680 result(s) have been found!
| Accession | Name | Sequence | Source/Organism | Mechanism | Assay Type | Cell Line | Cancer Type | Activity |
|---|---|---|---|---|---|---|---|---|
| dbacp00322 | [C/U, G1K, L5Y, K8R]cGm | KURRYUYRQRUVTYURGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | CRL-1739 | Epithelial cancer | CC50 : 46.2 ± 7.6 μM |
| dbacp00323 | [C/U, G1K, L5Y, K8R]cGm | KURRYUYRQRUVTYURGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | CRL-1739 | Chronic myeloid Leukemia | CC50 : 46.2 ± 7.6 μM |
| dbacp00324 | [C/U, G1K, L5Y, K8R]cGm | KURRYUYRQRUVTYURGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | CRL-1739 | Gastric cancer | CC50 : 46.2 ± 7.6 μM |
| dbacp00325 | [C/U, G1K, L5Y, K8R]cGm | KURRYUYRQRUVTYURGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | CRL-1739 | Breast cancer | CC50 : 46.2 ± 7.6 μM |
| dbacp00326 | [C/U, G1K, L5Y, K8R]cGm | KURRYUYRQRUVTYURGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | CRL-1739 | Cervical cancer | CC50 : 46.2 ± 7.6 μM |
| dbacp00327 | [C/U, G1K, L5Y, K8R]cGm | KURRYUYRQRUVTYURGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | MM96L | Epithelial cancer | CC50 : 2.3 ± 0.2 μM |
| dbacp00328 | [C/U, G1K, L5Y, K8R]cGm | KURRYUYRQRUVTYURGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | MM96L | Chronic myeloid Leukemia | CC50 : 2.3 ± 0.2 μM |
| dbacp00329 | [C/U, G1K, L5Y, K8R]cGm | KURRYUYRQRUVTYURGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | MM96L | Gastric cancer | CC50 : 2.3 ± 0.2 μM |
| dbacp00330 | [C/U, G1K, L5Y, K8R]cGm | KURRYUYRQRUVTYURGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | MM96L | Breast cancer | CC50 : 2.3 ± 0.2 μM |
| dbacp00331 | [C/U, G1K, L5Y, K8R]cGm | KURRYUYRQRUVTYURGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | MM96L | Cervical cancer | CC50 : 2.3 ± 0.2 μM |
| dbacp00332 | [C/U, G1K, L5Y, K8R]cGm | KURRYUYRQRUVTYURGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | HFF-1 | Epithelial cancer | CC50 : 30.8 ± 2.0 μM |
| dbacp00333 | [C/U, G1K, L5Y, K8R]cGm | KURRYUYRQRUVTYURGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | HFF-1 | Chronic myeloid Leukemia | CC50 : 30.8 ± 2.0 μM |
| dbacp00334 | [C/U, G1K, L5Y, K8R]cGm | KURRYUYRQRUVTYURGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | HFF-1 | Gastric cancer | CC50 : 30.8 ± 2.0 μM |
| dbacp00335 | [C/U, G1K, L5Y, K8R]cGm | KURRYUYRQRUVTYURGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | HFF-1 | Breast cancer | CC50 : 30.8 ± 2.0 μM |
| dbacp00336 | [C/U, G1K, L5Y, K8R]cGm | KURRYUYRQRUVTYURGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | HFF-1 | Cervical cancer | CC50 : 30.8 ± 2.0 μM |
| dbacp00337 | [C/U, G1K, L5Y, K8R]cGm | KURRYUYRQRUVTYURGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | HeLa | Epithelial cancer | CC50 : 36.2 ± 2.8 μM |
| dbacp00338 | [C/U, G1K, L5Y, K8R]cGm | KURRYUYRQRUVTYURGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | HeLa | Chronic myeloid Leukemia | CC50 : 36.2 ± 2.8 μM |
| dbacp00339 | [C/U, G1K, L5Y, K8R]cGm | KURRYUYRQRUVTYURGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | HeLa | Gastric cancer | CC50 : 36.2 ± 2.8 μM |
| dbacp00340 | [C/U, G1K, L5Y, K8R]cGm | KURRYUYRQRUVTYURGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | HeLa | Breast cancer | CC50 : 36.2 ± 2.8 μM |
| dbacp00341 | [C/U, G1K, L5Y, K8R]cGm | KURRYUYRQRUVTYURGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | HeLa | Cervical cancer | CC50 : 36.2 ± 2.8 μM |
| dbacp00342 | [C/U, G1K, L5Y, K8R]cGm | KURRYUYRQRUVTYURGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | MCF-7 | Epithelial cancer | CC50 : 29.0 ± 3.7 μM |
| dbacp00343 | [C/U, G1K, L5Y, K8R]cGm | KURRYUYRQRUVTYURGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | MCF-7 | Chronic myeloid Leukemia | CC50 : 29.0 ± 3.7 μM |
| dbacp00344 | [C/U, G1K, L5Y, K8R]cGm | KURRYUYRQRUVTYURGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | MCF-7 | Gastric cancer | CC50 : 29.0 ± 3.7 μM |
| dbacp00345 | [C/U, G1K, L5Y, K8R]cGm | KURRYUYRQRUVTYURGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | MCF-7 | Breast cancer | CC50 : 29.0 ± 3.7 μM |
| dbacp00346 | [C/U, G1K, L5Y, K8R]cGm | KURRYUYRQRUVTYURGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | MCF-7 | Cervical cancer | CC50 : 29.0 ± 3.7 μM |
| dbacp00347 | [C/U, G1K, L5Y, K8R]cGm | KURRYUYRQRUVTYURGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | K-562 | Epithelial cancer | CC50 : 6.4 ± 0.6 μM |
| dbacp00348 | [C/U, G1K, L5Y, K8R]cGm | KURRYUYRQRUVTYURGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | K-562 | Chronic myeloid Leukemia | CC50 : 6.4 ± 0.6 μM |
| dbacp00349 | [C/U, G1K, L5Y, K8R]cGm | KURRYUYRQRUVTYURGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | K-562 | Gastric cancer | CC50 : 6.4 ± 0.6 μM |
| dbacp00350 | [C/U, G1K, L5Y, K8R]cGm | KURRYUYRQRUVTYURGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | K-562 | Breast cancer | CC50 : 6.4 ± 0.6 μM |
| dbacp00351 | [C/U, G1K, L5Y, K8R]cGm | KURRYUYRQRUVTYURGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | K-562 | Cervical cancer | CC50 : 6.4 ± 0.6 μM |
| dbacp00352 | [C/U, G1K, L5Y, K8R]cGm | KURRYUYRQRUVTYURGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | HL-60 | Epithelial cancer | CC50 : 33.3 ±7.4 μM |
| dbacp00353 | [C/U, G1K, L5Y, K8R]cGm | KURRYUYRQRUVTYURGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | HL-60 | Chronic myeloid Leukemia | CC50 : 33.3 ±7.4 μM |
| dbacp00354 | [C/U, G1K, L5Y, K8R]cGm | KURRYUYRQRUVTYURGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | HL-60 | Gastric cancer | CC50 : 33.3 ±7.4 μM |
| dbacp00355 | [C/U, G1K, L5Y, K8R]cGm | KURRYUYRQRUVTYURGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | HL-60 | Breast cancer | CC50 : 33.3 ±7.4 μM |
| dbacp00356 | [C/U, G1K, L5Y, K8R]cGm | KURRYUYRQRUVTYURGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | HL-60 | Cervical cancer | CC50 : 33.3 ±7.4 μM |
| dbacp00357 | [C/U, G1K, L5Y, K8R]cGm | KURRYUYRQRUVTYURGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | PBMCs | Epithelial cancer | CC50 : 9.5 ± 0.5 μM |
| dbacp00358 | [C/U, G1K, L5Y, K8R]cGm | KURRYUYRQRUVTYURGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | PBMCs | Chronic myeloid Leukemia | CC50 : 9.5 ± 0.5 μM |
| dbacp00359 | [C/U, G1K, L5Y, K8R]cGm | KURRYUYRQRUVTYURGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | PBMCs | Gastric cancer | CC50 : 9.5 ± 0.5 μM |
| dbacp00360 | [C/U, G1K, L5Y, K8R]cGm | KURRYUYRQRUVTYURGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | PBMCs | Breast cancer | CC50 : 9.5 ± 0.5 μM |
| dbacp00361 | [C/U, G1K, L5Y, K8R]cGm | KURRYUYRQRUVTYURGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | PBMCs | Cervical cancer | CC50 : 9.5 ± 0.5 μM |
| dbacp00362 | [C/U]cGm | GURRLUYKQRUVTYURGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | CRL-1739 | Epithelial cancer | CC50 : 51.0 ± 4.6 μM |
| dbacp00363 | [C/U]cGm | GURRLUYKQRUVTYURGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | CRL-1739 | Chronic myeloid Leukemia | CC50 : 51.0 ± 4.6 μM |
| dbacp00364 | [C/U]cGm | GURRLUYKQRUVTYURGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | CRL-1739 | Gastric cancer | CC50 : 51.0 ± 4.6 μM |
| dbacp00365 | [C/U]cGm | GURRLUYKQRUVTYURGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | CRL-1739 | Breast cancer | CC50 : 51.0 ± 4.6 μM |
| dbacp00366 | [C/U]cGm | GURRLUYKQRUVTYURGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | CRL-1739 | Cervical cancer | CC50 : 51.0 ± 4.6 μM |
| dbacp00367 | [C/U]cGm | GURRLUYKQRUVTYURGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | MM96L | Epithelial cancer | CC50 : 4.6 ± 0.2 μM |
| dbacp00368 | [C/U]cGm | GURRLUYKQRUVTYURGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | MM96L | Chronic myeloid Leukemia | CC50 : 4.6 ± 0.2 μM |
| dbacp00369 | [C/U]cGm | GURRLUYKQRUVTYURGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | MM96L | Gastric cancer | CC50 : 4.6 ± 0.2 μM |
| dbacp00370 | [C/U]cGm | GURRLUYKQRUVTYURGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | MM96L | Breast cancer | CC50 : 4.6 ± 0.2 μM |
| dbacp00371 | [C/U]cGm | GURRLUYKQRUVTYURGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | MM96L | Cervical cancer | CC50 : 4.6 ± 0.2 μM |
| dbacp00372 | [C/U]cGm | GURRLUYKQRUVTYURGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | HFF-1 | Epithelial cancer | CC50 : 15.6 ± 3.6 μM |
| dbacp00373 | [C/U]cGm | GURRLUYKQRUVTYURGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | HFF-1 | Chronic myeloid Leukemia | CC50 : 15.6 ± 3.6 μM |
| dbacp00374 | [C/U]cGm | GURRLUYKQRUVTYURGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | HFF-1 | Gastric cancer | CC50 : 15.6 ± 3.6 μM |
| dbacp00375 | [C/U]cGm | GURRLUYKQRUVTYURGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | HFF-1 | Breast cancer | CC50 : 15.6 ± 3.6 μM |
| dbacp00376 | [C/U]cGm | GURRLUYKQRUVTYURGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | HFF-1 | Cervical cancer | CC50 : 15.6 ± 3.6 μM |
| dbacp00377 | [C/U]cGm | GURRLUYKQRUVTYURGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | HeLa | Epithelial cancer | CC50 : > 64 μM |
| dbacp00378 | [C/U]cGm | GURRLUYKQRUVTYURGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | HeLa | Chronic myeloid Leukemia | CC50 : > 64 μM |
| dbacp00379 | [C/U]cGm | GURRLUYKQRUVTYURGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | HeLa | Gastric cancer | CC50 : > 64 μM |
| dbacp00380 | [C/U]cGm | GURRLUYKQRUVTYURGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | HeLa | Breast cancer | CC50 : > 64 μM |
| dbacp00381 | [C/U]cGm | GURRLUYKQRUVTYURGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | HeLa | Cervical cancer | CC50 : > 64 μM |
| dbacp00382 | [C/U]cGm | GURRLUYKQRUVTYURGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | MCF-7 | Epithelial cancer | CC50 : 37.5 ± 3.3 μM |
| dbacp00383 | [C/U]cGm | GURRLUYKQRUVTYURGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | MCF-7 | Chronic myeloid Leukemia | CC50 : 37.5 ± 3.3 μM |
| dbacp00384 | [C/U]cGm | GURRLUYKQRUVTYURGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | MCF-7 | Gastric cancer | CC50 : 37.5 ± 3.3 μM |
| dbacp00385 | [C/U]cGm | GURRLUYKQRUVTYURGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | MCF-7 | Breast cancer | CC50 : 37.5 ± 3.3 μM |
| dbacp00386 | [C/U]cGm | GURRLUYKQRUVTYURGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | MCF-7 | Cervical cancer | CC50 : 37.5 ± 3.3 μM |
| dbacp00387 | [C/U]cGm | GURRLUYKQRUVTYURGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | K-562 | Epithelial cancer | CC50 : 1.4 ± 0.2 μM |
| dbacp00388 | [C/U]cGm | GURRLUYKQRUVTYURGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | K-562 | Chronic myeloid Leukemia | CC50 : 1.4 ± 0.2 μM |
| dbacp00389 | [C/U]cGm | GURRLUYKQRUVTYURGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | K-562 | Gastric cancer | CC50 : 1.4 ± 0.2 μM |
| dbacp00390 | [C/U]cGm | GURRLUYKQRUVTYURGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | K-562 | Breast cancer | CC50 : 1.4 ± 0.2 μM |
| dbacp00391 | [C/U]cGm | GURRLUYKQRUVTYURGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | K-562 | Cervical cancer | CC50 : 1.4 ± 0.2 μM |
| dbacp00392 | [C/U]cGm | GURRLUYKQRUVTYURGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | HL-60 | Epithelial cancer | CC50 : 38.5 ± 4.8 μM |
| dbacp00393 | [C/U]cGm | GURRLUYKQRUVTYURGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | HL-60 | Chronic myeloid Leukemia | CC50 : 38.5 ± 4.8 μM |
| dbacp00394 | [C/U]cGm | GURRLUYKQRUVTYURGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | HL-60 | Gastric cancer | CC50 : 38.5 ± 4.8 μM |
| dbacp00395 | [C/U]cGm | GURRLUYKQRUVTYURGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | HL-60 | Breast cancer | CC50 : 38.5 ± 4.8 μM |
| dbacp00396 | [C/U]cGm | GURRLUYKQRUVTYURGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | HL-60 | Cervical cancer | CC50 : 38.5 ± 4.8 μM |
| dbacp00397 | [C/U]cGm | GURRLUYKQRUVTYURGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | PBMCs | Epithelial cancer | CC50 : 15.5 ± 0.8 μM |
| dbacp00398 | [C/U]cGm | GURRLUYKQRUVTYURGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | PBMCs | Chronic myeloid Leukemia | CC50 : 15.5 ± 0.8 μM |
| dbacp00399 | [C/U]cGm | GURRLUYKQRUVTYURGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | PBMCs | Gastric cancer | CC50 : 15.5 ± 0.8 μM |
| dbacp00400 | [C/U]cGm | GURRLUYKQRUVTYURGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | PBMCs | Breast cancer | CC50 : 15.5 ± 0.8 μM |
| dbacp00401 | [C/U]cGm | GURRLUYKQRUVTYURGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | PBMCs | Cervical cancer | CC50 : 15.5 ± 0.8 μM |
