245 result(s) have been found!
| Accession | Name | Sequence | Source/Organism | Mechanism | Assay Type | Cell Line | Cancer Type | Activity |
|---|---|---|---|---|---|---|---|---|
| dbacp00001 | Citropin modified peptide-3 | GLFAVIKKVASVIGGL | Amphibian skin secretions | Penetration and disruption of the membrane | Sulforhodamine B assay | Leukemia tumor cell line | Leukemia cancer | IC50 : 6 M |
| dbacp00010 | Citropin modified peptide-5 | GLFDVIKAVASVIGGL | Amphibian skin secretions | Penetration and disruption of the membrane | Sulforhodamine B assay | Leukemia tumor cell line | Leukemia cancer | IC50 : 5 M |
| dbacp00019 | Citropin modified peptide-7 | GLFDVIKKVAAVIGGL | Amphibian skin secretions | Penetration and disruption of the membrane | Sulforhodamine B assay | Leukemia tumor cell line | Leukemia cancer | IC50 : 5 M |
| dbacp00098 | Citropin modified peptide-11 | GLFDVIKKVASVIKGL | Amphibian skin secretions | Penetration and disruption of the membrane | Sulforhodamine B assay | Leukemia tumor cell line | Leukemia cancer | IC50 : 5 M |
| dbacp00107 | Citropin modified peptide-13 | GLFDVIKKVASVIKKL | Amphibian skin secretions | Penetration and disruption of the membrane | Sulforhodamine B assay | Leukemia tumor cell line | Leukemia cancer | IC50 : 5 M |
| dbacp00116 | Citropin modified peptide-14 | GLFDVIAKVASVIKKL | Amphibian skin secretions | Penetration and disruption of the membrane | Sulforhodamine B assay | Leukemia tumor cell line | Leukemia cancer | IC50 : 5 M |
| dbacp00150 | Citropin modified peptide-15 | GLFAVIKKVASVIKGL | Amphibian skin secretions | Penetration and disruption of the membrane | Sulforhodamine B assay | Leukemia tumor cell line | Leukemia cancer | IC50 : 5 M |
| dbacp00183 | Citropin modified peptide-16 | GLFAVIKKVASVIKKL | Amphibian skin secretions | Penetration and disruption of the membrane | Sulforhodamine B assay | Leukemia tumor cell line | Leukemia cancer | IC50 : 5 M |
| dbacp00217 | Citropin modified peptide-17 | GLFAVIKKVAAVIKKL | Amphibian skin secretions | Penetration and disruption of the membrane | Sulforhodamine B assay | Leukemia tumor cell line | Leukemia cancer | IC50 : 5 M |
| dbacp00252 | Citropin modified peptide-18 | GLFAVIKKVAAVIRRL | Amphibian skin secretions | Penetration and disruption of the membrane | Sulforhodamine B assay | Leukemia tumor cell line | Leukemia cancer | IC50 : 5 M |
| dbacp00261 | Citropin modified peptide-19 | GLFAVIKKVAKVIKKL | Amphibian skin secretions | Penetration and disruption of the membrane | Sulforhodamine B assay | Leukemia tumor cell line | Leukemia cancer | IC50 : 5 M |
| dbacp00270 | Citropin modified peptide-22 | GLFKVIKKVASVIGGL | Amphibian skin secretions | Penetration and disruption of the membrane | Sulforhodamine B assay | Leukemia tumor cell line | Leukemia cancer | IC50 : 5 M |
| dbacp00292 | Citropin modified peptide-23 | GLFKVIKKVAKVIKKL | Amphibian skin secretions | Penetration and disruption of the membrane | Sulforhodamine B assay | Leukemia tumor cell line | Leukemia cancer | IC50 : 5 M |
| dbacp00572 | [L9]-P18 | KWKLFKKILKFLHLAKKF | Ceropin A | Cell membrane disintegration | MTT/MTS assay | K-562 | Leukemia cancer | IC50 : 3 µM |
| dbacp00620 | [S9]-P18 | KWKLFKKISKFLHLAKKF | Ceropin A | Cell membrane disintegration | MTT/MTS assay | K-562 | Leukemia cancer | IC50 : 3 µM |
| dbacp01252 | Aurein 3.1 | GLFDIVKKIAGHIAGSI | Southern bell frog, Australia | Cell membrane disruption | Not specified | Leukemia tumor cell line | Leukemia cancer | LC50 : 10 µM |
| dbacp01261 | Aurein 3.1 | GLFDIVKKIAGHIAGSI | Southern bell frog, Australia | Cell membrane disruption | Not specified | Leukemia tumor cell line | Leukemia cancer | LC50 : 10 µM |
| dbacp01271 | Aurein 3.2 | GLFDIVKKIAGHIASSI | Southern bell frog, Australia | Cell membrane disruption | Not specified | Leukemia tumor cell line | Leukemia cancer | LC50 : 10 µM |
| dbacp01281 | Aurein 3.3 | GLFDIVKKIAGHIVSSI | Southern bell frog, Australia | Cell membrane disruption | Not specified | Leukemia tumor cell line | Leukemia cancer | LC50 : 10-100 µM |
| dbacp01406 | Aurein1.2 | GLFDIIKKIAESF | Southern bell frog | Cell membrane disruption | Not specified | Leukemia tumor cell line | Leukemia cancer | LC50 : 10-100 µM |
| dbacp01415 | Aurein2.5 | GLFDIVKKVVGAFGSL | Southern bell frog | Cell membrane disruption | Not specified | Leukemia tumor cell line | Leukemia cancer | LC50 : 10-100 µM |
| dbacp01424 | Aurein2.6 | GLFDIAKKVIGVIGSL | Southern bell frog | Cell membrane disruption | Not specified | Leukemia tumor cell line | Leukemia cancer | LC50 : 10-100 µM |
| dbacp01989 | Buforin IIb | RAGLQFPVGRLLRRLLRRLLR | Histone H2A | Inducing mitochondria-dependent apoptosis | MTT/MTS assay | CCRF-CEM | Leukemia cancer | IC50 : 14.7 µg/ml |
| dbacp01990 | Buforin IIb | RAGLQFPVGRLLRRLLRRLLR | Histone H2A | Inducing mitochondria-dependent apoptosis | MTT/MTS assay | HL-60 | Leukemia cancer | IC50 : 11.3 µg/ml |
| dbacp01991 | Buforin IIb | RAGLQFPVGRLLRRLLRRLLR | Histone H2A | Inducing mitochondria-dependent apoptosis | MTT/MTS assay | K-562 | Leukemia cancer | IC50 : 8.2 µg/ml |
| dbacp01992 | Buforin IIb | RAGLQFPVGRLLRRLLRRLLR | Histone H2A | Inducing mitochondria-dependent apoptosis | MTT/MTS assay | MOLT-4 | Leukemia cancer | IC50 : 17 µg/ml |
