dbACP: A Comprehensive Database of Anti-Cancer Peptides

245 result(s) have been found!

Accession Name Sequence Source/Organism Mechanism Assay Type Cell Line Cancer Type Activity
dbacp00001 Citropin modified peptide-3 GLFAVIKKVASVIGGL Amphibian skin secretions Penetration and disruption of the membrane Sulforhodamine B assay Leukemia tumor cell line Leukemia cancer IC50 : 6 M
dbacp00010 Citropin modified peptide-5 GLFDVIKAVASVIGGL Amphibian skin secretions Penetration and disruption of the membrane Sulforhodamine B assay Leukemia tumor cell line Leukemia cancer IC50 : 5 M
dbacp00019 Citropin modified peptide-7 GLFDVIKKVAAVIGGL Amphibian skin secretions Penetration and disruption of the membrane Sulforhodamine B assay Leukemia tumor cell line Leukemia cancer IC50 : 5 M
dbacp00098 Citropin modified peptide-11 GLFDVIKKVASVIKGL Amphibian skin secretions Penetration and disruption of the membrane Sulforhodamine B assay Leukemia tumor cell line Leukemia cancer IC50 : 5 M
dbacp00107 Citropin modified peptide-13 GLFDVIKKVASVIKKL Amphibian skin secretions Penetration and disruption of the membrane Sulforhodamine B assay Leukemia tumor cell line Leukemia cancer IC50 : 5 M
dbacp00116 Citropin modified peptide-14 GLFDVIAKVASVIKKL Amphibian skin secretions Penetration and disruption of the membrane Sulforhodamine B assay Leukemia tumor cell line Leukemia cancer IC50 : 5 M
dbacp00150 Citropin modified peptide-15 GLFAVIKKVASVIKGL Amphibian skin secretions Penetration and disruption of the membrane Sulforhodamine B assay Leukemia tumor cell line Leukemia cancer IC50 : 5 M
dbacp00183 Citropin modified peptide-16 GLFAVIKKVASVIKKL Amphibian skin secretions Penetration and disruption of the membrane Sulforhodamine B assay Leukemia tumor cell line Leukemia cancer IC50 : 5 M
dbacp00217 Citropin modified peptide-17 GLFAVIKKVAAVIKKL Amphibian skin secretions Penetration and disruption of the membrane Sulforhodamine B assay Leukemia tumor cell line Leukemia cancer IC50 : 5 M
dbacp00252 Citropin modified peptide-18 GLFAVIKKVAAVIRRL Amphibian skin secretions Penetration and disruption of the membrane Sulforhodamine B assay Leukemia tumor cell line Leukemia cancer IC50 : 5 M
dbacp00261 Citropin modified peptide-19 GLFAVIKKVAKVIKKL Amphibian skin secretions Penetration and disruption of the membrane Sulforhodamine B assay Leukemia tumor cell line Leukemia cancer IC50 : 5 M
dbacp00270 Citropin modified peptide-22 GLFKVIKKVASVIGGL Amphibian skin secretions Penetration and disruption of the membrane Sulforhodamine B assay Leukemia tumor cell line Leukemia cancer IC50 : 5 M
dbacp00292 Citropin modified peptide-23 GLFKVIKKVAKVIKKL Amphibian skin secretions Penetration and disruption of the membrane Sulforhodamine B assay Leukemia tumor cell line Leukemia cancer IC50 : 5 M
dbacp00572 [L9]-P18 KWKLFKKILKFLHLAKKF Ceropin A Cell membrane disintegration MTT/MTS assay K-562 Leukemia cancer IC50 : 3 µM
dbacp00620 [S9]-P18 KWKLFKKISKFLHLAKKF Ceropin A Cell membrane disintegration MTT/MTS assay K-562 Leukemia cancer IC50 : 3 µM
dbacp01252 Aurein 3.1 GLFDIVKKIAGHIAGSI Southern bell frog, Australia Cell membrane disruption Not specified Leukemia tumor cell line Leukemia cancer LC50 : 10 µM
dbacp01261 Aurein 3.1 GLFDIVKKIAGHIAGSI Southern bell frog, Australia Cell membrane disruption Not specified Leukemia tumor cell line Leukemia cancer LC50 : 10 µM
dbacp01271 Aurein 3.2 GLFDIVKKIAGHIASSI Southern bell frog, Australia Cell membrane disruption Not specified Leukemia tumor cell line Leukemia cancer LC50 : 10 µM
dbacp01281 Aurein 3.3 GLFDIVKKIAGHIVSSI Southern bell frog, Australia Cell membrane disruption Not specified Leukemia tumor cell line Leukemia cancer LC50 : 10-100 µM
dbacp01406 Aurein1.2 GLFDIIKKIAESF Southern bell frog Cell membrane disruption Not specified Leukemia tumor cell line Leukemia cancer LC50 : 10-100 µM
dbacp01415 Aurein2.5 GLFDIVKKVVGAFGSL Southern bell frog Cell membrane disruption Not specified Leukemia tumor cell line Leukemia cancer LC50 : 10-100 µM
dbacp01424 Aurein2.6 GLFDIAKKVIGVIGSL Southern bell frog Cell membrane disruption Not specified Leukemia tumor cell line Leukemia cancer LC50 : 10-100 µM
dbacp01989 Buforin IIb RAGLQFPVGRLLRRLLRRLLR Histone H2A Inducing mitochondria-dependent apoptosis MTT/MTS assay CCRF-CEM Leukemia cancer IC50 : 14.7 µg/ml
dbacp01990 Buforin IIb RAGLQFPVGRLLRRLLRRLLR Histone H2A Inducing mitochondria-dependent apoptosis MTT/MTS assay HL-60 Leukemia cancer IC50 : 11.3 µg/ml
dbacp01991 Buforin IIb RAGLQFPVGRLLRRLLRRLLR Histone H2A Inducing mitochondria-dependent apoptosis MTT/MTS assay K-562 Leukemia cancer IC50 : 8.2 µg/ml
dbacp01992 Buforin IIb RAGLQFPVGRLLRRLLRRLLR Histone H2A Inducing mitochondria-dependent apoptosis MTT/MTS assay MOLT-4 Leukemia cancer IC50 : 17 µg/ml
dbacp01993 Buforin IIb RAGLQFPVGRLLRRLLRRLLR Histone H2A Inducing mitochondria-dependent apoptosis MTT/MTS assay RPMI-8226 Leukemia cancer IC50 : 10.5 µg/ml