| dbacp00403 | [D-P L-P]cGm | GCRRLCYKQRCVTYCRGpPR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | CRL-1739 | Epithelial cancer | CC50 : 22.5 ± 3.3 μM |
| dbacp00404 | [D-P L-P]cGm | GCRRLCYKQRCVTYCRGpPR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | CRL-1739 | Chronic myeloid Leukemia | CC50 : 22.5 ± 3.3 μM |
| dbacp00405 | [D-P L-P]cGm | GCRRLCYKQRCVTYCRGpPR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | CRL-1739 | Gastric cancer | CC50 : 22.5 ± 3.3 μM |
| dbacp00406 | [D-P L-P]cGm | GCRRLCYKQRCVTYCRGpPR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | CRL-1739 | Breast cancer | CC50 : 22.5 ± 3.3 μM |
| dbacp00407 | [D-P L-P]cGm | GCRRLCYKQRCVTYCRGpPR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | CRL-1739 | Cervical cancer | CC50 : 22.5 ± 3.3 μM |
| dbacp00408 | [D-P L-P]cGm | GCRRLCYKQRCVTYCRGpPR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | MM96L | Epithelial cancer | CC50 : 3.0 ± 0.1 μM |
| dbacp00409 | [D-P L-P]cGm | GCRRLCYKQRCVTYCRGpPR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | MM96L | Chronic myeloid Leukemia | CC50 : 3.0 ± 0.1 μM |
| dbacp00410 | [D-P L-P]cGm | GCRRLCYKQRCVTYCRGpPR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | MM96L | Gastric cancer | CC50 : 3.0 ± 0.1 μM |
| dbacp00411 | [D-P L-P]cGm | GCRRLCYKQRCVTYCRGpPR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | MM96L | Breast cancer | CC50 : 3.0 ± 0.1 μM |
| dbacp00412 | [D-P L-P]cGm | GCRRLCYKQRCVTYCRGpPR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | MM96L | Cervical cancer | CC50 : 3.0 ± 0.1 μM |
| dbacp00413 | [D-P L-P]cGm | GCRRLCYKQRCVTYCRGpPR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | HFF-1 | Epithelial cancer | CC50 : 14.9 ± 0.8 μM |
| dbacp00414 | [D-P L-P]cGm | GCRRLCYKQRCVTYCRGpPR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | HFF-1 | Chronic myeloid Leukemia | CC50 : 14.9 ± 0.8 μM |
| dbacp00415 | [D-P L-P]cGm | GCRRLCYKQRCVTYCRGpPR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | HFF-1 | Gastric cancer | CC50 : 14.9 ± 0.8 μM |
| dbacp00416 | [D-P L-P]cGm | GCRRLCYKQRCVTYCRGpPR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | HFF-1 | Breast cancer | CC50 : 14.9 ± 0.8 μM |
| dbacp00417 | [D-P L-P]cGm | GCRRLCYKQRCVTYCRGpPR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | HFF-1 | Cervical cancer | CC50 : 14.9 ± 0.8 μM |
| dbacp00418 | [D-P L-P]cGm | GCRRLCYKQRCVTYCRGpPR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | HeLa | Epithelial cancer | CC50 : 51.5 ± 3.9 μM |
| dbacp00419 | [D-P L-P]cGm | GCRRLCYKQRCVTYCRGpPR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | HeLa | Chronic myeloid Leukemia | CC50 : 51.5 ± 3.9 μM |
| dbacp00420 | [D-P L-P]cGm | GCRRLCYKQRCVTYCRGpPR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | HeLa | Gastric cancer | CC50 : 51.5 ± 3.9 μM |
| dbacp00421 | [D-P L-P]cGm | GCRRLCYKQRCVTYCRGpPR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | HeLa | Breast cancer | CC50 : 51.5 ± 3.9 μM |
| dbacp00422 | [D-P L-P]cGm | GCRRLCYKQRCVTYCRGpPR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | HeLa | Cervical cancer | CC50 : 51.5 ± 3.9 μM |
| dbacp00423 | [D-P L-P]cGm | GCRRLCYKQRCVTYCRGpPR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | K-562 | Epithelial cancer | CC50 : 3.9 ± 0.2 μM |
| dbacp00424 | [D-P L-P]cGm | GCRRLCYKQRCVTYCRGpPR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | K-562 | Chronic myeloid Leukemia | CC50 : 3.9 ± 0.2 μM |
| dbacp00425 | [D-P L-P]cGm | GCRRLCYKQRCVTYCRGpPR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | K-562 | Gastric cancer | CC50 : 3.9 ± 0.2 μM |
| dbacp00426 | [D-P L-P]cGm | GCRRLCYKQRCVTYCRGpPR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | K-562 | Breast cancer | CC50 : 3.9 ± 0.2 μM |
| dbacp00427 | [D-P L-P]cGm | GCRRLCYKQRCVTYCRGpPR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | K-562 | Cervical cancer | CC50 : 3.9 ± 0.2 μM |
| dbacp00428 | [D-P L-P]cGm | GCRRLCYKQRCVTYCRGpPR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | PBMCs | Epithelial cancer | CC50 : 14.1 ± 0.9 μM |
| dbacp00429 | [D-P L-P]cGm | GCRRLCYKQRCVTYCRGpPR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | PBMCs | Chronic myeloid Leukemia | CC50 : 14.1 ± 0.9 μM |
| dbacp00430 | [D-P L-P]cGm | GCRRLCYKQRCVTYCRGpPR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | PBMCs | Gastric cancer | CC50 : 14.1 ± 0.9 μM |
| dbacp00431 | [D-P L-P]cGm | GCRRLCYKQRCVTYCRGpPR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | PBMCs | Breast cancer | CC50 : 14.1 ± 0.9 μM |
| dbacp00432 | [D-P L-P]cGm | GCRRLCYKQRCVTYCRGpPR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | PBMCs | Cervical cancer | CC50 : 14.1 ± 0.9 μM |
| dbacp00440 | [G1K, K8R]cGm | KCRRLCYRQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | CRL-1739 | Epithelial cancer | CC50 : 19.5 ± 0.5 μM |
| dbacp00441 | [G1K, K8R]cGm | KCRRLCYRQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | CRL-1739 | Chronic myeloid Leukemia | CC50 : 19.5 ± 0.5 μM |
| dbacp00442 | [G1K, K8R]cGm | KCRRLCYRQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | CRL-1739 | Gastric cancer | CC50 : 19.5 ± 0.5 μM |
| dbacp00443 | [G1K, K8R]cGm | KCRRLCYRQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | CRL-1739 | Breast cancer | CC50 : 19.5 ± 0.5 μM |
| dbacp00444 | [G1K, K8R]cGm | KCRRLCYRQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | CRL-1739 | Cervical cancer | CC50 : 19.5 ± 0.5 μM |
| dbacp00445 | [G1K, K8R]cGm | KCRRLCYRQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | MM96L | Epithelial cancer | CC50 : 1.7 ± 0.1 μM |
| dbacp00446 | [G1K, K8R]cGm | KCRRLCYRQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | MM96L | Chronic myeloid Leukemia | CC50 : 1.7 ± 0.1 μM |
| dbacp00447 | [G1K, K8R]cGm | KCRRLCYRQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | MM96L | Gastric cancer | CC50 : 1.7 ± 0.1 μM |
| dbacp00448 | [G1K, K8R]cGm | KCRRLCYRQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | MM96L | Breast cancer | CC50 : 1.7 ± 0.1 μM |
| dbacp00449 | [G1K, K8R]cGm | KCRRLCYRQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | MM96L | Cervical cancer | CC50 : 1.7 ± 0.1 μM |
| dbacp00450 | [G1K, K8R]cGm | KCRRLCYRQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | HFF-1 | Epithelial cancer | CC50 : 9.0 ± 0.5 μM |
| dbacp00451 | [G1K, K8R]cGm | KCRRLCYRQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | HFF-1 | Chronic myeloid Leukemia | CC50 : 9.0 ± 0.5 μM |
| dbacp00452 | [G1K, K8R]cGm | KCRRLCYRQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | HFF-1 | Gastric cancer | CC50 : 9.0 ± 0.5 μM |
| dbacp00453 | [G1K, K8R]cGm | KCRRLCYRQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | HFF-1 | Breast cancer | CC50 : 9.0 ± 0.5 μM |
| dbacp00454 | [G1K, K8R]cGm | KCRRLCYRQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | HFF-1 | Cervical cancer | CC50 : 9.0 ± 0.5 μM |
| dbacp00455 | [G1K, K8R]cGm | KCRRLCYRQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | HeLa | Epithelial cancer | CC50 : 44.2 ± 2.2 μM |
| dbacp00456 | [G1K, K8R]cGm | KCRRLCYRQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | HeLa | Chronic myeloid Leukemia | CC50 : 44.2 ± 2.2 μM |
| dbacp00457 | [G1K, K8R]cGm | KCRRLCYRQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | HeLa | Gastric cancer | CC50 : 44.2 ± 2.2 μM |
| dbacp00458 | [G1K, K8R]cGm | KCRRLCYRQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | HeLa | Breast cancer | CC50 : 44.2 ± 2.2 μM |
| dbacp00459 | [G1K, K8R]cGm | KCRRLCYRQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | HeLa | Cervical cancer | CC50 : 44.2 ± 2.2 μM |
| dbacp00460 | [G1K, K8R]cGm | KCRRLCYRQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | MCF-7 | Epithelial cancer | CC50 : 6.7 ± 0.7 μM |
| dbacp00461 | [G1K, K8R]cGm | KCRRLCYRQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | MCF-7 | Chronic myeloid Leukemia | CC50 : 6.7 ± 0.7 μM |
| dbacp00462 | [G1K, K8R]cGm | KCRRLCYRQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | MCF-7 | Gastric cancer | CC50 : 6.7 ± 0.7 μM |
| dbacp00463 | [G1K, K8R]cGm | KCRRLCYRQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | MCF-7 | Breast cancer | CC50 : 6.7 ± 0.7 μM |
| dbacp00464 | [G1K, K8R]cGm | KCRRLCYRQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | MCF-7 | Cervical cancer | CC50 : 6.7 ± 0.7 μM |
| dbacp00465 | [G1K, K8R]cGm | KCRRLCYRQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | K-562 | Epithelial cancer | CC50 : 2.1 ± 0.2 μM |
| dbacp00466 | [G1K, K8R]cGm | KCRRLCYRQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | K-562 | Chronic myeloid Leukemia | CC50 : 2.1 ± 0.2 μM |
| dbacp00467 | [G1K, K8R]cGm | KCRRLCYRQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | K-562 | Gastric cancer | CC50 : 2.1 ± 0.2 μM |
| dbacp00468 | [G1K, K8R]cGm | KCRRLCYRQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | K-562 | Breast cancer | CC50 : 2.1 ± 0.2 μM |
| dbacp00469 | [G1K, K8R]cGm | KCRRLCYRQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | K-562 | Cervical cancer | CC50 : 2.1 ± 0.2 μM |
| dbacp00470 | [G1K, K8R]cGm | KCRRLCYRQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | HL-60 | Epithelial cancer | CC50 : 9.0 ± 1.1μM |
| dbacp00471 | [G1K, K8R]cGm | KCRRLCYRQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | HL-60 | Chronic myeloid Leukemia | CC50 : 9.0 ± 1.1μM |
| dbacp00472 | [G1K, K8R]cGm | KCRRLCYRQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | HL-60 | Gastric cancer | CC50 : 9.0 ± 1.1μM |
| dbacp00473 | [G1K, K8R]cGm | KCRRLCYRQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | HL-60 | Breast cancer | CC50 : 9.0 ± 1.1μM |
| dbacp00474 | [G1K, K8R]cGm | KCRRLCYRQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | HL-60 | Cervical cancer | CC50 : 9.0 ± 1.1μM |
| dbacp00475 | [G1K, K8R]cGm | KCRRLCYRQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | PBMCs | Epithelial cancer | CC50 : 5.1 ± 0.3 μM |
| dbacp00476 | [G1K, K8R]cGm | KCRRLCYRQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | PBMCs | Chronic myeloid Leukemia | CC50 : 5.1 ± 0.3 μM |
| dbacp00477 | [G1K, K8R]cGm | KCRRLCYRQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | PBMCs | Gastric cancer | CC50 : 5.1 ± 0.3 μM |
| dbacp00478 | [G1K, K8R]cGm | KCRRLCYRQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | PBMCs | Breast cancer | CC50 : 5.1 ± 0.3 μM |
| dbacp00479 | [G1K, K8R]cGm | KCRRLCYRQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | PBMCs | Cervical cancer | CC50 : 5.1 ± 0.3 μM |
| dbacp00480 | [G1K, L5Y, K8R]cGm | KCRRYCYRQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | CRL-1739 | Epithelial cancer | CC50 : 26.5 ± 2.4 μM |
| dbacp00481 | [G1K, L5Y, K8R]cGm | KCRRYCYRQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | CRL-1739 | Chronic myeloid Leukemia | CC50 : 26.5 ± 2.4 μM |
| dbacp00482 | [G1K, L5Y, K8R]cGm | KCRRYCYRQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | CRL-1739 | Gastric cancer | CC50 : 26.5 ± 2.4 μM |
| dbacp00483 | [G1K, L5Y, K8R]cGm | KCRRYCYRQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | CRL-1739 | Breast cancer | CC50 : 26.5 ± 2.4 μM |
| dbacp00484 | [G1K, L5Y, K8R]cGm | KCRRYCYRQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | CRL-1739 | Cervical cancer | CC50 : 26.5 ± 2.4 μM |
| dbacp00485 | [G1K, L5Y, K8R]cGm | KCRRYCYRQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | MM96L | Epithelial cancer | CC50 : 2.0 ± 0.1 μM |
| dbacp00486 | [G1K, L5Y, K8R]cGm | KCRRYCYRQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | MM96L | Chronic myeloid Leukemia | CC50 : 2.0 ± 0.1 μM |
| dbacp00487 | [G1K, L5Y, K8R]cGm | KCRRYCYRQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | MM96L | Gastric cancer | CC50 : 2.0 ± 0.1 μM |
| dbacp00488 | [G1K, L5Y, K8R]cGm | KCRRYCYRQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | MM96L | Breast cancer | CC50 : 2.0 ± 0.1 μM |
| dbacp00489 | [G1K, L5Y, K8R]cGm | KCRRYCYRQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | MM96L | Cervical cancer | CC50 : 2.0 ± 0.1 μM |
| dbacp00490 | [G1K, L5Y, K8R]cGm | KCRRYCYRQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | HFF-1 | Epithelial cancer | CC50 : 14.7 ± 1.5 μM |
| dbacp00491 | [G1K, L5Y, K8R]cGm | KCRRYCYRQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | HFF-1 | Chronic myeloid Leukemia | CC50 : 14.7 ± 1.5 μM |
| dbacp00492 | [G1K, L5Y, K8R]cGm | KCRRYCYRQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | HFF-1 | Gastric cancer | CC50 : 14.7 ± 1.5 μM |
| dbacp00493 | [G1K, L5Y, K8R]cGm | KCRRYCYRQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | HFF-1 | Breast cancer | CC50 : 14.7 ± 1.5 μM |