| dbacp01993 | Buforin IIb | RAGLQFPVGRLLRRLLRRLLR | Histone H2A | Inducing mitochondria-dependent apoptosis | MTT/MTS assay | RPMI-8226 | Leukemia cancer | IC50 : 10.5 µg/ml |
| dbacp01994 | Buforin IIb | RAGLQFPVGRLLRRLLRRLLR | Histone H2A | Inducing mitochondria-dependent apoptosis | MTT/MTS assay | SR | Leukemia cancer | IC50 : 20.2 µg/ml |
| dbacp02115 | C-1 | KWKLFKKIPFLHLAKKF | Ceropin A | Cell membrane disintegration | MTT/MTS assay | K-562 | Leukemia cancer | IC50 : 31 µM |
| dbacp02118 | C-10 | KWKLFKKIPKFLH | Ceropin A | Cell membrane disintegration | MTT/MTS assay | K-562 | Leukemia cancer | IC50 : <100 µM |
| dbacp02121 | C-2 | KWKLFKKIPKFLHLAKK | Ceropin A | Cell membrane disintegration | MTT/MTS assay | K-562 | Leukemia cancer | IC50 : 23 µM |
| dbacp02124 | C-3 | KWKLFKKIPLHLAKKF | Ceropin A | Cell membrane disintegration | MTT/MTS assay | K-562 | Leukemia cancer | IC50 : 62 µM |
| dbacp02127 | C-4 | KWKLFKKIPKFLHLAK | Ceropin A | Cell membrane disintegration | MTT/MTS assay | K-562 | Leukemia cancer | IC50 : 25 µM |
| dbacp02130 | C-5 | KWKLFKKIPHLAKKF | Ceropin A | Cell membrane disintegration | MTT/MTS assay | K-562 | Leukemia cancer | IC50 : 67 µM |
| dbacp02133 | C-6 | KWKLFKKIPKFLHLA | Ceropin A | Cell membrane disintegration | MTT/MTS assay | K-562 | Leukemia cancer | IC50 : 27 µM |
| dbacp02136 | C-7 | KWKLFKKIPLAKKF | Ceropin A | Cell membrane disintegration | MTT/MTS assay | K-562 | Leukemia cancer | IC50 : <100 µM |
| dbacp02139 | C-8 | KWKLFKKIPKFLHL | Ceropin A | Cell membrane disintegration | MTT/MTS assay | K-562 | Leukemia cancer | IC50 : 30 µM |
| dbacp02142 | C-9 | KWKLFKKIPLKKF | Ceropin A | Cell membrane disintegration | MTT/MTS assay | K-562 | Leukemia cancer | IC50 : <100 µM |
| dbacp02231 | CA-MA | KWKLFKKIGIGKFLHSAKKF | Ceropin-African clawed frog hybrid peptides | Cell membrane disintegration | MTT/MTS assay | K-562 | Leukemia cancer | IC50 : 65 µM |
| dbacp02240 | CA-MA-P | KWKLFKKIPKFLHSAKKF | Ceropin A | Cell membrane disintegration | MTT/MTS assay | K-562 | Leukemia cancer | IC50 : 25 µM |
| dbacp02241 | CA-MA1 | KWKLFKKIKFLHSAKKF | Ceropin-African clawed frog hybrid peptides | Cell membrane disintegration | MTT/MTS assay | K-562 | Leukemia cancer | IC50 : 85.3 µM |
| dbacp02245 | CA-MA2 | KWKLFKKIPKFLHSAKKF | Ceropin-African clawed frog hybrid peptides | Cell membrane disintegration | MTT/MTS assay | K-562 | Leukemia cancer | IC50 : 35.1 µM |
| dbacp02249 | CA-MA3 | KWKLFKKIGPGKFLHSAKKF | Ceropin-African clawed frog hybrid peptides | Cell membrane disintegration | MTT/MTS assay | K-562 | Leukemia cancer | IC50 : >100 µM |
| dbacp02323 | Cecropin 2 | GWLKKIGKKIERVGQHTRDATIQTIGVAQQAANVAATLK | The Medfly, also housefly | Cell membrane disintegration | Not specified | Not found | Leukemia cancer | Not found |
| dbacp02324 | Cecropin 2 | GWLKKIGKKIERVGQHTRDATIQTIGVAQQAANVAATLK | Mediterranean fruit fly | Not specified | Not specified | Not found | Leukemia cancer | Not found |
| dbacp02325 | Cecropin 2 | GWLKKIGKKIERVGQHTRDATIQTIGVAQQAANVAATLK | The Medfly, also housefly | Cell membrane disintegration | Not specified | Not found | Leukemia cancer | Not found |
| dbacp02357 | Cecropin B | KWKVFKKIEKMGRNIRNGIVKAGPAIAVLGEAKAL | Silkmoth | Pore formation at the cytoplasmic membrane | MTT/MTS assay | K-562 | Leukemia cancer | IC50 : 15.5 µM |
| dbacp02361 | Cecropin B | KWKVFKKIEKMGRNIRNGIVKAGPAIAVLGEAKAL | Silkmoth | Pore formation at the cytoplasmic membrane | MTT/MTS assay | WEHI-3B | Leukemia cancer | IC50 : 4.4 µM |
| dbacp02371 | Cecropin P1 | SWLSKTAKKLENSAKKRISEGIAIAIQGGPR | Small Intestine of Pig | Pore formation at the cytoplasmic membrane | MTT/MTS assay | K-562 | Leukemia cancer | IC50 : 93 µM |
| dbacp02377 | Cepafungin complex | I-C28H46N4O6,II-C27H44N4O6,III-C26H42N4O6 | Culture broth of strain, common, free-living bacterium, **Pseudomonas sp.** | Not specified | Not specified | P-388 | Leukemia cancer | Not found |
| dbacp02488 | Citropin 1.1 | GLFDVIKKVASVIGGL | Amphibian skin secretions | Penetration and disruption of the membranes | Sulforhodamine B assay | Leukemia tumor cell line | Leukemia cancer | IC50 : 5 M |
| dbacp02499 | Citropin 1.1D | glfdvikkvasviggl | Amphibian skin secretions | Penetration and disruption of the membranes | Sulforhodamine B assay | Leukemia tumor cell line | Leukemia cancer | IC50 : 5 M |
| dbacp02594 | Cyclic [W(RW)4 ]-Dox | WRWRWRWRW | Not found | Inhibition of the cell proliferation | MTT/MTS assay | CCRF-CEM | Leukemia cancer | 62-73% inhibition of cell proliferation at 1 µM |
| dbacp02805 | Dolastatin 10 | 2-[[2-(dimethylamino)-3-methylbutanoyl]amino]-N-[3-methoxy-1-[2-[1-methoxy-2-methyl-3-oxo-3-[[2-phenyl-1-(1,3-thiazol-2-yl)ethyl]amino]propyl]pyrrolidin-1-yl]-5-methyl-1-oxoheptan-4-yl]-N,3-dimethylbutaNAmide | Wedge sea hare | Apoptosis inducing | Cell viability assay | SR | Leukemia cancer | IC50 : 0.0013 - 0.013 nM |
| dbacp02809 | Dolastatin 15 | VV-nMe-VPP-2hydroxyisovaleryl-2-oxo-4-methoxy-5-benzyl-3-pyrroline | Wedge sea hare | Apoptosis inducing | Cell viability assay | SR | Leukemia cancer | IC50 : 0.0013 - 0.013 nM |
| dbacp03191 | HAL-1 | GMWSKILGHLIR | Sweat bees and their analogs | Cell membrane damage | MTT/MTS assay | CCRF-CEM | Leukemia cancer | IC50 : 49 ± 9 µM |
| dbacp03194 | HAL-1/10 | GMWKKILGKLIR | Sweat bees and their analogs | Cell membrane damage | MTT/MTS assay | CCRF-CEM | Leukemia cancer | Not found |