dbacp01994 Buforin IIb RAGLQFPVGRLLRRLLRRLLR Histone H2A Inducing mitochondria-dependent apoptosis MTT/MTS assay SR Leukemia cancer IC50 : 20.2 µg/ml
dbacp02115 C-1 KWKLFKKIPFLHLAKKF Ceropin A Cell membrane disintegration MTT/MTS assay K-562 Leukemia cancer IC50 : 31 µM
dbacp02118 C-10 KWKLFKKIPKFLH Ceropin A Cell membrane disintegration MTT/MTS assay K-562 Leukemia cancer IC50 : <100 µM
dbacp02121 C-2 KWKLFKKIPKFLHLAKK Ceropin A Cell membrane disintegration MTT/MTS assay K-562 Leukemia cancer IC50 : 23 µM
dbacp02124 C-3 KWKLFKKIPLHLAKKF Ceropin A Cell membrane disintegration MTT/MTS assay K-562 Leukemia cancer IC50 : 62 µM
dbacp02127 C-4 KWKLFKKIPKFLHLAK Ceropin A Cell membrane disintegration MTT/MTS assay K-562 Leukemia cancer IC50 : 25 µM
dbacp02130 C-5 KWKLFKKIPHLAKKF Ceropin A Cell membrane disintegration MTT/MTS assay K-562 Leukemia cancer IC50 : 67 µM
dbacp02133 C-6 KWKLFKKIPKFLHLA Ceropin A Cell membrane disintegration MTT/MTS assay K-562 Leukemia cancer IC50 : 27 µM
dbacp02136 C-7 KWKLFKKIPLAKKF Ceropin A Cell membrane disintegration MTT/MTS assay K-562 Leukemia cancer IC50 : <100 µM
dbacp02139 C-8 KWKLFKKIPKFLHL Ceropin A Cell membrane disintegration MTT/MTS assay K-562 Leukemia cancer IC50 : 30 µM
dbacp02142 C-9 KWKLFKKIPLKKF Ceropin A Cell membrane disintegration MTT/MTS assay K-562 Leukemia cancer IC50 : <100 µM
dbacp02231 CA-MA KWKLFKKIGIGKFLHSAKKF Ceropin-African clawed frog hybrid peptides Cell membrane disintegration MTT/MTS assay K-562 Leukemia cancer IC50 : 65 µM
dbacp02240 CA-MA-P KWKLFKKIPKFLHSAKKF Ceropin A Cell membrane disintegration MTT/MTS assay K-562 Leukemia cancer IC50 : 25 µM
dbacp02241 CA-MA1 KWKLFKKIKFLHSAKKF Ceropin-African clawed frog hybrid peptides Cell membrane disintegration MTT/MTS assay K-562 Leukemia cancer IC50 : 85.3 µM
dbacp02245 CA-MA2 KWKLFKKIPKFLHSAKKF Ceropin-African clawed frog hybrid peptides Cell membrane disintegration MTT/MTS assay K-562 Leukemia cancer IC50 : 35.1 µM
dbacp02249 CA-MA3 KWKLFKKIGPGKFLHSAKKF Ceropin-African clawed frog hybrid peptides Cell membrane disintegration MTT/MTS assay K-562 Leukemia cancer IC50 : >100 µM
dbacp02323 Cecropin 2 GWLKKIGKKIERVGQHTRDATIQTIGVAQQAANVAATLK The Medfly, also housefly Cell membrane disintegration Not specified Not found Leukemia cancer Not found
dbacp02324 Cecropin 2 GWLKKIGKKIERVGQHTRDATIQTIGVAQQAANVAATLK Mediterranean fruit fly Not specified Not specified Not found Leukemia cancer Not found
dbacp02325 Cecropin 2 GWLKKIGKKIERVGQHTRDATIQTIGVAQQAANVAATLK The Medfly, also housefly Cell membrane disintegration Not specified Not found Leukemia cancer Not found
dbacp02357 Cecropin B KWKVFKKIEKMGRNIRNGIVKAGPAIAVLGEAKAL Silkmoth Pore formation at the cytoplasmic membrane MTT/MTS assay K-562 Leukemia cancer IC50 : 15.5 µM
dbacp02361 Cecropin B KWKVFKKIEKMGRNIRNGIVKAGPAIAVLGEAKAL Silkmoth Pore formation at the cytoplasmic membrane MTT/MTS assay WEHI-3B Leukemia cancer IC50 : 4.4 µM
dbacp02371 Cecropin P1 SWLSKTAKKLENSAKKRISEGIAIAIQGGPR Small Intestine of Pig Pore formation at the cytoplasmic membrane MTT/MTS assay K-562 Leukemia cancer IC50 : 93 µM
dbacp02377 Cepafungin complex I-C28H46N4O6,II-C27H44N4O6,III-C26H42N4O6 Culture broth of strain, common, free-living bacterium, **Pseudomonas sp.** Not specified Not specified P-388 Leukemia cancer Not found
dbacp02488 Citropin 1.1 GLFDVIKKVASVIGGL Amphibian skin secretions Penetration and disruption of the membranes Sulforhodamine B assay Leukemia tumor cell line Leukemia cancer IC50 : 5 M
dbacp02499 Citropin 1.1D glfdvikkvasviggl Amphibian skin secretions Penetration and disruption of the membranes Sulforhodamine B assay Leukemia tumor cell line Leukemia cancer IC50 : 5 M
dbacp02594 Cyclic [W(RW)4 ]-Dox WRWRWRWRW Not found Inhibition of the cell proliferation MTT/MTS assay CCRF-CEM Leukemia cancer 62-73% inhibition of cell proliferation at 1 µM
dbacp02805 Dolastatin 10 2-[[2-(dimethylamino)-3-methylbutanoyl]amino]-N-[3-methoxy-1-[2-[1-methoxy-2-methyl-3-oxo-3-[[2-phenyl-1-(1,3-thiazol-2-yl)ethyl]amino]propyl]pyrrolidin-1-yl]-5-methyl-1-oxoheptan-4-yl]-N,3-dimethylbutaNAmide Wedge sea hare Apoptosis inducing Cell viability assay SR Leukemia cancer IC50 : 0.0013 - 0.013 nM
dbacp02809 Dolastatin 15 VV-nMe-VPP-2hydroxyisovaleryl-2-oxo-4-methoxy-5-benzyl-3-pyrroline Wedge sea hare Apoptosis inducing Cell viability assay SR Leukemia cancer IC50 : 0.0013 - 0.013 nM
dbacp03191 HAL-1 GMWSKILGHLIR Sweat bees and their analogs Cell membrane damage MTT/MTS assay CCRF-CEM Leukemia cancer IC50 : 49 ± 9 µM
dbacp03194 HAL-1/10 GMWKKILGKLIR Sweat bees and their analogs Cell membrane damage MTT/MTS assay CCRF-CEM Leukemia cancer Not found
dbacp03197 HAL-1/12 GKWSKILGHLIR Sweat bees and their analogs Cell membrane damage MTT/MTS assay CCRF-CEM Leukemia cancer IC50 : > 40 µM
dbacp03200 HAL-1/15 GMWSKLLGHLLR Sweat bees and their analogs Cell membrane damage MTT/MTS assay CCRF-CEM Leukemia cancer IC50 : > 40 µM
dbacp03203 HAL-1/17 KMWSKILGHLIR Sweat bees and their analogs Cell membrane damage MTT/MTS assay CCRF-CEM Leukemia cancer Not found