| dbacp00494 | [G1K, L5Y, K8R]cGm | KCRRYCYRQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | HFF-1 | Cervical cancer | CC50 : 14.7 ± 1.5 μM |
| dbacp00495 | [G1K, L5Y, K8R]cGm | KCRRYCYRQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | HeLa | Epithelial cancer | CC50 : 20.9 ± 1.4 μM |
| dbacp00496 | [G1K, L5Y, K8R]cGm | KCRRYCYRQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | HeLa | Chronic myeloid Leukemia | CC50 : 20.9 ± 1.4 μM |
| dbacp00497 | [G1K, L5Y, K8R]cGm | KCRRYCYRQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | HeLa | Gastric cancer | CC50 : 20.9 ± 1.4 μM |
| dbacp00498 | [G1K, L5Y, K8R]cGm | KCRRYCYRQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | HeLa | Breast cancer | CC50 : 20.9 ± 1.4 μM |
| dbacp00499 | [G1K, L5Y, K8R]cGm | KCRRYCYRQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | HeLa | Cervical cancer | CC50 : 20.9 ± 1.4 μM |
| dbacp00500 | [G1K, L5Y, K8R]cGm | KCRRYCYRQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | MCF-7 | Epithelial cancer | CC50 : 15.2 ± 1.9 μM |
| dbacp00501 | [G1K, L5Y, K8R]cGm | KCRRYCYRQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | MCF-7 | Chronic myeloid Leukemia | CC50 : 15.2 ± 1.9 μM |
| dbacp00502 | [G1K, L5Y, K8R]cGm | KCRRYCYRQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | MCF-7 | Gastric cancer | CC50 : 15.2 ± 1.9 μM |
| dbacp00503 | [G1K, L5Y, K8R]cGm | KCRRYCYRQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | MCF-7 | Breast cancer | CC50 : 15.2 ± 1.9 μM |
| dbacp00504 | [G1K, L5Y, K8R]cGm | KCRRYCYRQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | MCF-7 | Cervical cancer | CC50 : 15.2 ± 1.9 μM |
| dbacp00505 | [G1K, L5Y, K8R]cGm | KCRRYCYRQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | K-562 | Epithelial cancer | CC50 : 1.3 ± 0.1 μM |
| dbacp00506 | [G1K, L5Y, K8R]cGm | KCRRYCYRQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | K-562 | Chronic myeloid Leukemia | CC50 : 1.3 ± 0.1 μM |
| dbacp00507 | [G1K, L5Y, K8R]cGm | KCRRYCYRQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | K-562 | Gastric cancer | CC50 : 1.3 ± 0.1 μM |
| dbacp00508 | [G1K, L5Y, K8R]cGm | KCRRYCYRQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | K-562 | Breast cancer | CC50 : 1.3 ± 0.1 μM |
| dbacp00509 | [G1K, L5Y, K8R]cGm | KCRRYCYRQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | K-562 | Cervical cancer | CC50 : 1.3 ± 0.1 μM |
| dbacp00510 | [G1K, L5Y, K8R]cGm | KCRRYCYRQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | HL-60 | Epithelial cancer | CC50 : 15.7 ±1.1μM |
| dbacp00511 | [G1K, L5Y, K8R]cGm | KCRRYCYRQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | HL-60 | Chronic myeloid Leukemia | CC50 : 15.7 ±1.1μM |
| dbacp00512 | [G1K, L5Y, K8R]cGm | KCRRYCYRQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | HL-60 | Gastric cancer | CC50 : 15.7 ±1.1μM |
| dbacp00513 | [G1K, L5Y, K8R]cGm | KCRRYCYRQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | HL-60 | Breast cancer | CC50 : 15.7 ±1.1μM |
| dbacp00514 | [G1K, L5Y, K8R]cGm | KCRRYCYRQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | HL-60 | Cervical cancer | CC50 : 15.7 ±1.1μM |
| dbacp00515 | [G1K, L5Y, K8R]cGm | KCRRYCYRQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | PBMCs | Epithelial cancer | CC50 : 10.4 ± 1.0 μM |
| dbacp00516 | [G1K, L5Y, K8R]cGm | KCRRYCYRQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | PBMCs | Chronic myeloid Leukemia | CC50 : 10.4 ± 1.0 μM |
| dbacp00517 | [G1K, L5Y, K8R]cGm | KCRRYCYRQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | PBMCs | Gastric cancer | CC50 : 10.4 ± 1.0 μM |
| dbacp00518 | [G1K, L5Y, K8R]cGm | KCRRYCYRQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | PBMCs | Breast cancer | CC50 : 10.4 ± 1.0 μM |
| dbacp00519 | [G1K, L5Y, K8R]cGm | KCRRYCYRQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | PBMCs | Cervical cancer | CC50 : 10.4 ± 1.0 μM |
| dbacp00520 | [K8R]cGm | GCRRLCYRQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | CRL-1739 | Epithelial cancer | CC50 : 29.4 ± 1.1 μM |
| dbacp00521 | [K8R]cGm | GCRRLCYRQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | CRL-1739 | Chronic myeloid Leukemia | CC50 : 29.4 ± 1.1 μM |
| dbacp00522 | [K8R]cGm | GCRRLCYRQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | CRL-1739 | Gastric cancer | CC50 : 29.4 ± 1.1 μM |
| dbacp00523 | [K8R]cGm | GCRRLCYRQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | CRL-1739 | Breast cancer | CC50 : 29.4 ± 1.1 μM |
| dbacp00524 | [K8R]cGm | GCRRLCYRQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | CRL-1739 | Cervical cancer | CC50 : 29.4 ± 1.1 μM |
| dbacp00525 | [K8R]cGm | GCRRLCYRQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | MM96L | Epithelial cancer | CC50 : 5.0 ± 0.3 μM |
| dbacp00526 | [K8R]cGm | GCRRLCYRQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | MM96L | Chronic myeloid Leukemia | CC50 : 5.0 ± 0.3 μM |
| dbacp00527 | [K8R]cGm | GCRRLCYRQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | MM96L | Gastric cancer | CC50 : 5.0 ± 0.3 μM |
| dbacp00528 | [K8R]cGm | GCRRLCYRQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | MM96L | Breast cancer | CC50 : 5.0 ± 0.3 μM |
| dbacp00529 | [K8R]cGm | GCRRLCYRQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | MM96L | Cervical cancer | CC50 : 5.0 ± 0.3 μM |
| dbacp00530 | [K8R]cGm | GCRRLCYRQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | HFF-1 | Epithelial cancer | CC50 : 34.5 ± 3.6 μM |
| dbacp00531 | [K8R]cGm | GCRRLCYRQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | HFF-1 | Chronic myeloid Leukemia | CC50 : 34.5 ± 3.6 μM |
| dbacp00532 | [K8R]cGm | GCRRLCYRQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | HFF-1 | Gastric cancer | CC50 : 34.5 ± 3.6 μM |
| dbacp00533 | [K8R]cGm | GCRRLCYRQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | HFF-1 | Breast cancer | CC50 : 34.5 ± 3.6 μM |
| dbacp00534 | [K8R]cGm | GCRRLCYRQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | HFF-1 | Cervical cancer | CC50 : 34.5 ± 3.6 μM |
| dbacp00535 | [K8R]cGm | GCRRLCYRQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | HeLa | Epithelial cancer | CC50 : 39.4 ± 2.6 μM |
| dbacp00536 | [K8R]cGm | GCRRLCYRQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | HeLa | Chronic myeloid Leukemia | CC50 : 39.4 ± 2.6 μM |
| dbacp00537 | [K8R]cGm | GCRRLCYRQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | HeLa | Gastric cancer | CC50 : 39.4 ± 2.6 μM |
| dbacp00538 | [K8R]cGm | GCRRLCYRQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | HeLa | Breast cancer | CC50 : 39.4 ± 2.6 μM |
| dbacp00539 | [K8R]cGm | GCRRLCYRQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | HeLa | Cervical cancer | CC50 : 39.4 ± 2.6 μM |
| dbacp00540 | [K8R]cGm | GCRRLCYRQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | K-562 | Epithelial cancer | CC50 : 3.1 ± 0.1 μM |
| dbacp00541 | [K8R]cGm | GCRRLCYRQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | K-562 | Chronic myeloid Leukemia | CC50 : 3.1 ± 0.1 μM |
| dbacp00542 | [K8R]cGm | GCRRLCYRQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | K-562 | Gastric cancer | CC50 : 3.1 ± 0.1 μM |
| dbacp00543 | [K8R]cGm | GCRRLCYRQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | K-562 | Breast cancer | CC50 : 3.1 ± 0.1 μM |
| dbacp00544 | [K8R]cGm | GCRRLCYRQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | K-562 | Cervical cancer | CC50 : 3.1 ± 0.1 μM |
| dbacp00545 | [L5W]cGm | GCRRWCYKQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | CRL-1739 | Epithelial cancer | CC50 : 18.3 ± 1.4 μM |
| dbacp00546 | [L5W]cGm | GCRRWCYKQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | CRL-1739 | Chronic myeloid Leukemia | CC50 : 18.3 ± 1.4 μM |
| dbacp00547 | [L5W]cGm | GCRRWCYKQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | CRL-1739 | Gastric cancer | CC50 : 18.3 ± 1.4 μM |
| dbacp00548 | [L5W]cGm | GCRRWCYKQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | CRL-1739 | Breast cancer | CC50 : 18.3 ± 1.4 μM |
| dbacp00549 | [L5W]cGm | GCRRWCYKQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | CRL-1739 | Cervical cancer | CC50 : 18.3 ± 1.4 μM |
| dbacp00550 | [L5W]cGm | GCRRWCYKQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | MM96L | Epithelial cancer | CC50 : 4.0 ± 0.1 μM |
| dbacp00551 | [L5W]cGm | GCRRWCYKQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | MM96L | Chronic myeloid Leukemia | CC50 : 4.0 ± 0.1 μM |
| dbacp00552 | [L5W]cGm | GCRRWCYKQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | MM96L | Gastric cancer | CC50 : 4.0 ± 0.1 μM |
| dbacp00553 | [L5W]cGm | GCRRWCYKQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | MM96L | Breast cancer | CC50 : 4.0 ± 0.1 μM |
| dbacp00554 | [L5W]cGm | GCRRWCYKQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | MM96L | Cervical cancer | CC50 : 4.0 ± 0.1 μM |
| dbacp00555 | [L5W]cGm | GCRRWCYKQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | HFF-1 | Epithelial cancer | CC50 : 25.0 ± 2.9 μM |
| dbacp00556 | [L5W]cGm | GCRRWCYKQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | HFF-1 | Chronic myeloid Leukemia | CC50 : 25.0 ± 2.9 μM |
| dbacp00557 | [L5W]cGm | GCRRWCYKQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | HFF-1 | Gastric cancer | CC50 : 25.0 ± 2.9 μM |
| dbacp00558 | [L5W]cGm | GCRRWCYKQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | HFF-1 | Breast cancer | CC50 : 25.0 ± 2.9 μM |
| dbacp00559 | [L5W]cGm | GCRRWCYKQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | HFF-1 | Cervical cancer | CC50 : 25.0 ± 2.9 μM |
| dbacp00560 | [L5W]cGm | GCRRWCYKQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | HeLa | Epithelial cancer | CC50 : 17.1 ± 0.7 μM |
| dbacp00561 | [L5W]cGm | GCRRWCYKQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | HeLa | Chronic myeloid Leukemia | CC50 : 17.1 ± 0.7 μM |
| dbacp00562 | [L5W]cGm | GCRRWCYKQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | HeLa | Gastric cancer | CC50 : 17.1 ± 0.7 μM |
| dbacp00563 | [L5W]cGm | GCRRWCYKQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | HeLa | Breast cancer | CC50 : 17.1 ± 0.7 μM |
| dbacp00564 | [L5W]cGm | GCRRWCYKQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | HeLa | Cervical cancer | CC50 : 17.1 ± 0.7 μM |
| dbacp00565 | [L5W]cGm | GCRRWCYKQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | K-562 | Epithelial cancer | CC50 : 1.0 ± 0.1 μM |
| dbacp00566 | [L5W]cGm | GCRRWCYKQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | K-562 | Chronic myeloid Leukemia | CC50 : 1.0 ± 0.1 μM |
| dbacp00567 | [L5W]cGm | GCRRWCYKQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | K-562 | Gastric cancer | CC50 : 1.0 ± 0.1 μM |
| dbacp00568 | [L5W]cGm | GCRRWCYKQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | K-562 | Breast cancer | CC50 : 1.0 ± 0.1 μM |
| dbacp00569 | [L5W]cGm | GCRRWCYKQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | K-562 | Cervical cancer | CC50 : 1.0 ± 0.1 μM |
| dbacp00573 | [R4A, R18A]cGm | GCRALCYKQRCVTYCRGA | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | CRL-1739 | Epithelial cancer | CC50 : > 64 μM |
| dbacp00574 | [R4A, R18A]cGm | GCRALCYKQRCVTYCRGA | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | CRL-1739 | Chronic myeloid Leukemia | CC50 : > 64 μM |
| dbacp00575 | [R4A, R18A]cGm | GCRALCYKQRCVTYCRGA | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | CRL-1739 | Gastric cancer | CC50 : > 64 μM |
| dbacp00576 | [R4A, R18A]cGm | GCRALCYKQRCVTYCRGA | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | CRL-1739 | Breast cancer | CC50 : > 64 μM |
| dbacp00577 | [R4A, R18A]cGm | GCRALCYKQRCVTYCRGA | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | CRL-1739 | Cervical cancer | CC50 : > 64 μM |
| dbacp00578 | [R4A, R18A]cGm | GCRALCYKQRCVTYCRGA | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | MM96L | Epithelial cancer | CC50 : 10.3 ± 1.1 μM |
| dbacp00579 | [R4A, R18A]cGm | GCRALCYKQRCVTYCRGA | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | MM96L | Chronic myeloid Leukemia | CC50 : 10.3 ± 1.1 μM |
| dbacp00580 | [R4A, R18A]cGm | GCRALCYKQRCVTYCRGA | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | MM96L | Gastric cancer | CC50 : 10.3 ± 1.1 μM |
| dbacp00581 | [R4A, R18A]cGm | GCRALCYKQRCVTYCRGA | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | MM96L | Breast cancer | CC50 : 10.3 ± 1.1 μM |
| dbacp00582 | [R4A, R18A]cGm | GCRALCYKQRCVTYCRGA | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | MM96L | Cervical cancer | CC50 : 10.3 ± 1.1 μM |