| dbacp03197 | HAL-1/12 | GKWSKILGHLIR | Sweat bees and their analogs | Cell membrane damage | MTT/MTS assay | CCRF-CEM | Leukemia cancer | IC50 : > 40 µM |
| dbacp03200 | HAL-1/15 | GMWSKLLGHLLR | Sweat bees and their analogs | Cell membrane damage | MTT/MTS assay | CCRF-CEM | Leukemia cancer | IC50 : > 40 µM |
| dbacp03203 | HAL-1/17 | KMWSKILGHLIR | Sweat bees and their analogs | Cell membrane damage | MTT/MTS assay | CCRF-CEM | Leukemia cancer | Not found |
| dbacp03206 | HAL-1/18 | GMWSKILKHLIR | Sweat bees and their analogs | Cell membrane damage | MTT/MTS assay | CCRF-CEM | Leukemia cancer | Not found |
| dbacp03209 | HAL-1/19 | GKWKKILGHLIR | Sweat bees and their analogs | Cell membrane damage | MTT/MTS assay | CCRF-CEM | Leukemia cancer | Not found |
| dbacp03212 | HAL-1/20 | GKWSKILGKLIR | Sweat bees and their analogs | Cell membrane damage | MTT/MTS assay | CCRF-CEM | Leukemia cancer | IC50 : > 40 µM |
| dbacp03215 | HAL-1/21 | GKWKKILGKLIR | Sweat bees and their analogs | Cell membrane damage | MTT/MTS assay | CCRF-CEM | Leukemia cancer | Not found |
| dbacp03218 | HAL-1/22 | gmwskilghlir | Sweat bees and their analogs | Cell membrane damage | MTT/MTS assay | CCRF-CEM | Leukemia cancer | Not found |
| dbacp03221 | HAL-1/29 | GMWSKILGHLIR | Sweat bees and their analogs | Cell membrane damage | MTT/MTS assay | CCRF-CEM | Leukemia cancer | Not found |
| dbacp03224 | HAL-1/4 | GMWSKILGHLKR | Sweat bees and their analogs | Cell membrane damage | MTT/MTS assay | CCRF-CEM | Leukemia cancer | Not found |
| dbacp03227 | HAL-1/5 | GMWKKILGHLIR | Sweat bees and their analogs | Cell membrane damage | MTT/MTS assay | CCRF-CEM | Leukemia cancer | IC50 : > 40 µM |
| dbacp03230 | HAL-1/6 | GMWSKILGHLIK | Sweat bees and their analogs | Cell membrane damage | MTT/MTS assay | CCRF-CEM | Leukemia cancer | Not found |
| dbacp03233 | HAL-1/9 | GMWSKILGKLIR | Sweat bees and their analogs | Cell membrane damage | MTT/MTS assay | CCRF-CEM | Leukemia cancer | IC50 : 30 ± 10 µM |
| dbacp03236 | HAL-2 | GKWMSLLKHILK | Sweat bees and their analogs | Cell membrane damage | MTT/MTS assay | CCRF-CEM | Leukemia cancer | IC50 : 34 µM |
| dbacp03239 | HAL-2/1 | GKWKSLLKHILK | Sweat bees and their analogs | Cell membrane damage | MTT/MTS assay | CCRF-CEM | Leukemia cancer | IC50 : > 40 µM |
| dbacp03242 | HAL-2/11 | GKWLSLLKHILK | Sweat bees and their analogs | Cell membrane damage | MTT/MTS assay | CCRF-CEM | Leukemia cancer | Not found |
| dbacp03245 | HAL-2/13 | GKWMTLLKHILK | Sweat bees and their analogs | Cell membrane damage | MTT/MTS assay | CCRF-CEM | Leukemia cancer | Not found |
| dbacp03248 | HAL-2/18 | GKWMSLLKHIWK | Sweat bees and their analogs | Cell membrane damage | MTT/MTS assay | CCRF-CEM | Leukemia cancer | Not found |
| dbacp03251 | HAL-2/19 | GKWMSLLKHWLK | Sweat bees and their analogs | Cell membrane damage | MTT/MTS assay | CCRF-CEM | Leukemia cancer | Not found |
| dbacp03254 | HAL-2/2 | GKWMKLLKHILK | Sweat bees and their analogs | Cell membrane damage | MTT/MTS assay | CCRF-CEM | Leukemia cancer | IC50 : > 40 µM |
| dbacp03257 | HAL-2/20 | GKWMSLWKHILK | Sweat bees and their analogs | Cell membrane damage | MTT/MTS assay | CCRF-CEM | Leukemia cancer | Not found |
| dbacp03260 | HAL-2/22 | gkwmsllkhilk | Sweat bees and their analogs | Cell membrane damage | MTT/MTS assay | CCRF-CEM | Leukemia cancer | Not found |
| dbacp03263 | HAL-2/24 | GKFMSLLKHILK | Sweat bees and their analogs | Cell membrane damage | MTT/MTS assay | CCRF-CEM | Leukemia cancer | Not found |
| dbacp03266 | HAL-2/4 | GKWMSLLKKILK | Sweat bees and their analogs | Cell membrane damage | MTT/MTS assay | CCRF-CEM | Leukemia cancer | Not found |
| dbacp03269 | HAL-2/6 | GKWMSFLKHILK | Sweat bees and their analogs | Cell membrane damage | MTT/MTS assay | CCRF-CEM | Leukemia cancer | Not found |
| dbacp03272 | HAL-2/8 | GKWMSLLKHILK | Sweat bees and their analogs | Cell membrane damage | MTT/MTS assay | CCRF-CEM | Leukemia cancer | Not found |
| dbacp03709 | Laxaphycin A | Aoc-Hse-E-Dhb-Hyp-Hse-FLIILG | Terrestrial blue-green alga or the marine cyanobacterium | Not specified | Cell viability assay | CEM-WT | Leukemia cancer | No inhibition at 4 µM |
| dbacp03710 | Laxaphycin A | Aoc-Hse-E-Dhb-Hyp-Hse-FLIILG | Terrestrial blue-green alga or the marine cyanobacterium | Not specified | Cell viability assay | CEM-VLB | Leukemia cancer | No inhibition at 4 µM |
| dbacp03711 | Laxaphycin A | Aoc-Hse-E-Dhb-Hyp-Hse-FLIILG | Terrestrial blue-green alga or the marine cyanobacterium | Not specified | Cell viability assay | CEM-VM1 | Leukemia cancer | No inhibition at 4 µM |
| dbacp03712 | Laxaphycin B | A-Hleu-QN-MeIle-Hasn-TPLT-Ade-V-Hleu | Terrestrial blue-green alga or the marine cyanobacterium | Not specified | Cell viability assay | CEM-WT | Leukemia cancer | 50% inhibition at 1 µM |
| dbacp03713 | Laxaphycin B | A-Hleu-QN-MeIle-Hasn-TPLT-Ade-V-Hleu | Terrestrial blue-green alga or the marine cyanobacterium | Not specified | Cell viability assay | CEM-WT | Leukemia cancer | 44% inhibition at 1 µM |
| dbacp03714 | Laxaphycin B | A-Hleu-QN-MeIle-Hasn-TPLT-Ade-V-Hleu | Terrestrial blue-green alga or the marine cyanobacterium | Not specified | Cell viability assay | CEM-VM1 | Leukemia cancer | 44% inhibition at 1 µM |
| dbacp03715 | Laxaphycin B | A-Hleu-QN-MeIle-Hasn-TPLT-Ade-V-Hleu | Terrestrial blue-green alga or the marine cyanobacterium | Not specified | Cell viability assay | CEM-VLB | Leukemia cancer | 44% inhibition at 1 µM |