dbacp03206 HAL-1/18 GMWSKILKHLIR Sweat bees and their analogs Cell membrane damage MTT/MTS assay CCRF-CEM Leukemia cancer Not found
dbacp03209 HAL-1/19 GKWKKILGHLIR Sweat bees and their analogs Cell membrane damage MTT/MTS assay CCRF-CEM Leukemia cancer Not found
dbacp03212 HAL-1/20 GKWSKILGKLIR Sweat bees and their analogs Cell membrane damage MTT/MTS assay CCRF-CEM Leukemia cancer IC50 : > 40 µM
dbacp03215 HAL-1/21 GKWKKILGKLIR Sweat bees and their analogs Cell membrane damage MTT/MTS assay CCRF-CEM Leukemia cancer Not found
dbacp03218 HAL-1/22 gmwskilghlir Sweat bees and their analogs Cell membrane damage MTT/MTS assay CCRF-CEM Leukemia cancer Not found
dbacp03221 HAL-1/29 GMWSKILGHLIR Sweat bees and their analogs Cell membrane damage MTT/MTS assay CCRF-CEM Leukemia cancer Not found
dbacp03224 HAL-1/4 GMWSKILGHLKR Sweat bees and their analogs Cell membrane damage MTT/MTS assay CCRF-CEM Leukemia cancer Not found
dbacp03227 HAL-1/5 GMWKKILGHLIR Sweat bees and their analogs Cell membrane damage MTT/MTS assay CCRF-CEM Leukemia cancer IC50 : > 40 µM
dbacp03230 HAL-1/6 GMWSKILGHLIK Sweat bees and their analogs Cell membrane damage MTT/MTS assay CCRF-CEM Leukemia cancer Not found
dbacp03233 HAL-1/9 GMWSKILGKLIR Sweat bees and their analogs Cell membrane damage MTT/MTS assay CCRF-CEM Leukemia cancer IC50 : 30 ± 10 µM
dbacp03236 HAL-2 GKWMSLLKHILK Sweat bees and their analogs Cell membrane damage MTT/MTS assay CCRF-CEM Leukemia cancer IC50 : 34 µM
dbacp03239 HAL-2/1 GKWKSLLKHILK Sweat bees and their analogs Cell membrane damage MTT/MTS assay CCRF-CEM Leukemia cancer IC50 : > 40 µM
dbacp03242 HAL-2/11 GKWLSLLKHILK Sweat bees and their analogs Cell membrane damage MTT/MTS assay CCRF-CEM Leukemia cancer Not found
dbacp03245 HAL-2/13 GKWMTLLKHILK Sweat bees and their analogs Cell membrane damage MTT/MTS assay CCRF-CEM Leukemia cancer Not found
dbacp03248 HAL-2/18 GKWMSLLKHIWK Sweat bees and their analogs Cell membrane damage MTT/MTS assay CCRF-CEM Leukemia cancer Not found
dbacp03251 HAL-2/19 GKWMSLLKHWLK Sweat bees and their analogs Cell membrane damage MTT/MTS assay CCRF-CEM Leukemia cancer Not found
dbacp03254 HAL-2/2 GKWMKLLKHILK Sweat bees and their analogs Cell membrane damage MTT/MTS assay CCRF-CEM Leukemia cancer IC50 : > 40 µM
dbacp03257 HAL-2/20 GKWMSLWKHILK Sweat bees and their analogs Cell membrane damage MTT/MTS assay CCRF-CEM Leukemia cancer Not found
dbacp03260 HAL-2/22 gkwmsllkhilk Sweat bees and their analogs Cell membrane damage MTT/MTS assay CCRF-CEM Leukemia cancer Not found
dbacp03263 HAL-2/24 GKFMSLLKHILK Sweat bees and their analogs Cell membrane damage MTT/MTS assay CCRF-CEM Leukemia cancer Not found
dbacp03266 HAL-2/4 GKWMSLLKKILK Sweat bees and their analogs Cell membrane damage MTT/MTS assay CCRF-CEM Leukemia cancer Not found
dbacp03269 HAL-2/6 GKWMSFLKHILK Sweat bees and their analogs Cell membrane damage MTT/MTS assay CCRF-CEM Leukemia cancer Not found
dbacp03272 HAL-2/8 GKWMSLLKHILK Sweat bees and their analogs Cell membrane damage MTT/MTS assay CCRF-CEM Leukemia cancer Not found
dbacp03709 Laxaphycin A Aoc-Hse-E-Dhb-Hyp-Hse-FLIILG Terrestrial blue-green alga or the marine cyanobacterium Not specified Cell viability assay CEM-WT Leukemia cancer No inhibition at 4 µM
dbacp03710 Laxaphycin A Aoc-Hse-E-Dhb-Hyp-Hse-FLIILG Terrestrial blue-green alga or the marine cyanobacterium Not specified Cell viability assay CEM-VLB Leukemia cancer No inhibition at 4 µM
dbacp03711 Laxaphycin A Aoc-Hse-E-Dhb-Hyp-Hse-FLIILG Terrestrial blue-green alga or the marine cyanobacterium Not specified Cell viability assay CEM-VM1 Leukemia cancer No inhibition at 4 µM
dbacp03712 Laxaphycin B A-Hleu-QN-MeIle-Hasn-TPLT-Ade-V-Hleu Terrestrial blue-green alga or the marine cyanobacterium Not specified Cell viability assay CEM-WT Leukemia cancer 50% inhibition at 1 µM
dbacp03713 Laxaphycin B A-Hleu-QN-MeIle-Hasn-TPLT-Ade-V-Hleu Terrestrial blue-green alga or the marine cyanobacterium Not specified Cell viability assay CEM-WT Leukemia cancer 44% inhibition at 1 µM
dbacp03714 Laxaphycin B A-Hleu-QN-MeIle-Hasn-TPLT-Ade-V-Hleu Terrestrial blue-green alga or the marine cyanobacterium Not specified Cell viability assay CEM-VM1 Leukemia cancer 44% inhibition at 1 µM
dbacp03715 Laxaphycin B A-Hleu-QN-MeIle-Hasn-TPLT-Ade-V-Hleu Terrestrial blue-green alga or the marine cyanobacterium Not specified Cell viability assay CEM-VLB Leukemia cancer 44% inhibition at 1 µM
dbacp03716 Laxaphycin B A-Hleu-QN-MeIle-Hasn-TPLT-Ade-V-Hleu Terrestrial blue-green alga or the marine cyanobacterium Not specified Cell viability assay CEM-WT Leukemia cancer 40% inhibition at 1 µM
dbacp03717 Laxaphycin B A-Hleu-QN-MeIle-Hasn-TPLT-Ade-V-Hleu Terrestrial blue-green alga or the marine cyanobacterium Not specified Cell viability assay CEM-VM1 Leukemia cancer 40% inhibition at 1 µM
dbacp03718 Laxaphycin B A-Hleu-QN-MeIle-Hasn-TPLT-Ade-V-Hleu Terrestrial blue-green alga or the marine cyanobacterium Not specified Cell viability assay CEM-VLB Leukemia cancer 40% inhibition at 1 µM