| dbacp00583 | [R4A, R18A]cGm | GCRALCYKQRCVTYCRGA | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | HFF-1 | Epithelial cancer | CC50 : 51.2 ± 4.0 μM |
| dbacp00584 | [R4A, R18A]cGm | GCRALCYKQRCVTYCRGA | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | HFF-1 | Chronic myeloid Leukemia | CC50 : 51.2 ± 4.0 μM |
| dbacp00585 | [R4A, R18A]cGm | GCRALCYKQRCVTYCRGA | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | HFF-1 | Gastric cancer | CC50 : 51.2 ± 4.0 μM |
| dbacp00586 | [R4A, R18A]cGm | GCRALCYKQRCVTYCRGA | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | HFF-1 | Breast cancer | CC50 : 51.2 ± 4.0 μM |
| dbacp00587 | [R4A, R18A]cGm | GCRALCYKQRCVTYCRGA | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | HFF-1 | Cervical cancer | CC50 : 51.2 ± 4.0 μM |
| dbacp00588 | [R4A, R18A]cGm | GCRALCYKQRCVTYCRGA | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | HeLa | Epithelial cancer | CC50 : > 64 μM |
| dbacp00589 | [R4A, R18A]cGm | GCRALCYKQRCVTYCRGA | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | HeLa | Chronic myeloid Leukemia | CC50 : > 64 μM |
| dbacp00590 | [R4A, R18A]cGm | GCRALCYKQRCVTYCRGA | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | HeLa | Gastric cancer | CC50 : > 64 μM |
| dbacp00591 | [R4A, R18A]cGm | GCRALCYKQRCVTYCRGA | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | HeLa | Breast cancer | CC50 : > 64 μM |
| dbacp00592 | [R4A, R18A]cGm | GCRALCYKQRCVTYCRGA | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | HeLa | Cervical cancer | CC50 : > 64 μM |
| dbacp00593 | [R4A, R18A]cGm | GCRALCYKQRCVTYCRGA | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | MCF-7 | Epithelial cancer | CC50 : 48.4 ± 0.7 μM |
| dbacp00594 | [R4A, R18A]cGm | GCRALCYKQRCVTYCRGA | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | MCF-7 | Chronic myeloid Leukemia | CC50 : 48.4 ± 0.7 μM |
| dbacp00595 | [R4A, R18A]cGm | GCRALCYKQRCVTYCRGA | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | MCF-7 | Gastric cancer | CC50 : 48.4 ± 0.7 μM |
| dbacp00596 | [R4A, R18A]cGm | GCRALCYKQRCVTYCRGA | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | MCF-7 | Breast cancer | CC50 : 48.4 ± 0.7 μM |
| dbacp00597 | [R4A, R18A]cGm | GCRALCYKQRCVTYCRGA | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | MCF-7 | Cervical cancer | CC50 : 48.4 ± 0.7 μM |
| dbacp00598 | [R4A, R18A]cGm | GCRALCYKQRCVTYCRGA | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | K-562 | Epithelial cancer | CC50 : 11.5 ± 0.6 μM |
| dbacp00599 | [R4A, R18A]cGm | GCRALCYKQRCVTYCRGA | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | K-562 | Chronic myeloid Leukemia | CC50 : 11.5 ± 0.6 μM |
| dbacp00600 | [R4A, R18A]cGm | GCRALCYKQRCVTYCRGA | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | K-562 | Gastric cancer | CC50 : 11.5 ± 0.6 μM |
| dbacp00601 | [R4A, R18A]cGm | GCRALCYKQRCVTYCRGA | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | K-562 | Breast cancer | CC50 : 11.5 ± 0.6 μM |
| dbacp00602 | [R4A, R18A]cGm | GCRALCYKQRCVTYCRGA | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | K-562 | Cervical cancer | CC50 : 11.5 ± 0.6 μM |
| dbacp00603 | [R4A, R18A]cGm | GCRALCYKQRCVTYCRGA | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | HL-60 | Epithelial cancer | CC50 : 34.1 ± 3.9 μM |
| dbacp00604 | [R4A, R18A]cGm | GCRALCYKQRCVTYCRGA | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | HL-60 | Chronic myeloid Leukemia | CC50 : 34.1 ± 3.9 μM |
| dbacp00605 | [R4A, R18A]cGm | GCRALCYKQRCVTYCRGA | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | HL-60 | Gastric cancer | CC50 : 34.1 ± 3.9 μM |
| dbacp00606 | [R4A, R18A]cGm | GCRALCYKQRCVTYCRGA | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | HL-60 | Breast cancer | CC50 : 34.1 ± 3.9 μM |
| dbacp00607 | [R4A, R18A]cGm | GCRALCYKQRCVTYCRGA | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | HL-60 | Cervical cancer | CC50 : 34.1 ± 3.9 μM |
| dbacp00608 | [R4A, R18A]cGm | GCRALCYKQRCVTYCRGA | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | PBMCs | Epithelial cancer | CC50 : 30.8 ± 2.5 μM |
| dbacp00609 | [R4A, R18A]cGm | GCRALCYKQRCVTYCRGA | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | PBMCs | Chronic myeloid Leukemia | CC50 : 30.8 ± 2.5 μM |
| dbacp00610 | [R4A, R18A]cGm | GCRALCYKQRCVTYCRGA | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | PBMCs | Gastric cancer | CC50 : 30.8 ± 2.5 μM |
| dbacp00611 | [R4A, R18A]cGm | GCRALCYKQRCVTYCRGA | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | PBMCs | Breast cancer | CC50 : 30.8 ± 2.5 μM |
| dbacp00612 | [R4A, R18A]cGm | GCRALCYKQRCVTYCRGA | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | PBMCs | Cervical cancer | CC50 : 30.8 ± 2.5 μM |
| dbacp00621 | [Y14W]cGm | GCRRLCYKQRCVTWCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | CRL-1739 | Epithelial cancer | CC50 : 30.3 ± 1.1 μM |
| dbacp00622 | [Y14W]cGm | GCRRLCYKQRCVTWCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | CRL-1739 | Chronic myeloid Leukemia | CC50 : 30.3 ± 1.1 μM |
| dbacp00623 | [Y14W]cGm | GCRRLCYKQRCVTWCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | CRL-1739 | Gastric cancer | CC50 : 30.3 ± 1.1 μM |
| dbacp00624 | [Y14W]cGm | GCRRLCYKQRCVTWCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | CRL-1739 | Breast cancer | CC50 : 30.3 ± 1.1 μM |
| dbacp00625 | [Y14W]cGm | GCRRLCYKQRCVTWCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | CRL-1739 | Cervical cancer | CC50 : 30.3 ± 1.1 μM |
| dbacp00626 | [Y14W]cGm | GCRRLCYKQRCVTWCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | MM96L | Epithelial cancer | CC50 : 4.0 ± 0.1 μM |
| dbacp00627 | [Y14W]cGm | GCRRLCYKQRCVTWCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | MM96L | Chronic myeloid Leukemia | CC50 : 4.0 ± 0.1 μM |
| dbacp00628 | [Y14W]cGm | GCRRLCYKQRCVTWCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | MM96L | Gastric cancer | CC50 : 4.0 ± 0.1 μM |
| dbacp00629 | [Y14W]cGm | GCRRLCYKQRCVTWCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | MM96L | Breast cancer | CC50 : 4.0 ± 0.1 μM |
| dbacp00630 | [Y14W]cGm | GCRRLCYKQRCVTWCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | MM96L | Cervical cancer | CC50 : 4.0 ± 0.1 μM |
| dbacp00631 | [Y14W]cGm | GCRRLCYKQRCVTWCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | HFF-1 | Epithelial cancer | CC50 : 68.4 ± 9.6 μM |
| dbacp00632 | [Y14W]cGm | GCRRLCYKQRCVTWCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | HFF-1 | Chronic myeloid Leukemia | CC50 : 68.4 ± 9.6 μM |
| dbacp00633 | [Y14W]cGm | GCRRLCYKQRCVTWCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | HFF-1 | Gastric cancer | CC50 : 68.4 ± 9.6 μM |
| dbacp00634 | [Y14W]cGm | GCRRLCYKQRCVTWCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | HFF-1 | Breast cancer | CC50 : 68.4 ± 9.6 μM |
| dbacp00635 | [Y14W]cGm | GCRRLCYKQRCVTWCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | HFF-1 | Cervical cancer | CC50 : 68.4 ± 9.6 μM |
| dbacp00636 | [Y14W]cGm | GCRRLCYKQRCVTWCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | HeLa | Epithelial cancer | CC50 : 50.4 ± 2.4 μM |
| dbacp00637 | [Y14W]cGm | GCRRLCYKQRCVTWCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | HeLa | Chronic myeloid Leukemia | CC50 : 50.4 ± 2.4 μM |
| dbacp00638 | [Y14W]cGm | GCRRLCYKQRCVTWCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | HeLa | Gastric cancer | CC50 : 50.4 ± 2.4 μM |
| dbacp00639 | [Y14W]cGm | GCRRLCYKQRCVTWCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | HeLa | Breast cancer | CC50 : 50.4 ± 2.4 μM |
| dbacp00640 | [Y14W]cGm | GCRRLCYKQRCVTWCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | HeLa | Cervical cancer | CC50 : 50.4 ± 2.4 μM |
| dbacp00641 | [Y14W]cGm | GCRRLCYKQRCVTWCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | K-562 | Epithelial cancer | CC50 : 2.7 ± 0.1 μM |
| dbacp00642 | [Y14W]cGm | GCRRLCYKQRCVTWCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | K-562 | Chronic myeloid Leukemia | CC50 : 2.7 ± 0.1 μM |
| dbacp00643 | [Y14W]cGm | GCRRLCYKQRCVTWCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | K-562 | Gastric cancer | CC50 : 2.7 ± 0.1 μM |
| dbacp00644 | [Y14W]cGm | GCRRLCYKQRCVTWCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | K-562 | Breast cancer | CC50 : 2.7 ± 0.1 μM |
| dbacp00645 | [Y14W]cGm | GCRRLCYKQRCVTWCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | K-562 | Cervical cancer | CC50 : 2.7 ± 0.1 μM |
| dbacp00646 | [Y7W, K8R, Y14W]cGm | GCRRLCWRQRCVTWCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | CRL-1739 | Epithelial cancer | CC50 : 31.6 ± 1.3 μM |
| dbacp00647 | [Y7W, K8R, Y14W]cGm | GCRRLCWRQRCVTWCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | CRL-1739 | Chronic myeloid Leukemia | CC50 : 31.6 ± 1.3 μM |
| dbacp00648 | [Y7W, K8R, Y14W]cGm | GCRRLCWRQRCVTWCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | CRL-1739 | Gastric cancer | CC50 : 31.6 ± 1.3 μM |
| dbacp00649 | [Y7W, K8R, Y14W]cGm | GCRRLCWRQRCVTWCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | CRL-1739 | Breast cancer | CC50 : 31.6 ± 1.3 μM |
| dbacp00650 | [Y7W, K8R, Y14W]cGm | GCRRLCWRQRCVTWCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | CRL-1739 | Cervical cancer | CC50 : 31.6 ± 1.3 μM |
| dbacp00651 | [Y7W, K8R, Y14W]cGm | GCRRLCWRQRCVTWCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | MM96L | Epithelial cancer | CC50 : 5.4 ± 0.3 μM |
| dbacp00652 | [Y7W, K8R, Y14W]cGm | GCRRLCWRQRCVTWCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | MM96L | Chronic myeloid Leukemia | CC50 : 5.4 ± 0.3 μM |
| dbacp00653 | [Y7W, K8R, Y14W]cGm | GCRRLCWRQRCVTWCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | MM96L | Gastric cancer | CC50 : 5.4 ± 0.3 μM |
| dbacp00654 | [Y7W, K8R, Y14W]cGm | GCRRLCWRQRCVTWCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | MM96L | Breast cancer | CC50 : 5.4 ± 0.3 μM |
| dbacp00655 | [Y7W, K8R, Y14W]cGm | GCRRLCWRQRCVTWCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | MM96L | Cervical cancer | CC50 : 5.4 ± 0.3 μM |
| dbacp00656 | [Y7W, K8R, Y14W]cGm | GCRRLCWRQRCVTWCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | HFF-1 | Epithelial cancer | CC50 : 31.3 ± 2.6 μM |
| dbacp00657 | [Y7W, K8R, Y14W]cGm | GCRRLCWRQRCVTWCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | HFF-1 | Chronic myeloid Leukemia | CC50 : 31.3 ± 2.6 μM |
| dbacp00658 | [Y7W, K8R, Y14W]cGm | GCRRLCWRQRCVTWCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | HFF-1 | Gastric cancer | CC50 : 31.3 ± 2.6 μM |
| dbacp00659 | [Y7W, K8R, Y14W]cGm | GCRRLCWRQRCVTWCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | HFF-1 | Breast cancer | CC50 : 31.3 ± 2.6 μM |
| dbacp00660 | [Y7W, K8R, Y14W]cGm | GCRRLCWRQRCVTWCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | HFF-1 | Cervical cancer | CC50 : 31.3 ± 2.6 μM |
| dbacp00661 | [Y7W, K8R, Y14W]cGm | GCRRLCWRQRCVTWCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | HeLa | Epithelial cancer | CC50 : 41.0 ± 4.2 μM |
| dbacp00662 | [Y7W, K8R, Y14W]cGm | GCRRLCWRQRCVTWCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | HeLa | Chronic myeloid Leukemia | CC50 : 41.0 ± 4.2 μM |
| dbacp00663 | [Y7W, K8R, Y14W]cGm | GCRRLCWRQRCVTWCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | HeLa | Gastric cancer | CC50 : 41.0 ± 4.2 μM |
| dbacp00664 | [Y7W, K8R, Y14W]cGm | GCRRLCWRQRCVTWCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | HeLa | Breast cancer | CC50 : 41.0 ± 4.2 μM |
| dbacp00665 | [Y7W, K8R, Y14W]cGm | GCRRLCWRQRCVTWCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | HeLa | Cervical cancer | CC50 : 41.0 ± 4.2 μM |
| dbacp00666 | [Y7W, K8R, Y14W]cGm | GCRRLCWRQRCVTWCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | MCF-7 | Epithelial cancer | CC50 : 15.1 ± 1.4 μM |
| dbacp00667 | [Y7W, K8R, Y14W]cGm | GCRRLCWRQRCVTWCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | MCF-7 | Chronic myeloid Leukemia | CC50 : 15.1 ± 1.4 μM |
| dbacp00668 | [Y7W, K8R, Y14W]cGm | GCRRLCWRQRCVTWCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | MCF-7 | Gastric cancer | CC50 : 15.1 ± 1.4 μM |
| dbacp00669 | [Y7W, K8R, Y14W]cGm | GCRRLCWRQRCVTWCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | MCF-7 | Breast cancer | CC50 : 15.1 ± 1.4 μM |
| dbacp00670 | [Y7W, K8R, Y14W]cGm | GCRRLCWRQRCVTWCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | MCF-7 | Cervical cancer | CC50 : 15.1 ± 1.4 μM |
| dbacp00671 | [Y7W, K8R, Y14W]cGm | GCRRLCWRQRCVTWCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | K-562 | Epithelial cancer | CC50 : 3.9 ± 0.1 μM |
| dbacp00672 | [Y7W, K8R, Y14W]cGm | GCRRLCWRQRCVTWCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | K-562 | Chronic myeloid Leukemia | CC50 : 3.9 ± 0.1 μM |