| dbacp03716 | Laxaphycin B | A-Hleu-QN-MeIle-Hasn-TPLT-Ade-V-Hleu | Terrestrial blue-green alga or the marine cyanobacterium | Not specified | Cell viability assay | CEM-WT | Leukemia cancer | 40% inhibition at 1 µM |
| dbacp03717 | Laxaphycin B | A-Hleu-QN-MeIle-Hasn-TPLT-Ade-V-Hleu | Terrestrial blue-green alga or the marine cyanobacterium | Not specified | Cell viability assay | CEM-VM1 | Leukemia cancer | 40% inhibition at 1 µM |
| dbacp03718 | Laxaphycin B | A-Hleu-QN-MeIle-Hasn-TPLT-Ade-V-Hleu | Terrestrial blue-green alga or the marine cyanobacterium | Not specified | Cell viability assay | CEM-VLB | Leukemia cancer | 40% inhibition at 1 µM |
| dbacp04103 | linear (RW)4-Dox | RWRWRWRW | Doxorubicin (Dox) is a well-known anthracycline which has been conjugated to a CPP | Inhibition of the cell proliferation | MTT/MTS assay | CCRF-CEM | Leukemia cancer | 46-69% anti-proliferative activity at 1 µM |
| dbacp04182 | LL-III | VNWKKILGKIIKVVK | Lasioglossin III and its analogs | Cell membrane damage | MTT/MTS assay | CCRF-CEM | Leukemia cancer | IC50 : 5 ± 3 µM |
| dbacp04185 | LL-III/1 | VNWKKILAKIIKVVK | Lasioglossin III and its analogs | Cell membrane damage | MTT/MTS assay | CCRF-CEM | Leukemia cancer | IC50 : 3 ± 1 µM |
| dbacp04188 | LL-III/10 | KNWKKILGKIIKVVK | Lasioglossin III and its analogs | Cell membrane damage | MTT/MTS assay | CCRF-CEM | Leukemia cancer | IC50 : 9 µM |
| dbacp04191 | LL-III/11 | VNWKKIILGKIIKVVK | Lasioglossin III and its analogs | Cell membrane damage | MTT/MTS assay | CCRF-CEM | Leukemia cancer | IC50 : 4 ± 1 µM |
| dbacp04194 | LL-III/12 | vnwkkilgkiikvvk | Lasioglossin III and its analogs | Cell membrane damage | MTT/MTS assay | CCRF-CEM | Leukemia cancer | IC50 : 5 ± 2 µM |
| dbacp04197 | LL-III/15 | VNFKKLLGKLLKVVK | Lasioglossin III and its analogs | Cell membrane damage | MTT/MTS assay | CCRF-CEM | Leukemia cancer | IC50 : 9 ± 3 µM |
| dbacp04200 | LL-III/16 | VN-NAl-KKLLGKLLKVVK | Lasioglossin III and its analogs | Cell membrane damage | MTT/MTS assay | CCRF-CEM | Leukemia cancer | Not found |
| dbacp04203 | LL-III/17 | VNWRRILGRIIRVVR | Lasioglossin III and its analogs | Cell membrane damage | MTT/MTS assay | CCRF-CEM | Leukemia cancer | Not found |
| dbacp04206 | LL-III/18 | KNWKKILKKIIKVVK | Lasioglossin III and its analogs | Cell membrane damage | MTT/MTS assay | CCRF-CEM | Leukemia cancer | IC50 : 7 ± 2 µM |
| dbacp04209 | LL-III/19 | VNWKK-Aib-LGK-Aib-IK-Aib-VK | Lasioglossin III and its analogs | Cell membrane damage | MTT/MTS assay | CCRF-CEM | Leukemia cancer | IC50 : 8 ± 2 µM |
| dbacp04212 | LL-III/2 | NVWKKILGKIIKVVK | Lasioglossin III and its analogs | Cell membrane damage | MTT/MTS assay | CCRF-CEM | Leukemia cancer | IC50 : 7 ± 2 µM |
| dbacp04215 | LL-III/22 | KNWKK-Aib-LKK-Aib-IK-Aib-VK | Lasioglossin III and its analogs | Cell membrane damage | MTT/MTS assay | CCRF-CEM | Leukemia cancer | IC50 : 25 ± 4 µM |
| dbacp04218 | LL-III/23 | VNWKKLLGKLLKVVK | Lasioglossin III and its analogs | Cell membrane damage | MTT/MTS assay | CCRF-CEM | Leukemia cancer | IC50 : 6 µM |
| dbacp04221 | LL-III/24 | VNWOOILGOIIOVVO | Lasioglossin III and its analogs | Cell membrane damage | MTT/MTS assay | CCRF-CEM | Leukemia cancer | IC50 : 5 ± 2 µM |
| dbacp04224 | LL-III/25 | vnwkkllgkllkvvk | Lasioglossin III and its analogs | Cell membrane damage | MTT/MTS assay | CCRF-CEM | Leukemia cancer | IC50 : 4 µM |
| dbacp04227 | LL-III/26 | VYWKKILGKIIKVVK | Lasioglossin III and its analogs | Cell membrane damage | MTT/MTS assay | CCRF-CEM | Leukemia cancer | IC50 : 6 µM |
| dbacp04230 | LL-III/27 | VNWKKVLGKVVKVVK | Lasioglossin III and its analogs | Cell membrane damage | MTT/MTS assay | CCRF-CEM | Leukemia cancer | IC50 : 18 µM |
| dbacp04233 | LL-III/3 | VNWKKILKKIIKVVK | Lasioglossin III and its analogs | Cell membrane damage | MTT/MTS assay | CCRF-CEM | Leukemia cancer | Not found |
| dbacp04236 | LL-III/34 | NKWKKILGKIIKVVK | Lasioglossin III and its analogs | Cell membrane damage | MTT/MTS assay | CCRF-CEM | Leukemia cancer | IC50 : 5 ± 3 µM |
| dbacp04239 | LL-III/36 | VNWKKILAKIIKVVK | Lasioglossin III and its analogs | Cell membrane damage | MTT/MTS assay | CCRF-CEM | Leukemia cancer | Not found |
| dbacp04242 | LL-III/37 | VNWKKILGKIIKVVK | Lasioglossin III and its analogs | Cell membrane damage | MTT/MTS assay | CCRF-CEM | Leukemia cancer | IC50 : 4 ± 1 µM |
| dbacp04245 | LL-III/4 | VNWKKILGKIKKVVK | Lasioglossin III and its analogs | Cell membrane damage | MTT/MTS assay | CCRF-CEM | Leukemia cancer | IC50 : 18 µM |
| dbacp04248 | LL-III/6 | VNWKKILPKIIKVVK | Lasioglossin III and its analogs | Cell membrane damage | MTT/MTS assay | CCRF-CEM | Leukemia cancer | IC50 : 6 ± 3 µM |
| dbacp04251 | LL-III/8 | VNWKKILGKIIKVVK | Lasioglossin III and its analogs | Cell membrane damage | MTT/MTS assay | CCRF-CEM | Leukemia cancer | IC50 : 9 µM |
| dbacp04254 | LL-III/9 | VNWKKILGKIIKVVK | Lasioglossin III and its analogs | Cell membrane damage | MTT/MTS assay | CCRF-CEM | Leukemia cancer | Not found |
| dbacp04378 | MAC1 | GFGMALKLLKKVL | Wallabies and their analogs | Cell membrane damage | MTT/MTS assay | CCRF-CEM | Leukemia cancer | IC50 : 12 ± 6 µM |
| dbacp04381 | MAC1/1 | gfgmalkllkkvl | Wallabies and their analogs | Cell membrane damage | MTT/MTS assay | CCRF-CEM | Leukemia cancer | IC50 : 11 µM |