dbacp04103 linear (RW)4-Dox RWRWRWRW Doxorubicin (Dox) is a well-known anthracycline which has been conjugated to a CPP Inhibition of the cell proliferation MTT/MTS assay CCRF-CEM Leukemia cancer 46-69% anti-proliferative activity at 1 µM
dbacp04182 LL-III VNWKKILGKIIKVVK Lasioglossin III and its analogs Cell membrane damage MTT/MTS assay CCRF-CEM Leukemia cancer IC50 : 5 ± 3 µM
dbacp04185 LL-III/1 VNWKKILAKIIKVVK Lasioglossin III and its analogs Cell membrane damage MTT/MTS assay CCRF-CEM Leukemia cancer IC50 : 3 ± 1 µM
dbacp04188 LL-III/10 KNWKKILGKIIKVVK Lasioglossin III and its analogs Cell membrane damage MTT/MTS assay CCRF-CEM Leukemia cancer IC50 : 9 µM
dbacp04191 LL-III/11 VNWKKIILGKIIKVVK Lasioglossin III and its analogs Cell membrane damage MTT/MTS assay CCRF-CEM Leukemia cancer IC50 : 4 ± 1 µM
dbacp04194 LL-III/12 vnwkkilgkiikvvk Lasioglossin III and its analogs Cell membrane damage MTT/MTS assay CCRF-CEM Leukemia cancer IC50 : 5 ± 2 µM
dbacp04197 LL-III/15 VNFKKLLGKLLKVVK Lasioglossin III and its analogs Cell membrane damage MTT/MTS assay CCRF-CEM Leukemia cancer IC50 : 9 ± 3 µM
dbacp04200 LL-III/16 VN-NAl-KKLLGKLLKVVK Lasioglossin III and its analogs Cell membrane damage MTT/MTS assay CCRF-CEM Leukemia cancer Not found
dbacp04203 LL-III/17 VNWRRILGRIIRVVR Lasioglossin III and its analogs Cell membrane damage MTT/MTS assay CCRF-CEM Leukemia cancer Not found
dbacp04206 LL-III/18 KNWKKILKKIIKVVK Lasioglossin III and its analogs Cell membrane damage MTT/MTS assay CCRF-CEM Leukemia cancer IC50 : 7 ± 2 µM
dbacp04209 LL-III/19 VNWKK-Aib-LGK-Aib-IK-Aib-VK Lasioglossin III and its analogs Cell membrane damage MTT/MTS assay CCRF-CEM Leukemia cancer IC50 : 8 ± 2 µM
dbacp04212 LL-III/2 NVWKKILGKIIKVVK Lasioglossin III and its analogs Cell membrane damage MTT/MTS assay CCRF-CEM Leukemia cancer IC50 : 7 ± 2 µM
dbacp04215 LL-III/22 KNWKK-Aib-LKK-Aib-IK-Aib-VK Lasioglossin III and its analogs Cell membrane damage MTT/MTS assay CCRF-CEM Leukemia cancer IC50 : 25 ± 4 µM
dbacp04218 LL-III/23 VNWKKLLGKLLKVVK Lasioglossin III and its analogs Cell membrane damage MTT/MTS assay CCRF-CEM Leukemia cancer IC50 : 6 µM
dbacp04221 LL-III/24 VNWOOILGOIIOVVO Lasioglossin III and its analogs Cell membrane damage MTT/MTS assay CCRF-CEM Leukemia cancer IC50 : 5 ± 2 µM
dbacp04224 LL-III/25 vnwkkllgkllkvvk Lasioglossin III and its analogs Cell membrane damage MTT/MTS assay CCRF-CEM Leukemia cancer IC50 : 4 µM
dbacp04227 LL-III/26 VYWKKILGKIIKVVK Lasioglossin III and its analogs Cell membrane damage MTT/MTS assay CCRF-CEM Leukemia cancer IC50 : 6 µM
dbacp04230 LL-III/27 VNWKKVLGKVVKVVK Lasioglossin III and its analogs Cell membrane damage MTT/MTS assay CCRF-CEM Leukemia cancer IC50 : 18 µM
dbacp04233 LL-III/3 VNWKKILKKIIKVVK Lasioglossin III and its analogs Cell membrane damage MTT/MTS assay CCRF-CEM Leukemia cancer Not found
dbacp04236 LL-III/34 NKWKKILGKIIKVVK Lasioglossin III and its analogs Cell membrane damage MTT/MTS assay CCRF-CEM Leukemia cancer IC50 : 5 ± 3 µM
dbacp04239 LL-III/36 VNWKKILAKIIKVVK Lasioglossin III and its analogs Cell membrane damage MTT/MTS assay CCRF-CEM Leukemia cancer Not found
dbacp04242 LL-III/37 VNWKKILGKIIKVVK Lasioglossin III and its analogs Cell membrane damage MTT/MTS assay CCRF-CEM Leukemia cancer IC50 : 4 ± 1 µM
dbacp04245 LL-III/4 VNWKKILGKIKKVVK Lasioglossin III and its analogs Cell membrane damage MTT/MTS assay CCRF-CEM Leukemia cancer IC50 : 18 µM
dbacp04248 LL-III/6 VNWKKILPKIIKVVK Lasioglossin III and its analogs Cell membrane damage MTT/MTS assay CCRF-CEM Leukemia cancer IC50 : 6 ± 3 µM
dbacp04251 LL-III/8 VNWKKILGKIIKVVK Lasioglossin III and its analogs Cell membrane damage MTT/MTS assay CCRF-CEM Leukemia cancer IC50 : 9 µM
dbacp04254 LL-III/9 VNWKKILGKIIKVVK Lasioglossin III and its analogs Cell membrane damage MTT/MTS assay CCRF-CEM Leukemia cancer Not found
dbacp04378 MAC1 GFGMALKLLKKVL Wallabies and their analogs Cell membrane damage MTT/MTS assay CCRF-CEM Leukemia cancer IC50 : 12 ± 6 µM
dbacp04381 MAC1/1 gfgmalkllkkvl Wallabies and their analogs Cell membrane damage MTT/MTS assay CCRF-CEM Leukemia cancer IC50 : 11 µM
dbacp04384 MAC1/10 GFKMALKLLKKVL Wallabies and their analogs Cell membrane damage MTT/MTS assay CCRF-CEM Leukemia cancer IC50 : 16 µM
dbacp04387 MAC1/16 GFGMALKLLKKVL-NH2 Wallabies and their analogs Cell membrane damage MTT/MTS assay CCRF-CEM Leukemia cancer IC50 : 70 µM
dbacp04390 MAC1/19 GFGMALKLLKKVL-NH2 Wallabies and their analogs Cell membrane damage MTT/MTS assay CCRF-CEM Leukemia cancer IC50 : 43 ± 11 µM
dbacp04393 MAC1/2 AFGMALKLLKKVL Wallabies and their analogs Cell membrane damage MTT/MTS assay CCRF-CEM Leukemia cancer IC50 : 17 µM
dbacp04396 MAC1/20 GFGMALOLLOOVL Wallabies and their analogs Cell membrane damage MTT/MTS assay CCRF-CEM Leukemia cancer IC50 : 25 ± 3 µM
dbacp04399 MAC1/21 GFGMALRLLRRVL Wallabies and their analogs Cell membrane damage MTT/MTS assay CCRF-CEM Leukemia cancer IC50 : 22 ± 4 µM