| dbacp00673 | [Y7W, K8R, Y14W]cGm | GCRRLCWRQRCVTWCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | K-562 | Gastric cancer | CC50 : 3.9 ± 0.1 μM |
| dbacp00674 | [Y7W, K8R, Y14W]cGm | GCRRLCWRQRCVTWCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | K-562 | Breast cancer | CC50 : 3.9 ± 0.1 μM |
| dbacp00675 | [Y7W, K8R, Y14W]cGm | GCRRLCWRQRCVTWCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | K-562 | Cervical cancer | CC50 : 3.9 ± 0.1 μM |
| dbacp00676 | [Y7W]cGm | GCRRLCWKQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | CRL-1739 | Epithelial cancer | CC50 : 23.3 ± 0.4 μM |
| dbacp00677 | [Y7W]cGm | GCRRLCWKQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | CRL-1739 | Chronic myeloid Leukemia | CC50 : 23.3 ± 0.4 μM |
| dbacp00678 | [Y7W]cGm | GCRRLCWKQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | CRL-1739 | Gastric cancer | CC50 : 23.3 ± 0.4 μM |
| dbacp00679 | [Y7W]cGm | GCRRLCWKQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | CRL-1739 | Breast cancer | CC50 : 23.3 ± 0.4 μM |
| dbacp00680 | [Y7W]cGm | GCRRLCWKQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | CRL-1739 | Cervical cancer | CC50 : 23.3 ± 0.4 μM |
| dbacp00681 | [Y7W]cGm | GCRRLCWKQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | MM96L | Epithelial cancer | CC50 : 5.1 ± 0.3 μM |
| dbacp00682 | [Y7W]cGm | GCRRLCWKQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | MM96L | Chronic myeloid Leukemia | CC50 : 5.1 ± 0.3 μM |
| dbacp00683 | [Y7W]cGm | GCRRLCWKQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | MM96L | Gastric cancer | CC50 : 5.1 ± 0.3 μM |
| dbacp00684 | [Y7W]cGm | GCRRLCWKQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | MM96L | Breast cancer | CC50 : 5.1 ± 0.3 μM |
| dbacp00685 | [Y7W]cGm | GCRRLCWKQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | MM96L | Cervical cancer | CC50 : 5.1 ± 0.3 μM |
| dbacp00686 | [Y7W]cGm | GCRRLCWKQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | HFF-1 | Epithelial cancer | CC50 : 39.7 ± 3.8 μM |
| dbacp00687 | [Y7W]cGm | GCRRLCWKQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | HFF-1 | Chronic myeloid Leukemia | CC50 : 39.7 ± 3.8 μM |
| dbacp00688 | [Y7W]cGm | GCRRLCWKQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | HFF-1 | Gastric cancer | CC50 : 39.7 ± 3.8 μM |
| dbacp00689 | [Y7W]cGm | GCRRLCWKQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | HFF-1 | Breast cancer | CC50 : 39.7 ± 3.8 μM |
| dbacp00690 | [Y7W]cGm | GCRRLCWKQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | HFF-1 | Cervical cancer | CC50 : 39.7 ± 3.8 μM |
| dbacp00691 | [Y7W]cGm | GCRRLCWKQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | HeLa | Epithelial cancer | CC50 : > 64 μM |
| dbacp00692 | [Y7W]cGm | GCRRLCWKQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | HeLa | Chronic myeloid Leukemia | CC50 : > 64 μM |
| dbacp00693 | [Y7W]cGm | GCRRLCWKQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | HeLa | Gastric cancer | CC50 : > 64 μM |
| dbacp00694 | [Y7W]cGm | GCRRLCWKQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | HeLa | Breast cancer | CC50 : > 64 μM |
| dbacp00695 | [Y7W]cGm | GCRRLCWKQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | HeLa | Cervical cancer | CC50 : > 64 μM |
| dbacp00696 | [Y7W]cGm | GCRRLCWKQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | K-562 | Epithelial cancer | CC50 : 3.9 ± 0.2 μM |
| dbacp00697 | [Y7W]cGm | GCRRLCWKQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | K-562 | Chronic myeloid Leukemia | CC50 : 3.9 ± 0.2 μM |
| dbacp00698 | [Y7W]cGm | GCRRLCWKQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | K-562 | Gastric cancer | CC50 : 3.9 ± 0.2 μM |
| dbacp00699 | [Y7W]cGm | GCRRLCWKQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | K-562 | Breast cancer | CC50 : 3.9 ± 0.2 μM |
| dbacp00700 | [Y7W]cGm | GCRRLCWKQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | K-562 | Cervical cancer | CC50 : 3.9 ± 0.2 μM |
| dbacp01160 | Antimicrobial peptide TsAP-1 | MQIKHLITLFFLVLIVADQCSAFLSLIPSLVGGSISAFKGRRKREISAQIEQYKDLQKREAELEELLDRLPMY | Brazilian scorpion | Membrane disruption | MTT Cell viability assay | NCIeH157 | Human squamous carcinoma | IC50 : 0.83 - 2.0 μM |
| dbacp01161 | Antimicrobial peptide TsAP-1 | MQIKHLITLFFLVLIVADQCSAFLSLIPSLVGGSISAFKGRRKREISAQIEQYKDLQKREAELEELLDRLPMY | Brazilian scorpion | Membrane disruption | MTT Cell viability assay | NCIeH838 | Human Lung adenocarcinoma | IC50 : 0.83 - 2.0 μM |
| dbacp01162 | Antimicrobial peptide TsAP-1 | MQIKHLITLFFLVLIVADQCSAFLSLIPSLVGGSISAFKGRRKREISAQIEQYKDLQKREAELEELLDRLPMY | Brazilian scorpion | Membrane disruption | MTT Cell viability assay | PC-3 | androgen-independent Prostate adenocarcinoma | IC50 : 0.83 - 2.0 μM |
| dbacp01163 | Antimicrobial peptide TsAP-1 | MQIKHLITLFFLVLIVADQCSAFLSLIPSLVGGSISAFKGRRKREISAQIEQYKDLQKREAELEELLDRLPMY | Brazilian scorpion | Membrane disruption | MTT Cell viability assay | MCF-7 | Human breast carcinoma | IC50 : 0.83 - 2.0 μM |
| dbacp01164 | Antimicrobial peptide TsAP-1 | MQIKHLITLFFLVLIVADQCSAFLSLIPSLVGGSISAFKGRRKREISAQIEQYKDLQKREAELEELLDRLPMY | Brazilian scorpion | Membrane disruption | MTT Cell viability assay | U251 | Human glioblastoma | IC50 : 0.83 - 2.0 μM |
| dbacp02168 | C7A | KILRGVAKKIMRTFLRRISKDILTGKK | NK-2 peptide based derivatives | Apoptosis; Necrosis | Cell viability assay | HCT-116 | Colorectal cancer | Cell viability : >50% at 25μM approx. |
| dbacp02169 | C7A | KILRGVAKKIMRTFLRRISKDILTGKK | NK-2 peptide based derivatives | Apoptosis; Necrosis | Cell viability assay | HROC24 | Colorectal cancer | Cell viability : >60% at 25μM approx. |
| dbacp02170 | C7A | KILRGVAKKIMRTFLRRISKDILTGKK | NK-2 peptide based derivatives | Apoptosis; Necrosis | Cell viability assay | HROC40 | Colorectal cancer | Cell viability : >60% at 25μM approx. |
| dbacp02171 | C7A | KILRGVAKKIMRTFLRRISKDILTGKK | NK-2 peptide based derivatives | Apoptosis; Necrosis | Cell viability assay | HROC60 | Colorectal cancer | Cell viability : >50% at 25μM approx. |
| dbacp02172 | C7A | KILRGVAKKIMRTFLRRISKDILTGKK | NK-2 peptide based derivatives | Apoptosis; Necrosis | Cell viability assay | HROC32 | Colorectal cancer | Cell viability : >60% at 25μM approx. |
| dbacp02173 | C7A | KILRGVAKKIMRTFLRRISKDILTGKK | NK-2 peptide based derivatives | Apoptosis; Necrosis | Cell viability assay | HCT-116 | Colorectal cancer | Cell viability : >40% at 12.5μM approx. |
| dbacp02174 | C7A | KILRGVAKKIMRTFLRRISKDILTGKK | NK-2 peptide based derivatives | Apoptosis; Necrosis | Cell viability assay | HROC18 | Colorectal cancer | Cell viability : >55% at 12.5μM approx. |
| dbacp02175 | C7A | KILRGVAKKIMRTFLRRISKDILTGKK | NK-2 peptide based derivatives | Apoptosis; Necrosis | Cell viability assay | HROC24 | Colorectal cancer | Cell viability : >55% at 12.5μM approx. |
| dbacp02176 | C7A | KILRGVAKKIMRTFLRRISKDILTGKK | NK-2 peptide based derivatives | Apoptosis; Necrosis | Cell viability assay | HROC40 | Colorectal cancer | Cell viability : >45% at 12.5μM approx. |
| dbacp02177 | C7A | KILRGVAKKIMRTFLRRISKDILTGKK | NK-2 peptide based derivatives | Apoptosis; Necrosis | Cell viability assay | HROC60 | Colorectal cancer | Cell viability : >70% at 12.5μM approx. |
| dbacp02178 | C7A | KILRGVAKKIMRTFLRRISKDILTGKK | NK-2 peptide based derivatives | Apoptosis; Necrosis | Cell viability assay | HROC113 | Colorectal cancer | Cell viability : >80% at 12.5μM approx. |
| dbacp02179 | C7A | KILRGVAKKIMRTFLRRISKDILTGKK | NK-2 peptide based derivatives | Apoptosis; Necrosis | Cell viability assay | HROC32 | Colorectal cancer | Cell viability : >55% at 12.5μM approx. |
| dbacp02180 | C7A | KILRGVAKKIMRTFLRRISKDILTGKK | NK-2 peptide based derivatives | Apoptosis; Necrosis | Cell viability assay | HROC107 | Colorectal cancer | Cell viability : >50% at 12.5μM approx. |
| dbacp02189 | C7A-D21K | KILRGVAKKIMRTFLRRISKKILTGKK | NK-2 peptide based derivatives | Apoptosis; Necrosis | Cell viability assay | HCT-116 | Colorectal cancer | Cell viability : 50% at 12.5μM approx. |
| dbacp02190 | C7A-D21K | KILRGVAKKIMRTFLRRISKKILTGKK | NK-2 peptide based derivatives | Apoptosis; Necrosis | Cell viability assay | HROC24 | Colorectal cancer | Cell viability : >50% at 25μM approx. |
| dbacp02191 | C7A-D21K | KILRGVAKKIMRTFLRRISKKILTGKK | NK-2 peptide based derivatives | Apoptosis; Necrosis | Cell viability assay | HROC40 | Colorectal cancer | Cell viability : >50% at 25μM approx.. |
| dbacp02192 | C7A-D21K | KILRGVAKKIMRTFLRRISKKILTGKK | NK-2 peptide based derivatives | Apoptosis; Necrosis | Cell viability assay | HROC60 | Colorectal cancer | Cell viability : >50% at 25μM approx. |
| dbacp02193 | C7A-D21K | KILRGVAKKIMRTFLRRISKKILTGKK | NK-2 peptide based derivatives | Apoptosis; Necrosis | Cell viability assay | HROC32 | Colorectal cancer | Cell viability : 50% at 12.5μM approx. |
| dbacp02194 | C7A-D21K | KILRGVAKKIMRTFLRRISKKILTGKK | NK-2 peptide based derivatives | Apoptosis; Necrosis | Cell viability assay | HCT-116 | Colorectal cancer | Cell viability : >40% at 12.5μM approx. |
| dbacp02195 | C7A-D21K | KILRGVAKKIMRTFLRRISKKILTGKK | NK-2 peptide based derivatives | Apoptosis; Necrosis | Cell viability assay | HROC18 | Colorectal cancer | Cell viability : >55% at 12.5μM approx. |
| dbacp02196 | C7A-D21K | KILRGVAKKIMRTFLRRISKKILTGKK | NK-2 peptide based derivatives | Apoptosis; Necrosis | Cell viability assay | HROC24 | Colorectal cancer | Cell viability : >55% at 12.5μM approx. |
| dbacp02197 | C7A-D21K | KILRGVAKKIMRTFLRRISKKILTGKK | NK-2 peptide based derivatives | Apoptosis; Necrosis | Cell viability assay | HROC40 | Colorectal cancer | Cell viability : >80% at 12.5μM approx. |
| dbacp02198 | C7A-D21K | KILRGVAKKIMRTFLRRISKKILTGKK | NK-2 peptide based derivatives | Apoptosis; Necrosis | Cell viability assay | HROC60 | Colorectal cancer | Cell viability : >60% at 12.5μM approx. |
| dbacp02199 | C7A-D21K | KILRGVAKKIMRTFLRRISKKILTGKK | NK-2 peptide based derivatives | Apoptosis; Necrosis | Cell viability assay | HROC113 | Colorectal cancer | Cell viability : >65% at 12.5μM approx. |
| dbacp02200 | C7A-D21K | KILRGVAKKIMRTFLRRISKKILTGKK | NK-2 peptide based derivatives | Apoptosis; Necrosis | Cell viability assay | HROC32 | Colorectal cancer | Cell viability : >80% at 12.5μM approx. |
| dbacp02201 | C7A-D21K | KILRGVAKKIMRTFLRRISKKILTGKK | NK-2 peptide based derivatives | Apoptosis; Necrosis | Cell viability assay | HROC107 | Colorectal cancer | Cell viability : >65% at 12.5μM approx. |
| dbacp02209 | C7A-Δ | KILRGVAKKIMRTFLRRISKDILTGKK | NK-2 peptide based derivatives | Apoptosis; Necrosis | Cell viability assay | HCT-116 | Colorectal cancer | Cell viability : >50% at 12.5μM approx. |
| dbacp02210 | C7A-Δ | KILRGVAKKIMRTFLRRISKDILTGKK | NK-2 peptide based derivatives | Apoptosis; Necrosis | Cell viability assay | HROC24 | Colorectal cancer | Cell viability : >60% at 25μM approx. |
| dbacp02211 | C7A-Δ | KILRGVAKKIMRTFLRRISKDILTGKK | NK-2 peptide based derivatives | Apoptosis; Necrosis | Cell viability assay | HROC40 | Colorectal cancer | Cell viability : >50% at 25μM approx. |
| dbacp02212 | C7A-Δ | KILRGVAKKIMRTFLRRISKDILTGKK | NK-2 peptide based derivatives | Apoptosis; Necrosis | Cell viability assay | HROC60 | Colorectal cancer | Cell viability : >50% at 25μM approx. |
| dbacp02213 | C7A-Δ | KILRGVAKKIMRTFLRRISKDILTGKK | NK-2 peptide based derivatives | Apoptosis; Necrosis | Cell viability assay | HROC32 | Colorectal cancer | Cell viability : 50% at 12.5μM approx. |
| dbacp02214 | C7A-Δ | KILRGVAKKIMRTFLRRISKDILTGKK | NK-2 peptide based derivatives | Apoptosis; Necrosis | Cell viability assay | HCT-116 | Colorectal cancer | Cell viability : >50% at 12.5μM approx. |
| dbacp02215 | C7A-Δ | KILRGVAKKIMRTFLRRISKDILTGKK | NK-2 peptide based derivatives | Apoptosis; Necrosis | Cell viability assay | HROC18 | Colorectal cancer | Cell viability : >75% at 12.5μM approx. |
| dbacp02216 | C7A-Δ | KILRGVAKKIMRTFLRRISKDILTGKK | NK-2 peptide based derivatives | Apoptosis; Necrosis | Cell viability assay | HROC24 | Colorectal cancer | Cell viability : >70% at 12.5μM approx. |
| dbacp02217 | C7A-Δ | KILRGVAKKIMRTFLRRISKDILTGKK | NK-2 peptide based derivatives | Apoptosis; Necrosis | Cell viability assay | HROC40 | Colorectal cancer | Cell viability : >85% at 12.5μM approx. |
| dbacp02218 | C7A-Δ | KILRGVAKKIMRTFLRRISKDILTGKK | NK-2 peptide based derivatives | Apoptosis; Necrosis | Cell viability assay | HROC60 | Colorectal cancer | Cell viability : >70% at 12.5μM approx. |
| dbacp02219 | C7A-Δ | KILRGVAKKIMRTFLRRISKDILTGKK | NK-2 peptide based derivatives | Apoptosis; Necrosis | Cell viability assay | HROC113 | Colorectal cancer | Cell viability : >70% at 12.5μM approx. |