| dbacp04384 | MAC1/10 | GFKMALKLLKKVL | Wallabies and their analogs | Cell membrane damage | MTT/MTS assay | CCRF-CEM | Leukemia cancer | IC50 : 16 µM |
| dbacp04387 | MAC1/16 | GFGMALKLLKKVL-NH2 | Wallabies and their analogs | Cell membrane damage | MTT/MTS assay | CCRF-CEM | Leukemia cancer | IC50 : 70 µM |
| dbacp04390 | MAC1/19 | GFGMALKLLKKVL-NH2 | Wallabies and their analogs | Cell membrane damage | MTT/MTS assay | CCRF-CEM | Leukemia cancer | IC50 : 43 ± 11 µM |
| dbacp04393 | MAC1/2 | AFGMALKLLKKVL | Wallabies and their analogs | Cell membrane damage | MTT/MTS assay | CCRF-CEM | Leukemia cancer | IC50 : 17 µM |
| dbacp04396 | MAC1/20 | GFGMALOLLOOVL | Wallabies and their analogs | Cell membrane damage | MTT/MTS assay | CCRF-CEM | Leukemia cancer | IC50 : 25 ± 3 µM |
| dbacp04399 | MAC1/21 | GFGMALRLLRRVL | Wallabies and their analogs | Cell membrane damage | MTT/MTS assay | CCRF-CEM | Leukemia cancer | IC50 : 22 ± 4 µM |
| dbacp04402 | MAC1/24 | GFGMALKL-(AC6C)-KKVL | Wallabies and their analogs | Cell membrane damage | MTT/MTS assay | CCRF-CEM | Leukemia cancer | IC50 : 11 µM |
| dbacp04405 | MAC1/25 | GFGMALK-(AC6C)-LKKVL | Wallabies and their analogs | Cell membrane damage | MTT/MTS assay | CCRF-CEM | Leukemia cancer | IC50 : 12 ± 2 µM |
| dbacp04408 | MAC1/26 | GFGMA-(AC6C)-KLLKKVL | Wallabies and their analogs | Cell membrane damage | MTT/MTS assay | CCRF-CEM | Leukemia cancer | IC50 : 9 ± 2 µM |
| dbacp04411 | MAC1/3 | LFGMALKLLKKVL | Wallabies and their analogs | Cell membrane damage | MTT/MTS assay | CCRF-CEM | Leukemia cancer | IC50 : 22 µM |
| dbacp04414 | MAC1/4 | GFGMALKLLKKVL-NH2 | Wallabies and their analogs | Cell membrane damage | MTT/MTS assay | CCRF-CEM | Leukemia cancer | IC50 : 29 µM |
| dbacp04417 | MAC1/6 | GFGMALKLLKKVL-NH2 | Wallabies and their analogs | Cell membrane damage | MTT/MTS assay | CCRF-CEM | Leukemia cancer | IC50 : 15 µM |
| dbacp04420 | MAC1/9 | GFKMALKLLKKVL-NH2 | Wallabies and their analogs | Cell membrane damage | MTT/MTS assay | CCRF-CEM | Leukemia cancer | IC50 : 14 ± 4 µM |
| dbacp04423 | MAC2 | GTGLPMSERRKIMLMMR | Wallabies and their analogs | Cell membrane damage | MTT/MTS assay | CCRF-CEM | Leukemia cancer | IC50 : 32 µM |
| dbacp04488 | Magainin 2 | GIGKFLHSAKKFGKAFVGEIMNS | African clawed frog | Dissipate ion gradients; Induce osmotic lysis; Membrane damage | Trypan blue assay | 8402 | Leukemia cancer | IC50 : >150 µg/ml |
| dbacp04491 | Magainin 2 | GIGKFLHSAKKFGKAFVGEIMNS | African clawed frog | Dissipate ion gradients; Induce osmotic lysis; Membrane damage | Trypan blue assay | MLA | Leukemia cancer | IC50 : >150 µg/ml |
| dbacp04493 | Magainin 2 | GIGKFLHSAKKFGKAFVGEIMNS | African clawed frog | Dissipate ion gradients; Induce osmotic lysis; Membrane damage | Trypan blue assay | K-562 | Leukemia cancer | IC50 : >150 µg/ml |
| dbacp04506 | Magainin A | AIGKFLHSAKKFGKAFVGEIMNS | African clawed frog | Dissipate ion gradients; Induce osmotic lysis; Membrane damage | Trypan blue assay | 8402 | Leukemia cancer | IC50 : 18 µg/ml |
| dbacp04509 | Magainin A | AIGKFLHSAKKFGKAFVGEIMNS | African clawed frog | Dissipate ion gradients; Induce osmotic lysis; Membrane damage | Trypan blue assay | MLA | Leukemia cancer | IC50 : 34 µg/ml |
| dbacp04511 | Magainin A | AIGKFLHSAKKFGKAFVGEIMNS | African clawed frog | Dissipate ion gradients; Induce osmotic lysis; Membrane damage | Trypan blue assay | K-562 | Leukemia cancer | IC50 : 40 µg/ml |
| dbacp04516 | Magainin B | GIGKFLHAAKKFAKAFVAEIMNS | African clawed frog | Dissipate ion gradients; Induce osmotic lysis; Membrane damage | Trypan blue assay | 8402 | Leukemia cancer | IC50 : 12 µg/ml |
| dbacp04519 | Magainin B | GIGKFLHAAKKFAKAFVAEIMNS | African clawed frog | Dissipate ion gradients; Induce osmotic lysis; Membrane damage | Trypan blue assay | MLA | Leukemia cancer | IC50 : 30 µg/ml |
| dbacp04521 | Magainin B | GIGKFLHAAKKFAKAFVAEIMNS | African clawed frog | Dissipate ion gradients; Induce osmotic lysis; Membrane damage | Trypan blue assay | K-562 | Leukemia cancer | IC50 : 32 µg/ml |
| dbacp04532 | Magainin G | GIGKFLHSAKKFAKAFVAEIMNS | African clawed frog | Dissipate ion gradients; Induce osmotic lysis; Membrane damage | Trypan blue assay | 8402 | Leukemia cancer | IC50 : 16 µg/ml |
| dbacp04535 | Magainin G | GIGKFLHSAKKFAKAFVAEIMNS | African clawed frog | Dissipate ion gradients; Induce osmotic lysis; Membrane damage | Trypan blue assay | MLA | Leukemia cancer | IC50 : 33 µg/ml |
| dbacp04537 | Magainin G | GIGKFLHSAKKFAKAFVAEIMNS | African clawed frog | Dissipate ion gradients; Induce osmotic lysis; Membrane damage | Trypan blue assay | K-562 | Leukemia cancer | IC50 :37 µg/ml |
| dbacp04607 | Maximin1 | GIGTKILGGVKTALKGALKELASTYAN | Yunnan firebelly toad | Not specified | MTT/MTS assay | C8166 | Leukemia cancer | IC50 : 15.3 µg/ml |
| dbacp04608 | Maximin1 | GIGTKILGGVKTALKGALKELASTYAN | Yunnan firebelly toad | Not specified | MTT/MTS assay | MOLT-4 | Leukemia cancer | IC50 : 24.3 µg/ml |
| dbacp04611 | Maximin3 | GIGGKILSGLKTALKGAAKELASTYLH | Yunnan firebelly toad | Not specified | MTT/MTS assay | C8166 | Leukemia cancer | IC50 : 11.4 µg/ml |
| dbacp04612 | Maximin3 | GIGGKILSGLKTALKGAAKELASTYLH | Yunnan firebelly toad | Not specified | MTT/MTS assay | MOLT-4 | Leukemia cancer | IC50 : 25.2 µg/ml |