dbacp04402 MAC1/24 GFGMALKL-(AC6C)-KKVL Wallabies and their analogs Cell membrane damage MTT/MTS assay CCRF-CEM Leukemia cancer IC50 : 11 µM
dbacp04405 MAC1/25 GFGMALK-(AC6C)-LKKVL Wallabies and their analogs Cell membrane damage MTT/MTS assay CCRF-CEM Leukemia cancer IC50 : 12 ± 2 µM
dbacp04408 MAC1/26 GFGMA-(AC6C)-KLLKKVL Wallabies and their analogs Cell membrane damage MTT/MTS assay CCRF-CEM Leukemia cancer IC50 : 9 ± 2 µM
dbacp04411 MAC1/3 LFGMALKLLKKVL Wallabies and their analogs Cell membrane damage MTT/MTS assay CCRF-CEM Leukemia cancer IC50 : 22 µM
dbacp04414 MAC1/4 GFGMALKLLKKVL-NH2 Wallabies and their analogs Cell membrane damage MTT/MTS assay CCRF-CEM Leukemia cancer IC50 : 29 µM
dbacp04417 MAC1/6 GFGMALKLLKKVL-NH2 Wallabies and their analogs Cell membrane damage MTT/MTS assay CCRF-CEM Leukemia cancer IC50 : 15 µM
dbacp04420 MAC1/9 GFKMALKLLKKVL-NH2 Wallabies and their analogs Cell membrane damage MTT/MTS assay CCRF-CEM Leukemia cancer IC50 : 14 ± 4 µM
dbacp04423 MAC2 GTGLPMSERRKIMLMMR Wallabies and their analogs Cell membrane damage MTT/MTS assay CCRF-CEM Leukemia cancer IC50 : 32 µM
dbacp04488 Magainin 2 GIGKFLHSAKKFGKAFVGEIMNS African clawed frog Dissipate ion gradients; Induce osmotic lysis; Membrane damage Trypan blue assay 8402 Leukemia cancer IC50 : >150 µg/ml
dbacp04491 Magainin 2 GIGKFLHSAKKFGKAFVGEIMNS African clawed frog Dissipate ion gradients; Induce osmotic lysis; Membrane damage Trypan blue assay MLA Leukemia cancer IC50 : >150 µg/ml
dbacp04493 Magainin 2 GIGKFLHSAKKFGKAFVGEIMNS African clawed frog Dissipate ion gradients; Induce osmotic lysis; Membrane damage Trypan blue assay K-562 Leukemia cancer IC50 : >150 µg/ml
dbacp04506 Magainin A AIGKFLHSAKKFGKAFVGEIMNS African clawed frog Dissipate ion gradients; Induce osmotic lysis; Membrane damage Trypan blue assay 8402 Leukemia cancer IC50 : 18 µg/ml
dbacp04509 Magainin A AIGKFLHSAKKFGKAFVGEIMNS African clawed frog Dissipate ion gradients; Induce osmotic lysis; Membrane damage Trypan blue assay MLA Leukemia cancer IC50 : 34 µg/ml
dbacp04511 Magainin A AIGKFLHSAKKFGKAFVGEIMNS African clawed frog Dissipate ion gradients; Induce osmotic lysis; Membrane damage Trypan blue assay K-562 Leukemia cancer IC50 : 40 µg/ml
dbacp04516 Magainin B GIGKFLHAAKKFAKAFVAEIMNS African clawed frog Dissipate ion gradients; Induce osmotic lysis; Membrane damage Trypan blue assay 8402 Leukemia cancer IC50 : 12 µg/ml
dbacp04519 Magainin B GIGKFLHAAKKFAKAFVAEIMNS African clawed frog Dissipate ion gradients; Induce osmotic lysis; Membrane damage Trypan blue assay MLA Leukemia cancer IC50 : 30 µg/ml
dbacp04521 Magainin B GIGKFLHAAKKFAKAFVAEIMNS African clawed frog Dissipate ion gradients; Induce osmotic lysis; Membrane damage Trypan blue assay K-562 Leukemia cancer IC50 : 32 µg/ml
dbacp04532 Magainin G GIGKFLHSAKKFAKAFVAEIMNS African clawed frog Dissipate ion gradients; Induce osmotic lysis; Membrane damage Trypan blue assay 8402 Leukemia cancer IC50 : 16 µg/ml
dbacp04535 Magainin G GIGKFLHSAKKFAKAFVAEIMNS African clawed frog Dissipate ion gradients; Induce osmotic lysis; Membrane damage Trypan blue assay MLA Leukemia cancer IC50 : 33 µg/ml
dbacp04537 Magainin G GIGKFLHSAKKFAKAFVAEIMNS African clawed frog Dissipate ion gradients; Induce osmotic lysis; Membrane damage Trypan blue assay K-562 Leukemia cancer IC50 :37 µg/ml
dbacp04607 Maximin1 GIGTKILGGVKTALKGALKELASTYAN Yunnan firebelly toad Not specified MTT/MTS assay C8166 Leukemia cancer IC50 : 15.3 µg/ml
dbacp04608 Maximin1 GIGTKILGGVKTALKGALKELASTYAN Yunnan firebelly toad Not specified MTT/MTS assay MOLT-4 Leukemia cancer IC50 : 24.3 µg/ml
dbacp04611 Maximin3 GIGGKILSGLKTALKGAAKELASTYLH Yunnan firebelly toad Not specified MTT/MTS assay C8166 Leukemia cancer IC50 : 11.4 µg/ml
dbacp04612 Maximin3 GIGGKILSGLKTALKGAAKELASTYLH Yunnan firebelly toad Not specified MTT/MTS assay MOLT-4 Leukemia cancer IC50 : 25.2 µg/ml
dbacp04615 Maximin4 GIGVLLSAGKAALKGLAKVLAEKYAN Yunnan firebelly toad Not specified MTT/MTS assay C8166 Leukemia cancer IC50 : 24.2 µg/ml
dbacp04616 Maximin4 GIGVLLSAGKAALKGLAKVLAEKYAN Yunnan firebelly toad Not specified MTT/MTS assay MOLT-4 Leukemia cancer IC50 : 53.4 µg/ml
dbacp04619 Maximin5 SIGAKILGGVKTFFKGALKELASTYLQ Yunnan firebelly toad Not specified MTT/MTS assay C8166 Leukemia cancer IC50 : 34.4 µg/ml
dbacp04620 Maximin5 SIGAKILGGVKTFFKGALKELASTYLQ Yunnan firebelly toad Not specified MTT/MTS assay MOLT-4 Leukemia cancer IC50 : >50 µg/ml
dbacp04732 N-1 WKLFKKIPKFLHLAKKF Ceropin A Cell membrane disintegration MTT/MTS assay K-562 Leukemia cancer IC50 : 6 µM
dbacp04735 N-2 FKLFKKIPKFLHLAKKF Ceropin A Cell membrane disintegration MTT/MTS assay K-562 Leukemia cancer IC50 : 7 µM
dbacp04738 N-3 KWFKKIPKFLHLAKKF Ceropin A Cell membrane disintegration MTT/MTS assay K-562 Leukemia cancer IC50 : 11 µM
dbacp04741 N-3L KWFKKIPKFLHLLKKF Ceropin A Cell membrane disintegration MTT/MTS assay K-562 Leukemia cancer IC50 : 4.2 µM
dbacp04744 N-4 WFKKIPKFLHLAKKF Ceropin A Cell membrane disintegration MTT/MTS assay K-562 Leukemia cancer IC50 : 24 µM
