhibits proliferation | CCK-8 assay | HO-8910 | Ovarian Cancer | IC50 = 23.4 μg/mL |
| dbacp08056 | D-FP21-PEG-PEI/pGRO-α | ytrdlvygdparpgiqgtgtf | Synthetic | D-FP21 delivers gene, inhibits proliferation | CCK-8 assay | HO-8910 | Ovarian Cancer | IC50 = 21.6 μg/mL |
| dbacp08058 | TAT-327 | RKKRRQRRREFLDCFQKF | Peptide-327 | Peptide 327 blocks Eps8–EGFR | CCK-8 assay | A-549 | Lung Cancer | EC50 = 55.42 ± 0.84 μM |
| dbacp08059 | TAT-327 | RKKRRQRRREFLDCFQKF | Peptide-327 | Peptide 327 blocks Eps8–EGFR | CCK-8 assay | HepG-2 | Liver Cancer | EC50 = 68.52 ± 2.96 μM |
| dbacp08060 | TAT-327 | RKKRRQRRREFLDCFQKF | Peptide-327 | Peptide 327 blocks Eps8–EGFR | CCK-8 assay | Colo-320 | Colon Cancer | EC50 = 68.40 ± 0.42 μM |
| dbacp08061 | TAT-327 | RKKRRQRRREFLDCFQKF | Peptide-327 | Peptide 327 blocks Eps8–EGFR | CCK-8 assay | HT-29 | Colon Cancer | EC50 = 74.08 ± 0.63 μM |
| dbacp08062 | TAT-327 | RKKRRQRRREFLDCFQKF | Peptide-327 | Peptide 327 blocks Eps8–EGFR | CCK-8 assay | SW-620 | Colorectal Cancer | EC50 = 64.61 ± 1.63 μM |
| dbacp08063 | E5 | GGRSFFLLRRIQGCRFRNTVDD | Synthetic | E5 inhibits CXCR4–CXCL12 signaling | CCK-8 assay | 4T1 | Breast Cancer | 49% cell viability at 100 μM |
| dbacp08316 | Sample Peptide 1 from US011339203B2 | LTSVVFILICCFHLENIFVLLKKRTLRKNDRKKR | Synthetic | Not Available | CCK-8 assay | CAKI-2 | Renal Cancer | Cell Viability = 48% at 25 μM |
| dbacp08317 | Sample Peptide 2 from US011339203B2 | FIGNLALSDLLAGVAYTANLLLKKRTLRKNDRKKR | Synthetic | Not Available | CCK-8 assay | CAKI-2 | Renal Cancer | Cell Viability = 0.4% at 25 μM |
| dbacp08318 | Sample Peptide 2 from US011339203B2 | FIGNLALSDLLAGVAYTANLLLKKRTLRKNDRKKR | Synthetic | Not Available | CCK-8 assay | PC-3 | Prostate Cancer | Cell Viability = 2.5% at 25 μM |
| dbacp08319 | Sample Peptide 2 from US011339203B2 | FIGNLALSDLLAGVAYTANLLLKKRTLRKNDRKKR | Synthetic | Not Available | CCK-8 assay | A-2058 | Skin Cancer | Cell Viability = 0.2% at 25 μM |
| dbacp08320 | Sample Peptide 2 from US011339203B2 | FIGNLALSDLLAGVAYTANLLLKKRTLRKNDRKKR | Synthetic | Not Available | CCK-8 assay | NCI-H2444 | Lung Cancer | Cell Viability = 0.6% at 25 μM |
| dbacp08321 | Sample Peptide 2 from US011339203B2 | FIGNLALSDLLAGVAYTANLLLKKRTLRKNDRKKR | Synthetic | Not Available | CCK-8 assay | A-549 | Lung Cancer | Cell Viability = 1.4% at 25 μM |
| dbacp08322 | Sample Peptide 3 from US011339203B2 | WFLREGSMFVALSASVFSLLAIKKRTLRKNDRKKR | Synthetic | Not Available | CCK-8 assay | CAKI-2 | Renal Cancer | Cell Viability = 45.8% at 25 μM |
| dbacp08323 | Sample Peptide 4 from US011339203B2 | FLLISACWVISLILGGLPIMGWKKRTLRKNDRKKR | Synthetic | Not Available | CCK-8 assay | CAKI-2 | Renal Cancer | Cell Viability = 85.6% at 25 μM |
| dbacp08324 | Sample Peptide 5 from US011339203B2 | LYHKHYILECTTVFTLLLLSIVILYCRIKKRTLRKNDRKKR | Synthetic | Not Available | CCK-8 assay | CAKI-2 | Renal Cancer | Cell Viability = 77.6% at 25 μM |
| dbacp08325 | Sample Peptide 6 from US011339203B2 | VIIVLSVFIACWAPLFILLLLKKRTLRKNDRKKR | Synthetic | Not Available | CCK-8 assay | CAKI-2 | Renal Cancer | Cell Viability = 59.7% at 25 μM |
| dbacp08326 | Sample Peptide 7 from US011339203B2 | LFRAEYFLVLAVLNSGTNPIIKKRTLRKNDRKKR | Synthetic | Not Available | CCK-8 assay | CAKI-2 | Renal Cancer | Cell Viability = 66.3% at 25 μM |