| dbacp04615 | Maximin4 | GIGVLLSAGKAALKGLAKVLAEKYAN | Yunnan firebelly toad | Not specified | MTT/MTS assay | C8166 | Leukemia cancer | IC50 : 24.2 µg/ml |
| dbacp04616 | Maximin4 | GIGVLLSAGKAALKGLAKVLAEKYAN | Yunnan firebelly toad | Not specified | MTT/MTS assay | MOLT-4 | Leukemia cancer | IC50 : 53.4 µg/ml |
| dbacp04619 | Maximin5 | SIGAKILGGVKTFFKGALKELASTYLQ | Yunnan firebelly toad | Not specified | MTT/MTS assay | C8166 | Leukemia cancer | IC50 : 34.4 µg/ml |
| dbacp04620 | Maximin5 | SIGAKILGGVKTFFKGALKELASTYLQ | Yunnan firebelly toad | Not specified | MTT/MTS assay | MOLT-4 | Leukemia cancer | IC50 : >50 µg/ml |
| dbacp04732 | N-1 | WKLFKKIPKFLHLAKKF | Ceropin A | Cell membrane disintegration | MTT/MTS assay | K-562 | Leukemia cancer | IC50 : 6 µM |
| dbacp04735 | N-2 | FKLFKKIPKFLHLAKKF | Ceropin A | Cell membrane disintegration | MTT/MTS assay | K-562 | Leukemia cancer | IC50 : 7 µM |
| dbacp04738 | N-3 | KWFKKIPKFLHLAKKF | Ceropin A | Cell membrane disintegration | MTT/MTS assay | K-562 | Leukemia cancer | IC50 : 11 µM |
| dbacp04741 | N-3L | KWFKKIPKFLHLLKKF | Ceropin A | Cell membrane disintegration | MTT/MTS assay | K-562 | Leukemia cancer | IC50 : 4.2 µM |
| dbacp04744 | N-4 | WFKKIPKFLHLAKKF | Ceropin A | Cell membrane disintegration | MTT/MTS assay | K-562 | Leukemia cancer | IC50 : 24 µM |
| dbacp04747 | N-4L | WFKKIPKFLHLLKKF | Ceropin A | Cell membrane disintegration | MTT/MTS assay | K-562 | Leukemia cancer | IC50 : 3 µM |
| dbacp04750 | N-5 | WKKIPKFLHLAKKF | Ceropin A | Cell membrane disintegration | MTT/MTS assay | K-562 | Leukemia cancer | IC50 : < 100 µM |
| dbacp04753 | N-5L | WKKIPKFLHLLKKF | Ceropin A | Cell membrane disintegration | MTT/MTS assay | K-562 | Leukemia cancer | IC50 :10 µM |
| dbacp04867 | NK-2 | KILRGVCKKIMRTFLRRISKDILTGKK | NK-lysin | Cell membrane disintegration | PI-uptake assay | SW-480 | Leukemia cancer | LD50 : 1-4 µM |
| dbacp05050 | P18 | KWKFKKIPKFLHLAKKF | Ceropin A | Cell membrane disintegration | MTT/MTS assay | K-562 | Leukemia cancer | IC50 : 3.5 µM |
| dbacp05246 | Pep27 | MRKEFHNVLSSGQLLADKRPARDYNRK | Pneumococcus | Apoptosis inducing | MTT/MTS assay | AML-2 | Leukemia cancer | Not found |
| dbacp05247 | Pep27 | MRKEFHNVLSSGQLLADKRPARDYNRK | Pneumococcus | Apoptosis inducing | MTT/MTS assay | HL-60 | Leukemia cancer | IC50 : > 70 µM |
| dbacp05282 | Pep27anal1 | MWKWFHNVLSSWQLLADKRPARDYNRK | Pneumococcus | Apoptosis inducing | MTT/MTS assay | AML-2 | Leukemia cancer | IC50 : 50 µM |
| dbacp05283 | Pep27anal1 | MWKWFHNVLSSWQLLADKRPARDYNRK | Pneumococcus | Apoptosis inducing | MTT/MTS assay | HL-60 | Leukemia cancer | IC50 : 53 µM |
| dbacp05287 | Pep27anal2 | MWKWFHNVLSWWWLLADKRPARDYNRK | Pneumococcus | Apoptosis inducing | MTT/MTS assay | AML-2 | Leukemia cancer | IC50 : 29 µM |
| dbacp05288 | Pep27anal2 | MWKWFHNVLSWWWLLADKRPARDYNRK | Pneumococcus | Apoptosis inducing | MTT/MTS assay | HL-60 | Leukemia cancer | IC50 : 20 µM |
| dbacp05292 | Pep27anal3 | MRKWFHNVLSSGQLLADKWPAWDYNRK | Pneumococcus | Apoptosis inducing | MTT/MTS assay | AML-2 | Leukemia cancer | IC50 : 67 µM |
| dbacp05293 | Pep27anal3 | MRKWFHNVLSSGQLLADKWPAWDYNRK | Pneumococcus | Apoptosis inducing | MTT/MTS assay | HL-60 | Leukemia cancer | IC50 : 52 µM |
| dbacp05297 | Pep27anal4 | MWKEFHNVLSSGQLLADKRWARWYNRW | Pneumococcus | Apoptosis inducing | MTT/MTS assay | AML-2 | Leukemia cancer | IC50 : 50 µM |
| dbacp05298 | Pep27anal4 | MWKEFHNVLSSGQLLADKRWARWYNRW | Pneumococcus | Apoptosis inducing | MTT/MTS assay | HL-60 | Leukemia cancer | IC50 : 51 µM |
| dbacp05302 | Pep27anal5 | MWKWFHNVLSSGQLLADKWWAWWYNWW | Pneumococcus | Apoptosis inducing | MTT/MTS assay | AML-2 | Leukemia cancer | IC50 : >70 µM |
| dbacp05303 | Pep27anal5 | MWKWFHNVLSSGQLLADKWWAWWYNWW | Pneumococcus | Apoptosis inducing | MTT/MTS assay | HL-60 | Leukemia cancer | IC50 : >70 µM |
| dbacp05322 | Peptide 5 | fCYwO-CyLeu-Pen-TKKrPKPfQwFwL-CyLeu-KKLMYPTYLKKfQWAV-Aib-HL | Synthetic peptide of four designed analogs of vasoactive intestinal peptide, bombesin | Not specified | MTT/MTS assay | MOLT-4 | Leukemia cancer | 10.4 % inhibition of cell proliferation at 1 nM |
| dbacp05323 | Peptide 5 | fCYwO-CyLeu-Pen-TKKrPKPfQwFwL-CyLeu-KKLMYPTYLKKfQWAV-Aib-HL | Synthetic peptide of four designed analogs of vasoactive intestinal peptide, bombesin | Not specified | MTT/MTS assay | MOLT-4 | Leukemia cancer | 18.7 % inhibition of cell proliferation at 10 nM |
| dbacp05324 | Peptide 5 | fCYwO-CyLeu-Pen-TKKrPKPfQwFwL-CyLeu-KKLMYPTYLKKfQWAV-Aib-HL | Synthetic peptide of four designed analogs of vasoactive intestinal peptide, bombesin | Not specified | MTT/MTS assay | MOLT-4 | Leukemia cancer | 34.7 % inhibition of cell proliferation at 100 nM |
| dbacp05325 | Peptide 5 | fCYwO-CyLeu-Pen-TKKrPKPfQwFwL-CyLeu-KKLMYPTYLKKfQWAV-Aib-HL | Synthetic peptide of four designed analogs of vasoactive intestinal peptide, bombesin | Not specified | MTT/MTS assay | MOLT-4 | Leukemia cancer | 54.3 % inhibition of cell proliferation at 1 µM |
| dbacp05326 | Peptide 5 | fCYwO-CyLeu-Pen-TKKrPKPfQwFwL-CyLeu-KKLMYPTYLKKfQWAV-Aib-HL | Synthetic peptide of four designed analogs of vasoactive intestinal peptide, bombesin | Not specified | MTT/MTS assay | MOLT-4 | Leukemia cancer | 94.5 % inhibition of cell proliferation at 10 µM |