dbacp04747 N-4L WFKKIPKFLHLLKKF Ceropin A Cell membrane disintegration MTT/MTS assay K-562 Leukemia cancer IC50 : 3 µM
dbacp04750 N-5 WKKIPKFLHLAKKF Ceropin A Cell membrane disintegration MTT/MTS assay K-562 Leukemia cancer IC50 : < 100 µM
dbacp04753 N-5L WKKIPKFLHLLKKF Ceropin A Cell membrane disintegration MTT/MTS assay K-562 Leukemia cancer IC50 :10 µM
dbacp04867 NK-2 KILRGVCKKIMRTFLRRISKDILTGKK NK-lysin Cell membrane disintegration PI-uptake assay SW-480 Leukemia cancer LD50 : 1-4 µM
dbacp05050 P18 KWKFKKIPKFLHLAKKF Ceropin A Cell membrane disintegration MTT/MTS assay K-562 Leukemia cancer IC50 : 3.5 µM
dbacp05246 Pep27 MRKEFHNVLSSGQLLADKRPARDYNRK Pneumococcus Apoptosis inducing MTT/MTS assay AML-2 Leukemia cancer Not found
dbacp05247 Pep27 MRKEFHNVLSSGQLLADKRPARDYNRK Pneumococcus Apoptosis inducing MTT/MTS assay HL-60 Leukemia cancer IC50 : > 70 µM
dbacp05282 Pep27anal1 MWKWFHNVLSSWQLLADKRPARDYNRK Pneumococcus Apoptosis inducing MTT/MTS assay AML-2 Leukemia cancer IC50 : 50 µM
dbacp05283 Pep27anal1 MWKWFHNVLSSWQLLADKRPARDYNRK Pneumococcus Apoptosis inducing MTT/MTS assay HL-60 Leukemia cancer IC50 : 53 µM
dbacp05287 Pep27anal2 MWKWFHNVLSWWWLLADKRPARDYNRK Pneumococcus Apoptosis inducing MTT/MTS assay AML-2 Leukemia cancer IC50 : 29 µM
dbacp05288 Pep27anal2 MWKWFHNVLSWWWLLADKRPARDYNRK Pneumococcus Apoptosis inducing MTT/MTS assay HL-60 Leukemia cancer IC50 : 20 µM
dbacp05292 Pep27anal3 MRKWFHNVLSSGQLLADKWPAWDYNRK Pneumococcus Apoptosis inducing MTT/MTS assay AML-2 Leukemia cancer IC50 : 67 µM
dbacp05293 Pep27anal3 MRKWFHNVLSSGQLLADKWPAWDYNRK Pneumococcus Apoptosis inducing MTT/MTS assay HL-60 Leukemia cancer IC50 : 52 µM
dbacp05297 Pep27anal4 MWKEFHNVLSSGQLLADKRWARWYNRW Pneumococcus Apoptosis inducing MTT/MTS assay AML-2 Leukemia cancer IC50 : 50 µM
dbacp05298 Pep27anal4 MWKEFHNVLSSGQLLADKRWARWYNRW Pneumococcus Apoptosis inducing MTT/MTS assay HL-60 Leukemia cancer IC50 : 51 µM
dbacp05302 Pep27anal5 MWKWFHNVLSSGQLLADKWWAWWYNWW Pneumococcus Apoptosis inducing MTT/MTS assay AML-2 Leukemia cancer IC50 : >70 µM
dbacp05303 Pep27anal5 MWKWFHNVLSSGQLLADKWWAWWYNWW Pneumococcus Apoptosis inducing MTT/MTS assay HL-60 Leukemia cancer IC50 : >70 µM
dbacp05322 Peptide 5 fCYwO-CyLeu-Pen-TKKrPKPfQwFwL-CyLeu-KKLMYPTYLKKfQWAV-Aib-HL Synthetic peptide of four designed analogs of vasoactive intestinal peptide, bombesin Not specified MTT/MTS assay MOLT-4 Leukemia cancer 10.4 % inhibition of cell proliferation at 1 nM
dbacp05323 Peptide 5 fCYwO-CyLeu-Pen-TKKrPKPfQwFwL-CyLeu-KKLMYPTYLKKfQWAV-Aib-HL Synthetic peptide of four designed analogs of vasoactive intestinal peptide, bombesin Not specified MTT/MTS assay MOLT-4 Leukemia cancer 18.7 % inhibition of cell proliferation at 10 nM
dbacp05324 Peptide 5 fCYwO-CyLeu-Pen-TKKrPKPfQwFwL-CyLeu-KKLMYPTYLKKfQWAV-Aib-HL Synthetic peptide of four designed analogs of vasoactive intestinal peptide, bombesin Not specified MTT/MTS assay MOLT-4 Leukemia cancer 34.7 % inhibition of cell proliferation at 100 nM
dbacp05325 Peptide 5 fCYwO-CyLeu-Pen-TKKrPKPfQwFwL-CyLeu-KKLMYPTYLKKfQWAV-Aib-HL Synthetic peptide of four designed analogs of vasoactive intestinal peptide, bombesin Not specified MTT/MTS assay MOLT-4 Leukemia cancer 54.3 % inhibition of cell proliferation at 1 µM
dbacp05326 Peptide 5 fCYwO-CyLeu-Pen-TKKrPKPfQwFwL-CyLeu-KKLMYPTYLKKfQWAV-Aib-HL Synthetic peptide of four designed analogs of vasoactive intestinal peptide, bombesin Not specified MTT/MTS assay MOLT-4 Leukemia cancer 94.5 % inhibition of cell proliferation at 10 µM
dbacp05330 Peptide 5 fCYwO-CyLeu-Pen-TKKrPKPfQwFwL-CyLeu-KKLMYPTYLKKfQWAV-Aib-HL Synthetic peptide of four designed analogs of vasoactive intestinal peptide, bombesin Not specified MTT/MTS assay MOLT-4 Leukemia cancer ED50 : 0.29 µM
dbacp05434 Peptide-1 IELLQARGGC-Pem Synthetic construct Cell membrane disintegration MTT/MTS assay HL-60 Leukemia cancer IC50 : 2.17 µM
dbacp05436 Peptide-2 IELLQARGGC-Pem-GGRRRRRRRR Synthetic construct Cell membrane disintegration MTT/MTS assay HL-60 Leukemia cancer IC50 : 2.64 µM
dbacp05438 Peptide-20 CSSRTMHHC Synthetic Peptide Inducing apoptosis MTT/MTS assay HL-60 Leukemia cancer At 100 µM 90% viablity
dbacp05445 Peptide-3 RRRRRRRRGGC-Pem Synthetic construct Cell membrane disintegration MTT/MTS assay HL-60 Leukemia cancer IC50 : 6.24 µM
dbacp05696 Psychrophilin D (1) lw Blue or green mold Not specified Cell viability assay P-388 Leukemia cancer ID50 : 10.1 µg/ml
dbacp05934 Retro LGGIVSAVKKIVDFLG Amphibian skin secretions Penetration and disruption of the membranes Sulforhodamine B assay Leukemia tumor cell line Leukemia cancer IC50 : 5 M
dbacp06075 Shiva-1 MPRWRLFRRIDRVGKQIKQGILRAGPAIALVGDARAVG African clawed frog Pore formation at the cytoplasmic membrane MTT/MTS assay K-562 Leukemia cancer IC50 : 28.7 µM
dbacp06082 Short α-helical peptide GIIKKIIKKI Alpha-helical proteins Cell membrane disruption; Cell apoptosis MTT/MTS assay HL-60 Leukemia cancer 100% Cytotoxicity at 4µM approx.