| dbacp02220 | C7A-Δ | KILRGVAKKIMRTFLRRISKDILTGKK | NK-2 peptide based derivatives | Apoptosis; Necrosis | Cell viability assay | HROC32 | Colorectal cancer | Cell viability : >85% at 12.5μM approx. |
| dbacp02221 | C7A-Δ | KILRGVAKKIMRTFLRRISKDILTGKK | NK-2 peptide based derivatives | Apoptosis; Necrosis | Cell viability assay | HROC107 | Colorectal cancer | Cell viability : >70% at 12.5μM approx. |
| dbacp02330 | Cecropin A | KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK | Silkmoth | Membrane disruption | Cell viability assay | 486P | Bladder cancer | IC50 : 69.2 µg/ml |
| dbacp02331 | Cecropin A | KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK | Silkmoth | Membrane disruption | Cell viability assay | RT4 | Bladder cancer | IC50 : 96.22 µg/ml |
| dbacp02332 | Cecropin A | KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK | Silkmoth | Membrane disruption | Cell viability assay | 647V | Bladder cancer | IC50 : 28.74 µg/ml |
| dbacp02333 | Cecropin A | KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK | Silkmoth | Membrane disruption | Cell viability assay | J82 | Bladder cancer | IC50 : 99.01 µg/ml |
| dbacp02340 | Cecropin A | KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK | Isolated from the giant silk moth, cecropia moth | Membrane damage; Apoptotic cell death; Necrosis | Cell viability assay | SCC25 | Skin cancer | 0.6 ± 0.6% cell growth inhibition at 10 µM |
| dbacp02341 | Cecropin A | KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK | Isolated from the giant silk moth, cecropia moth | Membrane damage; Apoptotic cell death; Necrosis | Cell viability assay | SCC25 | Skin cancer | 107.0 ± 5.0% cell growth inhibition at 1 µM |
| dbacp02349 | Cecropin B | KWKIFKKIEKVGRNIRNGIIKAGPAVAVLGEAKAL | Chinese oak silk moth | Membrane disruption | Cell viability assay | 486P | Bladder cancer | IC50 : 87.47 µg/ml |
| dbacp02350 | Cecropin B | KWKIFKKIEKVGRNIRNGIIKAGPAVAVLGEAKAL | Chinese oak silk moth | Membrane disruption | Cell viability assay | RT4 | Bladder cancer | IC50 : 92.9 µg/ml |
| dbacp02351 | Cecropin B | KWKIFKKIEKVGRNIRNGIIKAGPAVAVLGEAKAL | Chinese oak silk moth | Membrane disruption | Cell viability assay | 647V | Bladder cancer | IC50 : 61.86 µg/ml |
| dbacp02352 | Cecropin B | KWKIFKKIEKVGRNIRNGIIKAGPAVAVLGEAKAL | Chinese oak silk moth | Membrane disruption | Cell viability assay | J82 | Bladder cancer | IC50 : 77.51 µg/ml |
| dbacp02395 | cGm (Derived from Gm) | GCRRLCYKQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | CRL-1739 | Epithelial cancer | CC50 : 39.8 ± 1.0 μM |
| dbacp02396 | cGm (Derived from Gm) | GCRRLCYKQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | CRL-1739 | Chronic myeloid leukemia | CC50 : 39.8 ± 1.0 μM |
| dbacp02397 | cGm (Derived from Gm) | GCRRLCYKQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | CRL-1739 | Gastric cancer | CC50 : 39.8 ± 1.0 μM |
| dbacp02398 | cGm (Derived from Gm) | GCRRLCYKQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | CRL-1739 | Breast cancer | CC50 : 39.8 ± 1.0 μM |
| dbacp02399 | cGm (Derived from Gm) | GCRRLCYKQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | CRL-1739 | Cervical cancer | CC50 : 39.8 ± 1.0 μM |
| dbacp02400 | cGm (Derived from Gm) | GCRRLCYKQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | MM96L | Epithelial cancer | CC50 : 2.9 ± 0.1 μM |
| dbacp02401 | cGm (Derived from Gm) | GCRRLCYKQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | MM96L | Chronic myeloid leukemia | CC50 : 2.9 ± 0.1 μM |
| dbacp02402 | cGm (Derived from Gm) | GCRRLCYKQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | MM96L | Gastric cancer | CC50 : 2.9 ± 0.1 μM |
| dbacp02403 | cGm (Derived from Gm) | GCRRLCYKQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | MM96L | Breast cancer | CC50 : 2.9 ± 0.1 μM |
| dbacp02404 | cGm (Derived from Gm) | GCRRLCYKQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | MM96L | Cervical cancer | CC50 : 2.9 ± 0.1 μM |
| dbacp02405 | cGm (Derived from Gm) | GCRRLCYKQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | HFF-1 | Epithelial cancer | CC50 : 71.7 ± 9.2 μM |
| dbacp02406 | cGm (Derived from Gm) | GCRRLCYKQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | HFF-1 | Chronic myeloid leukemia | CC50 : 71.7 ± 9.2 μM |
| dbacp02407 | cGm (Derived from Gm) | GCRRLCYKQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | HFF-1 | Gastric cancer | CC50 : 71.7 ± 9.2 μM |
| dbacp02408 | cGm (Derived from Gm) | GCRRLCYKQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | HFF-1 | Breast cancer | CC50 : 71.7 ± 9.2 μM |
| dbacp02409 | cGm (Derived from Gm) | GCRRLCYKQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | HFF-1 | Cervical cancer | CC50 : 71.7 ± 9.2 μM |
| dbacp02410 | cGm (Derived from Gm) | GCRRLCYKQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | HeLa | Epithelial cancer | CC50 : > 64 μM |
| dbacp02411 | cGm (Derived from Gm) | GCRRLCYKQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | HeLa | Chronic myeloid leukemia | CC50 : > 64 μM |
| dbacp02412 | cGm (Derived from Gm) | GCRRLCYKQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | HeLa | Gastric cancer | CC50 : > 64 μM |
| dbacp02413 | cGm (Derived from Gm) | GCRRLCYKQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | HeLa | Breast cancer | CC50 : > 64 μM |
| dbacp02414 | cGm (Derived from Gm) | GCRRLCYKQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | HeLa | Cervical cancer | CC50 : > 64 μM |
| dbacp02415 | cGm (Derived from Gm) | GCRRLCYKQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | MCF-7 | Epithelial cancer | CC50 : 15.3 ± 1.4 μM |
| dbacp02416 | cGm (Derived from Gm) | GCRRLCYKQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | MCF-7 | Chronic myeloid leukemia | CC50 : 15.3 ± 1.4 μM |
| dbacp02417 | cGm (Derived from Gm) | GCRRLCYKQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | MCF-7 | Gastric cancer | CC50 : 15.3 ± 1.4 μM |
| dbacp02418 | cGm (Derived from Gm) | GCRRLCYKQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | MCF-7 | Breast cancer | CC50 : 15.3 ± 1.4 μM |
| dbacp02419 | cGm (Derived from Gm) | GCRRLCYKQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | MCF-7 | Cervical cancer | CC50 : 15.3 ± 1.4 μM |
| dbacp02420 | cGm (Derived from Gm) | GCRRLCYKQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | K-562 | Epithelial cancer | CC50 : 2.7 ± 0.1 μM |
| dbacp02421 | cGm (Derived from Gm) | GCRRLCYKQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | K-562 | Chronic myeloid leukemia | CC50 : 2.7 ± 0.1 μM |
| dbacp02422 | cGm (Derived from Gm) | GCRRLCYKQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | K-562 | Gastric cancer | CC50 : 2.7 ± 0.1 μM |
| dbacp02423 | cGm (Derived from Gm) | GCRRLCYKQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | K-562 | Breast cancer | CC50 : 2.7 ± 0.1 μM |
| dbacp02424 | cGm (Derived from Gm) | GCRRLCYKQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | K-562 | Cervical cancer | CC50 : 2.7 ± 0.1 μM |
| dbacp02425 | cGm (Derived from Gm) | GCRRLCYKQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | PBMCs | Epithelial cancer | CC50 : 12.7 ± 1.1 μM |
| dbacp02426 | cGm (Derived from Gm) | GCRRLCYKQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | PBMCs | Chronic myeloid leukemia | CC50 : 12.7 ± 1.1 μM |
| dbacp02427 | cGm (Derived from Gm) | GCRRLCYKQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | PBMCs | Gastric cancer | CC50 : 12.7 ± 1.1 μM |
| dbacp02428 | cGm (Derived from Gm) | GCRRLCYKQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | PBMCs | Breast cancer | CC50 : 12.7 ± 1.1 μM |
| dbacp02429 | cGm (Derived from Gm) | GCRRLCYKQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | PBMCs | Cervical cancer | CC50 : 12.7 ± 1.1 μM |
| dbacp02631 | DC1 | GAFLKCGESCVYLPCLTTVVGCSCQNSVCYRD | Snake-needle grass | Apoptosis inducing | Colorimetric Cell viability assay,Migration assay ,Wound healing assay and Human prostate cancer xenograft assay | DC3 | Prostate cancer | Not found |
| dbacp02632 | DC1 | GAFLKCGESCVYLPCLTTVVGCSCQNSVCYRD | Snake-needle grass | Apoptosis inducing | Colorimetric Cell viability assay,Migration assay ,Wound healing assay and Human prostate cancer xenograft assay | LNCap | Prostate cancer | Not found |
| dbacp02633 | DC2 | GAVPCGETCVYLPCITPDIGCSCQNKVCYRD | Snake-needle grass | Apoptosis inducing | Colorimetric Cell viability assay,Migration assay ,Wound healing assay and Human prostate cancer xenograft assay | DC3 | Prostate cancer | Not found |
| dbacp02634 | DC2 | GAVPCGETCVYLPCITPDIGCSCQNKVCYRD | Snake-needle grass | Apoptosis inducing | Colorimetric Cell viability assay,Migration assay ,Wound healing assay and Human prostate cancer xenograft assay | LNCap | Prostate cancer | Not found |
| dbacp02635 | DC3 | GTSCGETCVLLPCLSSVLGCTCQNKRCYKD | Snake-needle grass | Apoptosis inducing | Colorimetric Cell viability assay,Migration assay ,Wound healing assay and Human prostate cancer xenograft assay | DC3 | Prostate cancer | Not found |
| dbacp02636 | DC3 | GTSCGETCVLLPCLSSVLGCTCQNKRCYKD | Snake-needle grass | Apoptosis inducing | Colorimetric Cell viability assay,Migration assay ,Wound healing assay and Human prostate cancer xenograft assay | LNCap | Prostate cancer | Not found |
| dbacp02655 | Dermaseptin-B2 | GLWSKIKEVGKEAAKAAAKAAGKAALGAVSEAV | Giant leaf frog | Immunomodulatory properties | Cytotoxicity assays, Cell Titer-Glo Luminescent Cell viability assay | A549 | Lung adenocarcinoma | LC50 : < 12 μM |
| dbacp02656 | Dermaseptin-B2 | GLWSKIKEVGKEAAKAAAKAAGKAALGAVSEAV | Giant leaf frog | Immunomodulatory properties | Cytotoxicity assays, Cell Titer-Glo Luminescent Cell viability assay | MDA-MB-231 | Breast adenocarcinoma | LC50 : < 12 μM |
| dbacp02657 | Dermaseptin-B2 | GLWSKIKEVGKEAAKAAAKAAGKAALGAVSEAV | Giant leaf frog | Immunomodulatory properties | Cytotoxicity assays, Cell Titer-Glo Luminescent Cell viability assay | HT-29 | Colorectal adenocarcinoma | LC50 : < 12 μM |
| dbacp02779 | Distinctin-Like-Peptide-PH | NLVSALIEGRKYLKNVLKKLNRLKEKNKAKNSKENN | Skin Secretion, Northern orange-legged leaf frog, South America | Membrane lysis via pore formation | MTT Cell viability assay, LDH assay | H157 | Prostate carcinoma | MIC : ≥ 4.197 μM |
| dbacp02780 | Distinctin-Like-Peptide-PH | NLVSALIEGRKYLKNVLKKLNRLKEKNKAKNSKENN | Skin Secretion, Northern orange-legged leaf frog, South America | Membrane lysis via pore formation | MTT Cell viability assay, LDH assay | H158 | Prostate carcinoma | IC50 : 15.41 μg/mL |
| dbacp02781 | Distinctin-Like-Peptide-PH | NLVSALIEGRKYLKNVLKKLNRLKEKNKAKNSKENN | Skin Secretion, Northern orange-legged leaf frog, South America | Membrane lysis via pore formation | MTT Cell viability assay, LDH assay | PC3 | Lung cancer | MIC : ≥ 4.197 μM |
| dbacp02782 | Distinctin-Like-Peptide-PH | NLVSALIEGRKYLKNVLKKLNRLKEKNKAKNSKENN | Skin Secretion, Northern orange-legged leaf frog, South America | Membrane lysis via pore formation | MTT Cell viability assay, LDH assay | PC3 | Lung cancer | IC50 : 32.25 μg/mL |
| dbacp02802 | Dolastatin 10 | 2-[[2-(dimethylamino)-3-methylbutanoyl]amino]-N-[3-methoxy-1-[2-[1-methoxy-2-methyl-3-oxo-3-[[2-phenyl-1-(1,3-thiazol-2-yl)ethyl]amino]propyl]pyrrolidin-1-yl]-5-methyl-1-oxoheptan-4-yl]-N,3-dimethylbutaNAmide | Wedge sea hare | Apoptosis inducing | Cell viability assay | DB | Lymphoma cancer | IC50 : 0.0013 - 0.013 nM |
| dbacp02803 | Dolastatin 10 | 2-[[2-(dimethylamino)-3-methylbutanoyl]amino]-N-[3-methoxy-1-[2-[1-methoxy-2-methyl-3-oxo-3-[[2-phenyl-1-(1,3-thiazol-2-yl)ethyl]amino]propyl]pyrrolidin-1-yl]-5-methyl-1-oxoheptan-4-yl]-N,3-dimethylbutaNAmide | Wedge sea hare | Apoptosis inducing | Cell viability assay | HT | Lymphoma cancer | IC50 : 0.0013 - 0.013 nM |
| dbacp02804 | Dolastatin 10 | 2-[[2-(dimethylamino)-3-methylbutanoyl]amino]-N-[3-methoxy-1-[2-[1-methoxy-2-methyl-3-oxo-3-[[2-phenyl-1-(1,3-thiazol-2-yl)ethyl]amino]propyl]pyrrolidin-1-yl]-5-methyl-1-oxoheptan-4-yl]-N,3-dimethylbutaNAmide | Wedge sea hare | Apoptosis inducing | Cell viability assay | RL | Lymphoma cancer | IC50 : 0.0013 - 0.013 nM |
| dbacp02805 | Dolastatin 10 | 2-[[2-(dimethylamino)-3-methylbutanoyl]amino]-N-[3-methoxy-1-[2-[1-methoxy-2-methyl-3-oxo-3-[[2-phenyl-1-(1,3-thiazol-2-yl)ethyl]amino]propyl]pyrrolidin-1-yl]-5-methyl-1-oxoheptan-4-yl]-N,3-dimethylbutaNAmide | Wedge sea hare | Apoptosis inducing | Cell viability assay | SR | Leukemia cancer | IC50 : 0.0013 - 0.013 nM |