| dbacp05330 | Peptide 5 | fCYwO-CyLeu-Pen-TKKrPKPfQwFwL-CyLeu-KKLMYPTYLKKfQWAV-Aib-HL | Synthetic peptide of four designed analogs of vasoactive intestinal peptide, bombesin | Not specified | MTT/MTS assay | MOLT-4 | Leukemia cancer | ED50 : 0.29 µM |
| dbacp05434 | Peptide-1 | IELLQARGGC-Pem | Synthetic construct | Cell membrane disintegration | MTT/MTS assay | HL-60 | Leukemia cancer | IC50 : 2.17 µM |
| dbacp05436 | Peptide-2 | IELLQARGGC-Pem-GGRRRRRRRR | Synthetic construct | Cell membrane disintegration | MTT/MTS assay | HL-60 | Leukemia cancer | IC50 : 2.64 µM |
| dbacp05438 | Peptide-20 | CSSRTMHHC | Synthetic Peptide | Inducing apoptosis | MTT/MTS assay | HL-60 | Leukemia cancer | At 100 µM 90% viablity |
| dbacp05445 | Peptide-3 | RRRRRRRRGGC-Pem | Synthetic construct | Cell membrane disintegration | MTT/MTS assay | HL-60 | Leukemia cancer | IC50 : 6.24 µM |
| dbacp05696 | Psychrophilin D (1) | lw | Blue or green mold | Not specified | Cell viability assay | P-388 | Leukemia cancer | ID50 : 10.1 µg/ml |
| dbacp05934 | Retro | LGGIVSAVKKIVDFLG | Amphibian skin secretions | Penetration and disruption of the membranes | Sulforhodamine B assay | Leukemia tumor cell line | Leukemia cancer | IC50 : 5 M |
| dbacp06075 | Shiva-1 | MPRWRLFRRIDRVGKQIKQGILRAGPAIALVGDARAVG | African clawed frog | Pore formation at the cytoplasmic membrane | MTT/MTS assay | K-562 | Leukemia cancer | IC50 : 28.7 µM |
| dbacp06082 | Short α-helical peptide | GIIKKIIKKI | Alpha-helical proteins | Cell membrane disruption; Cell apoptosis | MTT/MTS assay | HL-60 | Leukemia cancer | 100% Cytotoxicity at 4µM approx. |
| dbacp06083 | Short α-helical peptide | GIIKKIIKKIIKKI | Alpha-helical proteins | Cell membrane disruption; Cell apoptosis | MTT/MTS assay | HL-60 | Leukemia cancer | 90% Cytotoxicity at 4µM approx. |
| dbacp06084 | Short α-helical peptide | GIIKKIIKKIIKKIIKKI | Alpha-helical proteins | Cell membrane disruption; Cell apoptosis | MTT/MTS assay | HL-60 | Leukemia cancer | 70% Cytotoxicity at 5µM approx. |
| dbacp06475 | Varv peptide F | GVPICGETCTLGTCYTAGCSCSWPVCTRN | Field pansy | Cell membrane disintegration | Not specified | Not found | Leukemia cancer | Not found |
| dbacp06476 | Varv peptide F | GVPICGETCTLGTCYTAGCSCSWPVCTRN | Field pansy | Cell membrane disintegration | Not specified | Not found | Leukemia cancer | Not found |
| dbacp06494 | Vibi E | GIPCAESCVWIPCTVTALIGCGCSNKVCYN | Alpine violet, Viola biflora | Cell membrane disintegration | Not specified | Not found | Leukemia cancer | Not found |
| dbacp06558 | Z24 | ALSKALSKALSKALSKALSKALSK | African clawed frog | Dissipate ion gradients; Induce osmotic lysis; Membrane damage | Trypan blue assay | 8402 | Leukemia cancer | IC50 : 83 µg/ml |
| dbacp06560 | Z24 | ALSKALSKALSKALSKALSKALSK | African clawed frog | Dissipate ion gradients; Induce osmotic lysis; Membrane damage | Trypan blue assay | Daudi | Leukemia cancer | IC50 : 143 µg/ml |
| dbacp06561 | Z24 | ALSKALSKALSKALSKALSKALSK | African clawed frog | Dissipate ion gradients; Induce osmotic lysis; Membrane damage | Trypan blue assay | MLA | Leukemia cancer | IC50 : 102 µg/ml |
| dbacp06563 | Z24 | ALSKALSKALSKALSKALSKALSK | African clawed frog | Dissipate ion gradients; Induce osmotic lysis; Membrane damage | Trypan blue assay | K-562 | Leukemia cancer | IC50 : 112 µg/ml |
| dbacp06574 | Z44 | ALSKALSKALSKALSKALSKALSK | African clawed frog | Dissipate ion gradients;Induce osmotic lysis; Membrane damage | Trypan blue assay | 8402 | Leukemia cancer | IC50 : 60 µg/ml |
| dbacp06577 | Z44 | ALSKALSKALSKALSKALSKALSK | African clawed frog | Dissipate ion gradients;Induce osmotic lysis; Membrane damage | Trypan blue assay | MLA | Leukemia cancer | IC50 : 80 µg/ml |
| dbacp06579 | Z44 | ALSKALSKALSKALSKALSKALSK | African clawed frog | Dissipate ion gradients;Induce osmotic lysis; Membrane damage | Trypan blue assay | K-562 | Leukemia cancer | IC50 : 98 µg/ml |
| dbacp06752 | Salamandrin - I | FAVWGCADYRGY | Salamandra salamandra | Pyroptosis mediated | MTT assay | HL-60 | Leukemia Cancer | IC50 = 27 µM |
| dbacp06753 | Salamandrin - I | FAVWGCADYRGY | Salamandra salamandra | Pyroptosis mediated | LDH leakage assay | HL-60 | Leukemia Cancer | Absorbance ~ 2 at 490 nm at 27 27 µM |
| dbacp06807 | [C/U, G1K, L5Y, K8R]cGm | KURRYUYRQRUVTYURGR | Synthetic Analogue of Gomesin | Cell membrane penetration | Resazurin dye assay | K-562 | Leukemia Cancer | CC50 = 6.4 ± 0.6 μM |
| dbacp06808 | [C/U, G1K, L5Y, K8R]cGm | KURRYUYRQRUVTYURGR | Synthetic Analogue of Gomesin | Cell membrane penetration | Resazurin dye assay | HL-60 | Leukemia Cancer | CC50 = 33.3 ±7.4μM |
| dbacp06813 | [G1K, L5Y, K8R]cGm | KCRRYCYRQRCVTYCRGR | Synthetic Analogue of Gomesin | Cell membrane penetration | Resazurin dye assay | K-562 | Leukemia Cancer | CC50 = 1.3 ± 0.1 μM |
| dbacp06814 | [G1K, L5Y, K8R]cGm | KCRRYCYRQRCVTYCRGR | Synthetic Analogue of Gomesin | Cell membrane penetration | Resazurin dye assay | HL-60 | Leukemia Cancer | CC50 = 15.7 ±1.1μM |
| dbacp06818 | [D-P L-P]cGm | GCRRLCYKQRCVTYCRGpPR | Synthetic Analogue of Gomesin | Cell membrane penetration | Resazurin dye assay | K-562 | Leukemia Cancer | CC50 = 3.9 ± 0.2 μM |
| dbacp06823 | [C/U]cGm | GURRLUYKQRUVTYURGR | Synthetic Analogue of Gomesin | Cell membrane penetration | Resazurin dye assay | K-562 | Leukemia Cancer | CC50 = 1.4 ± 0.2 μM |
| dbacp06824 | [C/U]cGm | GURRLUYKQRUVTYURGR | Synthetic Analogue of Gomesin | Cell membrane penetration | Resazurin dye assay | HL-60 | Leukemia Cancer | CC50 = 38.5 ± 4.8 μM |