dbacp06083 Short α-helical peptide GIIKKIIKKIIKKI Alpha-helical proteins Cell membrane disruption; Cell apoptosis MTT/MTS assay HL-60 Leukemia cancer 90% Cytotoxicity at 4µM approx.
dbacp06084 Short α-helical peptide GIIKKIIKKIIKKIIKKI Alpha-helical proteins Cell membrane disruption; Cell apoptosis MTT/MTS assay HL-60 Leukemia cancer 70% Cytotoxicity at 5µM approx.
dbacp06475 Varv peptide F GVPICGETCTLGTCYTAGCSCSWPVCTRN Field pansy Cell membrane disintegration Not specified Not found Leukemia cancer Not found
dbacp06476 Varv peptide F GVPICGETCTLGTCYTAGCSCSWPVCTRN Field pansy Cell membrane disintegration Not specified Not found Leukemia cancer Not found
dbacp06494 Vibi E GIPCAESCVWIPCTVTALIGCGCSNKVCYN Alpine violet, Viola biflora Cell membrane disintegration Not specified Not found Leukemia cancer Not found
dbacp06558 Z24 ALSKALSKALSKALSKALSKALSK African clawed frog Dissipate ion gradients; Induce osmotic lysis; Membrane damage Trypan blue assay 8402 Leukemia cancer IC50 : 83 µg/ml
dbacp06560 Z24 ALSKALSKALSKALSKALSKALSK African clawed frog Dissipate ion gradients; Induce osmotic lysis; Membrane damage Trypan blue assay Daudi Leukemia cancer IC50 : 143 µg/ml
dbacp06561 Z24 ALSKALSKALSKALSKALSKALSK African clawed frog Dissipate ion gradients; Induce osmotic lysis; Membrane damage Trypan blue assay MLA Leukemia cancer IC50 : 102 µg/ml
dbacp06563 Z24 ALSKALSKALSKALSKALSKALSK African clawed frog Dissipate ion gradients; Induce osmotic lysis; Membrane damage Trypan blue assay K-562 Leukemia cancer IC50 : 112 µg/ml
dbacp06574 Z44 ALSKALSKALSKALSKALSKALSK African clawed frog Dissipate ion gradients;Induce osmotic lysis; Membrane damage Trypan blue assay 8402 Leukemia cancer IC50 : 60 µg/ml
dbacp06577 Z44 ALSKALSKALSKALSKALSKALSK African clawed frog Dissipate ion gradients;Induce osmotic lysis; Membrane damage Trypan blue assay MLA Leukemia cancer IC50 : 80 µg/ml
dbacp06579 Z44 ALSKALSKALSKALSKALSKALSK African clawed frog Dissipate ion gradients;Induce osmotic lysis; Membrane damage Trypan blue assay K-562 Leukemia cancer IC50 : 98 µg/ml
dbacp06752 Salamandrin - I FAVWGCADYRGY Salamandra salamandra Pyroptosis mediated MTT assay HL-60 Leukemia Cancer IC50 = 27 µM
dbacp06753 Salamandrin - I FAVWGCADYRGY Salamandra salamandra Pyroptosis mediated LDH leakage assay HL-60 Leukemia Cancer Absorbance ~ 2 at 490 nm at 27 27 µM
dbacp06807 [C/U, G1K, L5Y, K8R]cGm KURRYUYRQRUVTYURGR Synthetic Analogue of Gomesin Cell membrane penetration Resazurin dye assay K-562 Leukemia Cancer CC50 = 6.4 ± 0.6 μM
dbacp06808 [C/U, G1K, L5Y, K8R]cGm KURRYUYRQRUVTYURGR Synthetic Analogue of Gomesin Cell membrane penetration Resazurin dye assay HL-60 Leukemia Cancer CC50 = 33.3 ±7.4μM
dbacp06813 [G1K, L5Y, K8R]cGm KCRRYCYRQRCVTYCRGR Synthetic Analogue of Gomesin Cell membrane penetration Resazurin dye assay K-562 Leukemia Cancer CC50 = 1.3 ± 0.1 μM
dbacp06814 [G1K, L5Y, K8R]cGm KCRRYCYRQRCVTYCRGR Synthetic Analogue of Gomesin Cell membrane penetration Resazurin dye assay HL-60 Leukemia Cancer CC50 = 15.7 ±1.1μM
dbacp06818 [D-P L-P]cGm GCRRLCYKQRCVTYCRGpPR Synthetic Analogue of Gomesin Cell membrane penetration Resazurin dye assay K-562 Leukemia Cancer CC50 = 3.9 ± 0.2 μM
dbacp06823 [C/U]cGm GURRLUYKQRUVTYURGR Synthetic Analogue of Gomesin Cell membrane penetration Resazurin dye assay K-562 Leukemia Cancer CC50 = 1.4 ± 0.2 μM
dbacp06824 [C/U]cGm GURRLUYKQRUVTYURGR Synthetic Analogue of Gomesin Cell membrane penetration Resazurin dye assay HL-60 Leukemia Cancer CC50 = 38.5 ± 4.8 μM
dbacp06829 [G1K, K8R]cGm KCRRLCYRQRCVTYCRGR Synthetic Analogue of Gomesin Cell membrane penetration Resazurin dye assay K-562 Leukemia Cancer CC50 = 2.1 ± 0.2 μM
dbacp06830 [G1K, K8R]cGm KCRRLCYRQRCVTYCRGR Synthetic Analogue of Gomesin Cell membrane penetration Resazurin dye assay HL-60 Leukemia Cancer CC50 = 9.0 ± 1.1μM
dbacp06835 [R4A, R18A]cGm GCRALCYKQRCVTYCRGA Synthetic Analogue of Gomesin Cell membrane penetration Resazurin dye assay K-562 Leukemia Cancer CC50 = 11.5 ± 0.6 μM