| dbacp02806 | Dolastatin 15 | VV-nMe-VPP-2hydroxyisovaleryl-2-oxo-4-methoxy-5-benzyl-3-pyrroline | Wedge sea hare | Apoptosis inducing | Cell viability assay | DB | Lymphoma cancer | IC50 : 0.0013 - 0.013 nM |
| dbacp02807 | Dolastatin 15 | VV-nMe-VPP-2hydroxyisovaleryl-2-oxo-4-methoxy-5-benzyl-3-pyrroline | Wedge sea hare | Apoptosis inducing | Cell viability assay | HT | Lymphoma cancer | IC50 : 0.0013 - 0.013 nM |
| dbacp02808 | Dolastatin 15 | VV-nMe-VPP-2hydroxyisovaleryl-2-oxo-4-methoxy-5-benzyl-3-pyrroline | Wedge sea hare | Apoptosis inducing | Cell viability assay | RL | Lymphoma cancer | IC50 : 0.0013 - 0.013 nM |
| dbacp02809 | Dolastatin 15 | VV-nMe-VPP-2hydroxyisovaleryl-2-oxo-4-methoxy-5-benzyl-3-pyrroline | Wedge sea hare | Apoptosis inducing | Cell viability assay | SR | Leukemia cancer | IC50 : 0.0013 - 0.013 nM |
| dbacp02829 | Elastin derived peptide | VGVAPG | Elastin derived | Apoptosis inducing | Cell viability assay | MCF-7 | Breast cancer | Not found |
| dbacp02830 | Elastin derived peptide | VGVAPG | Elastin derived | Apoptosis inducing | Cell viability assay | A549 | Lung cancer | Not found |
| dbacp02919 | Esculentin-2CHa | GFSSIFRGVAKFASKGLGKDLAKLGVDLVACKISKQC | Chiricahua leopard frog | Membrane disruption and cell lysis | Cytotoxicity assay, Cell TiterGlo Luminescent cell viability assay | A549 cells | Lung adenocarcinoma | LC50 : 10μM |
| dbacp02969 | Frenatin 2.1S | GLVGTLLGHIGKAILG | Skin secretions, the Orinoco lime frog, north central Guyana, South America | Immunomodulatory activity | Cytotoxicity assay, Cell Titer-Glo Luminescent Cell Viability assay | A549 | Lung adenocarcinoma | LC50 : 80 ± 6 μM |
| dbacp02970 | Frenatin 2.1S (F2.3S) | MAFLKKSLFLVLFLGLVSLSMGEREKREEEEEEEEENKEEEANEEGKGESEEKRGLVGTLLGHIGKAILGG | Orinoco lime treefrog | Not specified | Cytotoxicity assay, Cell Titer-Glo Luminescent Cell Viability assay | A549 | Lung adenocarcinoma | LC50 : 80 ± 6 µM |
| dbacp02971 | Frenatin 2.2S | GLVGTLLGHIGKAILS | Skin secretions, the Orinoco lime frog, north central Guyana, South America | Immunomodulatory activity | Cytotoxicity assay, Cell Titer-Glo Luminescent Cell Viability assay | A549 | Lung adenocarcinoma | LC50 : 75 ± 5 μM |
| dbacp03129 | Gomesin | ZCRRLCYKQRCVTYCRGR | Tarantula spider sp. | Target and destroy tumor cell membranes | Cell viability assay | K-562 | Epithelial cancer | CC50 : 3.8 ± 0.3 μM |
| dbacp03130 | Gomesin | ZCRRLCYKQRCVTYCRGR | Tarantula spider sp. | Target and destroy tumor cell membranes | Cell viability assay | K-562 | Chronic myeloid leukemia | CC50 : 3.8 ± 0.3 μM |
| dbacp03131 | Gomesin | ZCRRLCYKQRCVTYCRGR | Tarantula spider sp. | Target and destroy tumor cell membranes | Cell viability assay | K-562 | Gastric cancer | CC50 : 3.8 ± 0.3 μM |
| dbacp03132 | Gomesin | ZCRRLCYKQRCVTYCRGR | Tarantula spider sp. | Target and destroy tumor cell membranes | Cell viability assay | K-562 | Breast cancer | CC50 : 3.8 ± 0.3 μM |
| dbacp03133 | Gomesin | ZCRRLCYKQRCVTYCRGR | Tarantula spider sp. | Target and destroy tumor cell membranes | Cell viability assay | K-562 | Cervical cancer | CC50 : 3.8 ± 0.3 μM |
| dbacp03134 | Gomesin | ZCRRLCYKQRCVTYCRGR | Tarantula spider sp. | Target and destroy tumor cell membranes | Cell viability assay | CRL-1739 | Epithelial cancer | CC50 : 67.0 ± 5.0 μM |
| dbacp03135 | Gomesin | ZCRRLCYKQRCVTYCRGR | Tarantula spider sp. | Target and destroy tumor cell membranes | Cell viability assay | CRL-1739 | Chronic myeloid leukemia | CC50 : 67.0 ± 5.0 μM |
| dbacp03136 | Gomesin | ZCRRLCYKQRCVTYCRGR | Tarantula spider sp. | Target and destroy tumor cell membranes | Cell viability assay | CRL-1739 | Gastric cancer | CC50 : 67.0 ± 5.0 μM |
| dbacp03137 | Gomesin | ZCRRLCYKQRCVTYCRGR | Tarantula spider sp. | Target and destroy tumor cell membranes | Cell viability assay | CRL-1739 | Breast cancer | CC50 : 67.0 ± 5.0 μM |
| dbacp03138 | Gomesin | ZCRRLCYKQRCVTYCRGR | Tarantula spider sp. | Target and destroy tumor cell membranes | Cell viability assay | CRL-1739 | Cervical cancer | CC50 : 67.0 ± 5.0 μM |
| dbacp03139 | Gomesin | ZCRRLCYKQRCVTYCRGR | Tarantula spider sp. | Target and destroy tumor cell membranes | Cell viability assay | MM96L | Epithelial cancer | CC50 : 3.7 ± 0.2 μM |
| dbacp03140 | Gomesin | ZCRRLCYKQRCVTYCRGR | Tarantula spider sp. | Target and destroy tumor cell membranes | Cell viability assay | MM96L | Chronic myeloid leukemia | CC50 : 3.7 ± 0.2 μM |
| dbacp03141 | Gomesin | ZCRRLCYKQRCVTYCRGR | Tarantula spider sp. | Target and destroy tumor cell membranes | Cell viability assay | MM96L | Gastric cancer | CC50 : 3.7 ± 0.2 μM |
| dbacp03142 | Gomesin | ZCRRLCYKQRCVTYCRGR | Tarantula spider sp. | Target and destroy tumor cell membranes | Cell viability assay | MM96L | Breast cancer | CC50 : 3.7 ± 0.2 μM |
| dbacp03143 | Gomesin | ZCRRLCYKQRCVTYCRGR | Tarantula spider sp. | Target and destroy tumor cell membranes | Cell viability assay | MM96L | Cervical cancer | CC50 : 3.7 ± 0.2 μM |
| dbacp03144 | Gomesin | ZCRRLCYKQRCVTYCRGR | Tarantula spider sp. | Target and destroy tumor cell membranes | Cell viability assay | HFF-1 | Epithelial cancer | CC50 : 49.9 ±16.6 μM |
| dbacp03145 | Gomesin | ZCRRLCYKQRCVTYCRGR | Tarantula spider sp. | Target and destroy tumor cell membranes | Cell viability assay | HFF-1 | Chronic myeloid leukemia | CC50 : 49.9 ±16.6 μM |
| dbacp03146 | Gomesin | ZCRRLCYKQRCVTYCRGR | Tarantula spider sp. | Target and destroy tumor cell membranes | Cell viability assay | HFF-1 | Gastric cancer | CC50 : 49.9 ±16.6 μM |
| dbacp03147 | Gomesin | ZCRRLCYKQRCVTYCRGR | Tarantula spider sp. | Target and destroy tumor cell membranes | Cell viability assay | HFF-1 | Breast cancer | CC50 : 49.9 ±16.6 μM |
| dbacp03148 | Gomesin | ZCRRLCYKQRCVTYCRGR | Tarantula spider sp. | Target and destroy tumor cell membranes | Cell viability assay | HFF-1 | Cervical cancer | CC50 : 49.9 ±16.6 μM |
| dbacp03149 | Gomesin | ZCRRLCYKQRCVTYCRGR | Tarantula spider sp. | Target and destroy tumor cell membranes | Cell viability assay | HeLa | Epithelial cancer | CC50 : 54.1 ± 5.0 μM |
| dbacp03150 | Gomesin | ZCRRLCYKQRCVTYCRGR | Tarantula spider sp. | Target and destroy tumor cell membranes | Cell viability assay | HeLa | Chronic myeloid leukemia | CC50 : 54.1 ± 5.0 μM |
| dbacp03151 | Gomesin | ZCRRLCYKQRCVTYCRGR | Tarantula spider sp. | Target and destroy tumor cell membranes | Cell viability assay | HeLa | Gastric cancer | CC50 : 54.1 ± 5.0 μM |
| dbacp03152 | Gomesin | ZCRRLCYKQRCVTYCRGR | Tarantula spider sp. | Target and destroy tumor cell membranes | Cell viability assay | HeLa | Breast cancer | CC50 : 54.1 ± 5.0 μM |
| dbacp03153 | Gomesin | ZCRRLCYKQRCVTYCRGR | Tarantula spider sp. | Target and destroy tumor cell membranes | Cell viability assay | HeLa | Cervical cancer | CC50 : 54.1 ± 5.0 μM |
| dbacp03352 | Hymenochirin-1B | KLSPETKDNLKKVLKGAIKGAIVAKMV | Zaire dwarf clawed frog | Membrane disruption and cell lysis | Cytotoxicity assay, Cell TiterGlo Luminescent Cell viability assay | A549 | Lung cancer | LC50 : 2.5 ± 0.2 μM |
| dbacp03353 | Hymenochirin-1B | KLSPETKDNLKKVLKGAIKGAIVAKMV | Zaire dwarf clawed frog | Membrane disruption and cell lysis | Cytotoxicity assay, Cell TiterGlo Luminescent Cell viability assay | MDA-MB-231 | Breast cancer | LC50 : 9.0 ± 0.3 μM |
| dbacp03354 | Hymenochirin-1B | KLSPETKDNLKKVLKGAIKGAIVAKMV | Zaire dwarf clawed frog | Membrane disruption and cell lysis | Cytotoxicity assay, Cell TiterGlo Luminescent Cell viability assay | HT-29 | Colon cancer | LC50 : 9.7 ± 0.2 μM |
| dbacp03355 | Hymenochirin-1B | KLSPETKDNLKKVLKGAIKGAIVAKMV | Zaire dwarf clawed frog | Membrane disruption and cell lysis | Cytotoxicity assay, Cell TiterGlo Luminescent Cell viability assay | HepG2 | Liver cancer | LC50 : 22.5 ± 1.4 μM |
| dbacp03363 | Hα-Defensin HNPs-1 | NA | Not found | Cellular necrosis | Cell viability assay | RCCs, HLA-DRB1*10301 | Tumor | Inhibition at 12.5 µg/ml |
| dbacp03364 | Hα-Defensin HNPs-2 | NA | Not found | Cellular necrosis | Cell viability assay | RCCs, HLA-DRB1*10301 | Tumor | Inhibition at 12.5 µg/ml |
| dbacp03365 | Hα-Defensin HNPs-3 | NA | Not found | Cellular necrosis | Cell viability assay | RCCs, HLA-DRB1*10301 | Tumor | Inhibition at 12.5 µg/ml |
| dbacp03709 | Laxaphycin A | Aoc-Hse-E-Dhb-Hyp-Hse-FLIILG | Terrestrial blue-green alga or the marine cyanobacterium | Not specified | Cell viability assay | CEM-WT | Leukemia cancer | No inhibition at 4 µM |
| dbacp03710 | Laxaphycin A | Aoc-Hse-E-Dhb-Hyp-Hse-FLIILG | Terrestrial blue-green alga or the marine cyanobacterium | Not specified | Cell viability assay | CEM-VLB | Leukemia cancer | No inhibition at 4 µM |
| dbacp03711 | Laxaphycin A | Aoc-Hse-E-Dhb-Hyp-Hse-FLIILG | Terrestrial blue-green alga or the marine cyanobacterium | Not specified | Cell viability assay | CEM-VM1 | Leukemia cancer | No inhibition at 4 µM |
| dbacp03712 | Laxaphycin B | A-Hleu-QN-MeIle-Hasn-TPLT-Ade-V-Hleu | Terrestrial blue-green alga or the marine cyanobacterium | Not specified | Cell viability assay | CEM-WT | Leukemia cancer | 50% inhibition at 1 µM |
| dbacp03713 | Laxaphycin B | A-Hleu-QN-MeIle-Hasn-TPLT-Ade-V-Hleu | Terrestrial blue-green alga or the marine cyanobacterium | Not specified | Cell viability assay | CEM-WT | Leukemia cancer | 44% inhibition at 1 µM |
| dbacp03714 | Laxaphycin B | A-Hleu-QN-MeIle-Hasn-TPLT-Ade-V-Hleu | Terrestrial blue-green alga or the marine cyanobacterium | Not specified | Cell viability assay | CEM-VM1 | Leukemia cancer | 44% inhibition at 1 µM |
| dbacp03715 | Laxaphycin B | A-Hleu-QN-MeIle-Hasn-TPLT-Ade-V-Hleu | Terrestrial blue-green alga or the marine cyanobacterium | Not specified | Cell viability assay | CEM-VLB | Leukemia cancer | 44% inhibition at 1 µM |
| dbacp03716 | Laxaphycin B | A-Hleu-QN-MeIle-Hasn-TPLT-Ade-V-Hleu | Terrestrial blue-green alga or the marine cyanobacterium | Not specified | Cell viability assay | CEM-WT | Leukemia cancer | 40% inhibition at 1 µM |
| dbacp03717 | Laxaphycin B | A-Hleu-QN-MeIle-Hasn-TPLT-Ade-V-Hleu | Terrestrial blue-green alga or the marine cyanobacterium | Not specified | Cell viability assay | CEM-VM1 | Leukemia cancer | 40% inhibition at 1 µM |
| dbacp03718 | Laxaphycin B | A-Hleu-QN-MeIle-Hasn-TPLT-Ade-V-Hleu | Terrestrial blue-green alga or the marine cyanobacterium | Not specified | Cell viability assay | CEM-VLB | Leukemia cancer | 40% inhibition at 1 µM |
| dbacp04483 | Magainin 2 | GIGKFLHSAKKFGKAFVGEIMNS | African clawed frog | Membrane perforation | Cell viability assay | RT4(G1) | Bladder cancer | IC50 : 135.3 µM |
| dbacp04484 | Magainin 2 | GIGKFLHSAKKFGKAFVGEIMNS | African clawed frog | Membrane perforation | Cell viability assay | 647V(G2) | Bladder cancer | IC50 : 31 µM |
| dbacp04485 | Magainin 2 | GIGKFLHSAKKFGKAFVGEIMNS | African clawed frog | Membrane perforation | Cell viability assay | 486P(G4) | Bladder cancer | IC50 : 59.4 µM |
| dbacp04497 | Magainin 2 | GIGKFLHSAKKFGKAFVGEIMNS | Yunnan firebelly toad | Membrane perforation | Cell viability assay | 486P(G4) | Bladder cancer | IC50 : 59.4 µM |
| dbacp04578 | Mastoparan-Cimals. XXA; UCLL1c) | LNLKALLAVAKKIL | Venom, the European Hornet | Inducing apoptosis | MTT cell viability assay and Lactate dehydrogenase (LDH) leakage assay | H157 | Lung cancer | MIC : 6.26 - 36.65 μM |
| dbacp04579 | Mastoparan-Cimals. XXA; UCLL1c) | LNLKALLAVAKKIL | Venom, the European Hornet | Inducing apoptosis | MTT cell viability assay and Lactate dehydrogenase (LDH) leakage assay | MDA-MB-435S | Breast cancer | MIC : 6.26 - 36.65 μM |
| dbacp04580 | Mastoparan-Cimals. XXA; UCLL1c) | LNLKALLAVAKKIL | Venom, the European Hornet | Inducing apoptosis | MTT cell viability assay and Lactate dehydrogenase (LDH) leakage assay | PC-3 | Human prostate carcinoma | MIC : 6.26 - 36.65 μM |
| dbacp04581 | Mastoparan-Cimals. XXA; UCLL1c) | LNLKALLAVAKKIL | Venom, the European Hornet | Inducing apoptosis | MTT cell viability assay and Lactate dehydrogenase (LDH) leakage assay | U251-MG | Glioma | MIC : 6.26 - 36.65 μM |
| dbacp04582 | Mastoparan-Cimals. XXA; UCLL1c) | LNLKALLAVAKKIL | Venom, the European Hornet | Inducing apoptosis | MTT cell viability assay and Lactate dehydrogenase (LDH) leakage assay | MCF-7 | Breast cancer | MIC : 6.26 - 36.65 μM |
| dbacp04583 | Mastoparan-Cimals. XXA; UCLL1c) | LNLKALLAVAKKIL | Venom, the European Hornet | Inducing apoptosis | MTT cell viability assay and Lactate dehydrogenase (LDH) leakage assay | HMEC-1 | Glioma | MIC : 6.26 - 36.65 μM |
| dbacp04584 | Mastoparan-Cimals. XXA; UCLL1c) | LNLKALLAVAKKIL | Venom, the European Hornet | Inducing apoptosis | MTT cell viability assay and Lactate dehydrogenase (LDH) leakage assay | H157 | Lung cancer | IC50 : < 4 μM |