| dbacp06829 | [G1K, K8R]cGm | KCRRLCYRQRCVTYCRGR | Synthetic Analogue of Gomesin | Cell membrane penetration | Resazurin dye assay | K-562 | Leukemia Cancer | CC50 = 2.1 ± 0.2 μM |
| dbacp06830 | [G1K, K8R]cGm | KCRRLCYRQRCVTYCRGR | Synthetic Analogue of Gomesin | Cell membrane penetration | Resazurin dye assay | HL-60 | Leukemia Cancer | CC50 = 9.0 ± 1.1μM |
| dbacp06835 | [R4A, R18A]cGm | GCRALCYKQRCVTYCRGA | Synthetic Analogue of Gomesin | Cell membrane penetration | Resazurin dye assay | K-562 | Leukemia Cancer | CC50 = 11.5 ± 0.6 μM |
| dbacp06836 | [R4A, R18A]cGm | GCRALCYKQRCVTYCRGA | Synthetic Analogue of Gomesin | Cell membrane penetration | Resazurin dye assay | HL-60 | Leukemia Cancer | CC50 = 34.1 ± 3.9 μM |
| dbacp06841 | [Y7W, K8R, Y14W]cGm | GCRRLCWRQRCVTWCRGR | Synthetic Analogue of Gomesin | Cell membrane penetration | Resazurin dye assay | K-562 | Leukemia Cancer | CC50 = 3.9 ± 0.1 μM |
| dbacp07807 | cT1 | KWCFRVCYRGICYRRCRG | Synthetic | Not Available | Resazurin dye assay | K-562 | Leukemia Cancer | CC50 = 2.0 ± 0.1 µM |
| dbacp07812 | [R/K]cT1 | KWCFKVCYKGICYKKCKG | Synthetic | Not Available | Resazurin dye assay | K-562 | Leukemia Cancer | CC50 = 2.5 ± 0.1 µM |
| dbacp07818 | [W2S]cT1 | KSCFRVCYRGICYRRCRG | Synthetic | Not Available | Resazurin dye assay | K-562 | Leukemia Cancer | CC50 = 2.7 ± 0.2 µM |
| dbacp07823 | [Y8S-I11S]cT1 | KWCFRVCSRGSCYRRCRG | Synthetic | Not Available | Resazurin dye assay | K-562 | Leukemia Cancer | CC50 = 13.2 ± 0.9 µM |
| dbacp07837 | [R9S-R14S-R17S]cT1 | KWCFRVCYSGICYSRCSG | Synthetic | Not Available | Resazurin dye assay | K-562 | Leukemia Cancer | CC50 = 4.8 ± 0.3 µM |
| dbacp07841 | [G18K]cT1 | KWCFRVCYRGICYRRCRK | Synthetic | Not Available | Resazurin dye assay | K-562 | Leukemia Cancer | CC50 = 1.7 ± 0.1 µM |
| dbacp07846 | [I11F-G18K]cT1 | KWCFRVCYRGFCYRRCRK | Synthetic | Not Available | Resazurin dye assay | K-562 | Leukemia Cancer | CC50 = 1.9 ± 0.1 µM |
| dbacp08089 | B1 | KKLFKKILKYLK | Analogue of BP 100 | Membrane disruption triggers apoptosis | MTT assay | K-562 | Leukemia Cancer | IC50 = 17.9 ± 1.4 μM |
| dbacp08092 | B1 | KKLFKKILKYLK | Analogue of BP 100 | Membrane disruption triggers apoptosis | MTT assay | K-562/ADM | Leukemia Cancer | IC50 = 19.1 ± 2.1 μM |
| dbacp08093 | B2 | KKLFKKILKYLKK | Analogue of BP 100 | Membrane disruption triggers apoptosis | MTT assay | K-562 | Leukemia Cancer | IC50 = 33.6 ± 4.2 μM |
| dbacp08096 | B2 | KKLFKKILKYLKK | Analogue of BP 100 | Membrane disruption triggers apoptosis | MTT assay | K-562/ADM | Leukemia Cancer | IC50 = 39.6 ± 5.7 μM |
| dbacp08097 | B3 | KKLFKKILKYLKKL | Analogue of BP 100 | Membrane disruption triggers apoptosis | MTT assay | K-562 | Leukemia Cancer | IC50 = 47.4 ± 12.5 μM |
| dbacp08100 | B5 | LKKLFKKILKYLK | Analogue of BP 100 | Membrane disruption triggers apoptosis | MTT assay | K-562 | Leukemia Cancer | IC50 = 26.5 ± 1.5 μM |
| dbacp08103 | B5 | LKKLFKKILKYLK | Analogue of BP 100 | Membrane disruption triggers apoptosis | MTT assay | K-562/ADM | Leukemia Cancer | IC50 = 28.3 ± 2.3 μM |
| dbacp08104 | B6 | LKKLFKKILKYLKK | Analogue of BP 100 | Membrane disruption triggers apoptosis | MTT assay | K-562 | Leukemia Cancer | IC50 = 19.2 ± 2.3 μM |
| dbacp08107 | B6 | LKKLFKKILKYLKK | Analogue of BP 100 | Membrane disruption triggers apoptosis | MTT assay | K-562/ADM | Leukemia Cancer | IC50 = 22.7 ± 2.3 μM |
| dbacp08108 | B9 | KLKKLFKKILKY | Analogue of BP 100 | Membrane disruption triggers apoptosis | MTT assay | K-562 | Leukemia Cancer | IC50 = 60.7 ± 5.4 μM |
| dbacp08111 | B9 | KLKKLFKKILKY | Analogue of BP 100 | Membrane disruption triggers apoptosis | MTT assay | K-562/ADM | Leukemia Cancer | IC50 = 83.7 ± 5.3 μM |
| dbacp08349 | LPSBD-0 | CQYSVNPKIKRFELYFKGRMW | Synthetic | Not Available | Not Available | THP-1 | Leukemia Cancer | Not Available |
| dbacp08350 | LPSBD-2 | CHYRVKPKIKRFEKYKGRMW | Synthetic | Not Available | Not Available | THP-1 | Leukemia Cancer | Not Available |
| dbacp08377 | IDP-wtL05 | RKRRNDLRSRFLALRDQ | Synthetic | Not Available | MTT/Alamamar-Blue/Hexosaminidase activity test | RPMI | Leukemia Cancer | EC50 ~ 10 μM |
| dbacp08378 | IDP-LS05 | RKRRNDLRSRFLALRDQ | Synthetic | Not Available | MTT/Alamamar-Blue/Hexosaminidase activity test | HL-60 | Leukemia Cancer | EC50 ~ 5 μM |
| dbacp08379 | IDP-LS05 | RKRRNDLRSRFLALRDQ | Synthetic | Not Available | MTT/Alamamar-Blue/Hexosaminidase activity test | RPMI | Leukemia Cancer | EC50 ~ 6 μM |
| dbacp08381 | IDP-LS13 | RKRRNDLRSRFLALRDQ | Synthetic | Not Available | MTT/Alamamar-Blue/Hexosaminidase activity test | HL-60 | Leukemia Cancer | EC50 ~ 7 μM |
| dbacp08382 | IDP-LS13 | RKRRNDLRSRFLALRDQ | Synthetic | Not Available | MTT/Alamamar-Blue/Hexosaminidase activity test | RPMI | Leukemia Cancer | EC50 ~ 9 μM |
| dbacp08384 | IDP-LS15 | RKRRNDLRSRFLALRDQ | Synthetic | Not Available | MTT/Alamamar-Blue/Hexosaminidase activity test | RPMI | Leukemia Cancer | EC50 ~ 7 μM |
| dbacp08386 | IDP-LS16 | APKVVILSKALEYLQA | Synthetic | Not Available | MTT/Alamamar-Blue/Hexosaminidase activity test | RPMI | Leukemia Cancer | EC50 ~ 15 μM |
| dbacp08388 | IDP-LS17 | APKVVILSKALEYLQA | Synthetic | Not Available | MTT/Alamamar-Blue/Hexosaminidase activity test | RPMI | Leukemia Cancer | EC50 ~ 10 μM |