dbacp06836 [R4A, R18A]cGm GCRALCYKQRCVTYCRGA Synthetic Analogue of Gomesin Cell membrane penetration Resazurin dye assay HL-60 Leukemia Cancer CC50 = 34.1 ± 3.9 μM
dbacp06841 [Y7W, K8R, Y14W]cGm GCRRLCWRQRCVTWCRGR Synthetic Analogue of Gomesin Cell membrane penetration Resazurin dye assay K-562 Leukemia Cancer CC50 = 3.9 ± 0.1 μM
dbacp07807 cT1 KWCFRVCYRGICYRRCRG Synthetic Not Available Resazurin dye assay K-562 Leukemia Cancer CC50 = 2.0 ± 0.1 µM
dbacp07812 [R/K]cT1 KWCFKVCYKGICYKKCKG Synthetic Not Available Resazurin dye assay K-562 Leukemia Cancer CC50 = 2.5 ± 0.1 µM
dbacp07818 [W2S]cT1 KSCFRVCYRGICYRRCRG Synthetic Not Available Resazurin dye assay K-562 Leukemia Cancer CC50 = 2.7 ± 0.2 µM
dbacp07823 [Y8S-I11S]cT1 KWCFRVCSRGSCYRRCRG Synthetic Not Available Resazurin dye assay K-562 Leukemia Cancer CC50 = 13.2 ± 0.9 µM
dbacp07837 [R9S-R14S-R17S]cT1 KWCFRVCYSGICYSRCSG Synthetic Not Available Resazurin dye assay K-562 Leukemia Cancer CC50 = 4.8 ± 0.3 µM
dbacp07841 [G18K]cT1 KWCFRVCYRGICYRRCRK Synthetic Not Available Resazurin dye assay K-562 Leukemia Cancer CC50 = 1.7 ± 0.1 µM
dbacp07846 [I11F-G18K]cT1 KWCFRVCYRGFCYRRCRK Synthetic Not Available Resazurin dye assay K-562 Leukemia Cancer CC50 = 1.9 ± 0.1 µM
dbacp08089 B1 KKLFKKILKYLK Analogue of BP 100 Membrane disruption triggers apoptosis MTT assay K-562 Leukemia Cancer IC50 = 17.9 ± 1.4 μM
dbacp08092 B1 KKLFKKILKYLK Analogue of BP 100 Membrane disruption triggers apoptosis MTT assay K-562/ADM Leukemia Cancer IC50 = 19.1 ± 2.1 μM
dbacp08093 B2 KKLFKKILKYLKK Analogue of BP 100 Membrane disruption triggers apoptosis MTT assay K-562 Leukemia Cancer IC50 = 33.6 ± 4.2 μM
dbacp08096 B2 KKLFKKILKYLKK Analogue of BP 100 Membrane disruption triggers apoptosis MTT assay K-562/ADM Leukemia Cancer IC50 = 39.6 ± 5.7 μM
dbacp08097 B3 KKLFKKILKYLKKL Analogue of BP 100 Membrane disruption triggers apoptosis MTT assay K-562 Leukemia Cancer IC50 = 47.4 ± 12.5 μM
dbacp08100 B5 LKKLFKKILKYLK Analogue of BP 100 Membrane disruption triggers apoptosis MTT assay K-562 Leukemia Cancer IC50 = 26.5 ± 1.5 μM
dbacp08103 B5 LKKLFKKILKYLK Analogue of BP 100 Membrane disruption triggers apoptosis MTT assay K-562/ADM Leukemia Cancer IC50 = 28.3 ± 2.3 μM
dbacp08104 B6 LKKLFKKILKYLKK Analogue of BP 100 Membrane disruption triggers apoptosis MTT assay K-562 Leukemia Cancer IC50 = 19.2 ± 2.3 μM
dbacp08107 B6 LKKLFKKILKYLKK Analogue of BP 100 Membrane disruption triggers apoptosis MTT assay K-562/ADM Leukemia Cancer IC50 = 22.7 ± 2.3 μM
dbacp08108 B9 KLKKLFKKILKY Analogue of BP 100 Membrane disruption triggers apoptosis MTT assay K-562 Leukemia Cancer IC50 = 60.7 ± 5.4 μM
dbacp08111 B9 KLKKLFKKILKY Analogue of BP 100 Membrane disruption triggers apoptosis MTT assay K-562/ADM Leukemia Cancer IC50 = 83.7 ± 5.3 μM
dbacp08349 LPSBD-0 CQYSVNPKIKRFELYFKGRMW Synthetic Not Available Not Available THP-1 Leukemia Cancer Not Available
dbacp08350 LPSBD-2 CHYRVKPKIKRFEKYKGRMW Synthetic Not Available Not Available THP-1 Leukemia Cancer Not Available
dbacp08377 IDP-wtL05 RKRRNDLRSRFLALRDQ Synthetic Not Available MTT/Alamamar-Blue/Hexosaminidase activity test RPMI Leukemia Cancer EC50 ~ 10 μM
dbacp08378 IDP-LS05 RKRRNDLRSRFLALRDQ Synthetic Not Available MTT/Alamamar-Blue/Hexosaminidase activity test HL-60 Leukemia Cancer EC50 ~ 5 μM
dbacp08379 IDP-LS05 RKRRNDLRSRFLALRDQ Synthetic Not Available MTT/Alamamar-Blue/Hexosaminidase activity test RPMI Leukemia Cancer EC50 ~ 6 μM
dbacp08381 IDP-LS13 RKRRNDLRSRFLALRDQ Synthetic Not Available MTT/Alamamar-Blue/Hexosaminidase activity test HL-60 Leukemia Cancer EC50 ~ 7 μM
dbacp08382 IDP-LS13 RKRRNDLRSRFLALRDQ Synthetic Not Available MTT/Alamamar-Blue/Hexosaminidase activity test RPMI Leukemia Cancer EC50 ~ 9 μM
dbacp08384 IDP-LS15 RKRRNDLRSRFLALRDQ Synthetic Not Available MTT/Alamamar-Blue/Hexosaminidase activity test RPMI Leukemia Cancer EC50 ~ 7 μM
dbacp08386 IDP-LS16 APKVVILSKALEYLQA Synthetic Not Available MTT/Alamamar-Blue/Hexosaminidase activity test RPMI Leukemia Cancer EC50 ~ 15 μM
dbacp08388 IDP-LS17 APKVVILSKALEYLQA Synthetic Not Available MTT/Alamamar-Blue/Hexosaminidase activity test RPMI Leukemia Cancer EC50 ~ 10 μM