| dbacp04585 | Mastoparan-Cimals. XXA; UCLL1c) | LNLKALLAVAKKIL | Venom, the European Hornet | Inducing apoptosis | MTT cell viability assay and Lactate dehydrogenase (LDH) leakage assay | MDA-MB-435S | Breast cancer | IC50 : < 4 μM |
| dbacp04586 | Mastoparan-Cimals. XXA; UCLL1c) | LNLKALLAVAKKIL | Venom, the European Hornet | Inducing apoptosis | MTT cell viability assay and Lactate dehydrogenase (LDH) leakage assay | PC-3 | Human prostate carcinoma | IC50 : < 4 μM |
| dbacp04587 | Mastoparan-Cimals. XXA; UCLL1c) | LNLKALLAVAKKIL | Venom, the European Hornet | Inducing apoptosis | MTT cell viability assay and Lactate dehydrogenase (LDH) leakage assay | U251-MG | Glioma | IC50 : < 4 μM |
| dbacp04588 | Mastoparan-Cimals. XXA; UCLL1c) | LNLKALLAVAKKIL | Venom, the European Hornet | Inducing apoptosis | MTT cell viability assay and Lactate dehydrogenase (LDH) leakage assay | MCF-7 | Breast cancer | IC50 : < 4 μM |
| dbacp04589 | Mastoparan-Cimals. XXA; UCLL1c) | LNLKALLAVAKKIL | Venom, the European Hornet | Inducing apoptosis | MTT cell viability assay and Lactate dehydrogenase (LDH) leakage assay | HMEC-1 | Glioma | IC50 : < 4 μM |
| dbacp04652 | Melittin | GIGAVLKVLTTGLPALISWIKRKRQQ | Main component of honey bee venom | Membrane damage; Apoptotic cell death; Necrosis | Cell viability assay | SCC25 | Skin cancer | 102.9 ± 4.1% cell growth inhibition at 1 µM |
| dbacp04794 | N29D | PDEDAINDALNKVCSTGRRQRSICKQLLKK | Synthetic peptide | Apoptotic inducing | Cell viability assay | SW-480 | Colon cancer | > 100% cell viability at 5 µM |
| dbacp04795 | N29D | PDEDAINDALNKVCSTGRRQRSICKQLLKK | Synthetic peptide | Apoptotic inducing | Cell viability assay | SW-480 | Colon cancer | 60% cell viability at 50 µM |
| dbacp04796 | N29D | PDEDAINDALNKVCSTGRRQRSICKQLLKK | Synthetic peptide | Apoptotic inducing | Cell viability assay | U-937 | Lymphoma cancer | 100% cell viability at 5 µM |
| dbacp04797 | N29D | PDEDAINDALNKVCSTGRRQRSICKQLLKK | Synthetic peptide | Apoptotic inducing | Cell viability assay | U-937 | Lymphoma cancer | < 60% cell viability at 50 µM |
| dbacp04798 | N29D | PDEDAINDALNKVCSTGRRQRSICKQLLKK | Synthetic peptide | Apoptotic inducing | Cell viability assay | SNU-1 | Gastric cancer | < 100% cell viability at 5 µM |
| dbacp04799 | N29D | PDEDAINDALNKVCSTGRRQRSICKQLLKK | Synthetic peptide | Apoptotic inducing | Cell viability assay | SNU-1 | Gastric cancer | < 40% cell viability at 50 µM |
| dbacp04800 | N29D | PDEDAINDALNKVCSTGRRQRSICKQLLKK | Synthetic peptide | Apoptotic inducing | Cell viability assay | SW-480 | Colon cancer | > 100% cell viability at 5 µM |
| dbacp04801 | N29D | PDEDAINDALNKVCSTGRRQRSICKQLLKK | Synthetic peptide | Apoptotic inducing | Cell viability assay | SW-480 | Colon cancer | 60% cell viability at 50 µM |
| dbacp04802 | N29D | PDEDAINDALNKVCSTGRRQRSICKQLLKK | Synthetic peptide | Apoptotic inducing | Cell viability assay | U-937 | Lymphoma cancer | 100% cell viability at 5 µM |
| dbacp04803 | N29D | PDEDAINDALNKVCSTGRRQRSICKQLLKK | Synthetic peptide | Apoptotic inducing | Cell viability assay | U-937 | Lymphoma cancer | < 60% cell viability at 50 µM |
| dbacp04804 | N29D | PDEDAINDALNKVCSTGRRQRSICKQLLKK | Synthetic peptide | Apoptotic inducing | Cell viability assay | SNU-1 | Gastric cancer | 100% cell viability at 5 µM |
| dbacp04805 | N29D | PDEDAINDALNKVCSTGRRQRSICKQLLKK | Synthetic peptide | Apoptotic inducing | Cell viability assay | SNU-1 | Gastric cancer | < 40% cell viability at 50 µM |
| dbacp04806 | N29N | PDEDAINNALNKVCSTGRRQRSICKQLLKK | Synthetic peptide | Apoptotic inducing | Cell viability assay | SW-480 | Colon cancer | 100% cell viability at 5 µM |
| dbacp04807 | N29N | PDEDAINNALNKVCSTGRRQRSICKQLLKK | Synthetic peptide | Apoptotic inducing | Cell viability assay | SW-480 | Colon cancer | 40% cell viability at 50 µM |
| dbacp04808 | N29N | PDEDAINNALNKVCSTGRRQRSICKQLLKK | Synthetic peptide | Apoptotic inducing | Cell viability assay | U-937 | Lymphoma cancer | 100% cell viability at 5 µM |
| dbacp04809 | N29N | PDEDAINNALNKVCSTGRRQRSICKQLLKK | Synthetic peptide | Apoptotic inducing | Cell viability assay | U-937 | Lymphoma cancer | < 40% cell viability at 50 µM |
| dbacp04810 | N29N | PDEDAINNALNKVCSTGRRQRSICKQLLKK | Synthetic peptide | Apoptotic inducing | Cell viability assay | SNU-1 | Gastric cancer | < 100% cell viability at 5 µM |
| dbacp04811 | N29N | PDEDAINNALNKVCSTGRRQRSICKQLLKK | Synthetic peptide | Apoptotic inducing | Cell viability assay | SNU-1 | Gastric cancer | < 20% cell viability at 50 µM |
| dbacp04812 | N29N | PDEDAINNALNKVCSTGRRQRSICKQLLKK | Synthetic peptide | Apoptotic inducing | Cell viability assay | SW-480 | Colon cancer | 100% cell viability at 5 µM |
| dbacp04813 | N29N | PDEDAINNALNKVCSTGRRQRSICKQLLKK | Synthetic peptide | Apoptotic inducing | Cell viability assay | SW-480 | Colon cancer | 40% cell viability at 50 µM |
| dbacp04814 | N29N | PDEDAINNALNKVCSTGRRQRSICKQLLKK | Synthetic peptide | Apoptotic inducing | Cell viability assay | U-937 | Lymphoma cancer | 100% cell viability at 5 µM |
| dbacp04815 | N29N | PDEDAINNALNKVCSTGRRQRSICKQLLKK | Synthetic peptide | Apoptotic inducing | Cell viability assay | U-937 | Lymphoma cancer | < 40% cell viability at 50 µM |
| dbacp04816 | N29N | PDEDAINNALNKVCSTGRRQRSICKQLLKK | Synthetic peptide | Apoptotic inducing | Cell viability assay | SNU-1 | Gastric cancer | < 100% cell viability at 5 µM |
| dbacp04817 | N29N | PDEDAINNALNKVCSTGRRQRSICKQLLKK | Synthetic peptide | Apoptotic inducing | Cell viability assay | SNU-1 | Gastric cancer | < 20% cell viability at 50 µM |
| dbacp04818 | N29N | PDEDAINNALNKVCSTGRRQRSICKQLLKK | Synthetic peptide | Apoptotic inducing | Cell viability assay | SW-480 | Colon cancer | MIC : 5 µM |
| dbacp05103 | PA10 | RQIKIWFQNRRMKWKKGGGGNNETTSIQIAGSLHHHHHH | Synthetic construct | Cell proliferation inhibition; Cell penetration; Apoptosis | Cell viability assay | MDA-MB231 | Breast cancer | MIC : 10 μM |
| dbacp05104 | PA10 | RQIKIWFQNRRMKWKKGGGGNNETTSIQIAGSLHHHHHH | Synthetic construct | Cell proliferation inhibition; Cell penetration; Apoptosis | Cell viability assay | HCC1806 | Breast cancer | MIC : 10 μM |
| dbacp05105 | PA10 | RQIKIWFQNRRMKWKKGGGGNNETTSIQIAGSLHHHHHH | Synthetic construct | Cell proliferation inhibition; Cell penetration; Apoptosis | Cell viability assay | 184B5 | Breast cancer | MIC : 10 μM |
| dbacp05106 | PA10 | RQIKIWFQNRRMKWKKGGGGNNETTSIQIAGSLHHHHHH | Synthetic construct | Cell proliferation inhibition; Cell penetration; Apoptosis | Cell viability assay | MCF10A | Breast cancer | MIC : 10 μM |
| dbacp05107 | PA15 | RQIKIWFQNRRMKWKKGGSLSAACHEQWSLGAQHHHHHH | Synthetic construct | Cell proliferation inhibition; Cell penetration; Apoptosis | Cell viability assay | MDA-MB231 | Breast cancer | MIC : 10 μM |
| dbacp05108 | PA15 | RQIKIWFQNRRMKWKKGGSLSAACHEQWSLGAQHHHHHH | Synthetic construct | Cell proliferation inhibition; Cell penetration; Apoptosis | Cell viability assay | HCC1806 | Breast cancer | MIC : 10 μM |
| dbacp05109 | PA15 | RQIKIWFQNRRMKWKKGGSLSAACHEQWSLGAQHHHHHH | Synthetic construct | Cell proliferation inhibition; Cell penetration; Apoptosis | Cell viability assay | 184B5 | Breast cancer | MIC : 10 μM |
| dbacp05110 | PA15 | RQIKIWFQNRRMKWKKGGSLSAACHEQWSLGAQHHHHHH | Synthetic construct | Cell proliferation inhibition; Cell penetration; Apoptosis | Cell viability assay | MCF10A | Breast cancer | MIC : 10 μM |
| dbacp05111 | PA2 | RQIKIWFQNRRMKWKKGGATRPRVDTQPELCGMHHHHHH | Synthetic construct | Cell proliferation inhibition; Cell penetration; Apoptosis | Cell viability assay | MDA-MB231 | Breast cancer | MIC : 10 μM |
| dbacp05112 | PA2 | RQIKIWFQNRRMKWKKGGATRPRVDTQPELCGMHHHHHH | Synthetic construct | Cell proliferation inhibition; Cell penetration; Apoptosis | Cell viability assay | HCC1806 | Breast cancer | MIC : 10 μM |
| dbacp05113 | PA2 | RQIKIWFQNRRMKWKKGGATRPRVDTQPELCGMHHHHHH | Synthetic construct | Cell proliferation inhibition; Cell penetration; Apoptosis | Cell viability assay | 184B5 | Breast cancer | MIC : 10 μM |
| dbacp05114 | PA2 | RQIKIWFQNRRMKWKKGGATRPRVDTQPELCGMHHHHHH | Synthetic construct | Cell proliferation inhibition; Cell penetration; Apoptosis | Cell viability assay | MCF10A | Breast cancer | MIC : 10 μM |
| dbacp05115 | PA3 | RQIKIWFQNRRMKWKKGGDCLCISRRARLLRATHHHHHH | Synthetic construct | Cell proliferation inhibition; Cell penetration; Apoptosis | Cell viability assay | MDA-MB231 | Breast cancer | MIC : 10 μM |
| dbacp05116 | PA3 | RQIKIWFQNRRMKWKKGGDCLCISRRARLLRATHHHHHH | Synthetic construct | Cell proliferation inhibition; Cell penetration; Apoptosis | Cell viability assay | HCC1806 | Breast cancer | MIC : 10 μM |
| dbacp05117 | PA3 | RQIKIWFQNRRMKWKKGGDCLCISRRARLLRATHHHHHH | Synthetic construct | Cell proliferation inhibition; Cell penetration; Apoptosis | Cell viability assay | 184B5 | Breast cancer | MIC : 10 μM |
| dbacp05118 | PA3 | RQIKIWFQNRRMKWKKGGDCLCISRRARLLRATHHHHHH | Synthetic construct | Cell proliferation inhibition; Cell penetration; Apoptosis | Cell viability assay | MCF10A | Breast cancer | MIC : 10 μM |
| dbacp05119 | PA38 | RQIKIWFQNRRMKWKKGGKYNGRFTTHHLLHLLNHHHHHH | Synthetic construct | Cell proliferation inhibition; Cell penetration; Apoptosis | Cell viability assay | MDA-MB231 | Breast cancer | MIC : 10 μM |
| dbacp05120 | PA38 | RQIKIWFQNRRMKWKKGGKYNGRFTTHHLLHLLNHHHHHH | Synthetic construct | Cell proliferation inhibition; Cell penetration; Apoptosis | Cell viability assay | HCC1806 | Breast cancer | MIC : 10 μM |
| dbacp05121 | PA38 | RQIKIWFQNRRMKWKKGGKYNGRFTTHHLLHLLNHHHHHH | Synthetic construct | Cell proliferation inhibition; Cell penetration; Apoptosis | Cell viability assay | 184B5 | Breast cancer | MIC : 10 μM |
| dbacp05122 | PA38 | RQIKIWFQNRRMKWKKGGKYNGRFTTHHLLHLLNHHHHHH | Synthetic construct | Cell proliferation inhibition; Cell penetration; Apoptosis | Cell viability assay | MCF10A | Breast cancer | MIC : 10 μM |
| dbacp05123 | PA49 | RQIKIWFQNRRMKWKKGGAGVYTFLVGADNRGWEHHHHHH | Synthetic construct | Cell proliferation inhibition; Cell penetration; Apoptosis | Cell viability assay | MDA-MB231 | Breast cancer | MIC : 10 μM |
| dbacp05124 | PA49 | RQIKIWFQNRRMKWKKGGAGVYTFLVGADNRGWEHHHHHH | Synthetic construct | Cell proliferation inhibition; Cell penetration; Apoptosis | Cell viability assay | HCC1806 | Breast cancer | MIC : 10 μM |
| dbacp05125 | PA49 | RQIKIWFQNRRMKWKKGGAGVYTFLVGADNRGWEHHHHHH | Synthetic construct | Cell proliferation inhibition; Cell penetration; Apoptosis | Cell viability assay | 184B5 | Breast cancer | MIC : 10 μM |
| dbacp05126 | PA49 | RQIKIWFQNRRMKWKKGGAGVYTFLVGADNRGWEHHHHHH | Synthetic construct | Cell proliferation inhibition; Cell penetration; Apoptosis | Cell viability assay | MCF10A | Breast cancer | MIC : 10 μM |
| dbacp05371 | peptide containing the BH3 regions from Bad | NLWAAQRYGRELRRMSDEFEGSFKGL | BH3-only, Sensizers (BAD, HRK, Noxa) | Inducing apoptosis | Cell viability assay | FL5.12 | Not specified | Not found |
| dbacp05372 | peptide containing the BH3 regions from Bad(145-160) | QRYGRELRRMSDEFEG | BH3-only, Sensizers (BAD, HRK, Noxa) | Inducing apoptosis | Cell viability assay | FL5.12 | Not specified | Not found |
| dbacp05373 | peptide containing the BH3 regions from Bak(72-87) | GQVGRQLAIIGDDINR | Effectors (BAK, BAX) | Inducing apoptosis | Cell viability assay | FL5.12 | Not specified | Not found |
| dbacp05374 | peptide containing the BH3 regions from Bak(72-94) | GQVGRQLAIIGDDINRRYDSEFQ | Effectors (BAK, BAX) | Inducing apoptosis | Cell viability assay | FL5.12 | Not specified | Not found |
| dbacp05375 | peptide containing the BH3 regions from Bax(57-72) | KKLSECLKRIGDELDS | Effectors (BAK, BAX) | Inducing apoptosis | Cell viability assay | FL5.12 | Not specified | Not found |
| dbacp05508 | Phylloseptin-1.1TR (PLS-1.1TR) | FLSLIPKIAGGIASLVKNL | Trinidad leaf frog | Cytotoxic | Cell viability assay | A549 | Not found | LC50 : 20 μM |
| dbacp05509 | Phylloseptin-1.1TR (PLS-1.1TR) | FLSLIPKIAGGIASLVKNL | Trinidad leaf frog | Cytotoxic | Cell viability assay | MDA‐MB231 | Not found | LC50 : 20 μM |
| dbacp05510 | Phylloseptin-1.1TR (PLS-1.1TR) | FLSLIPKIAGGIASLVKNL | Trinidad leaf frog | Cytotoxic | Cell viability assay | HT‐29 | Not found | LC50 : 34 μM |
| dbacp05511 | Phylloseptin-1.2TR (PLS-1.2TR) (Phylloseptin-1.3TR) | FLSLIPKIAGGIASLVKDL | Trinidad leaf frog | Cytotoxic | Cell viability assay | A549 | Not found | LC50 : 55 μM |
| dbacp05512 | Phylloseptin-1.2TR (PLS-1.2TR) (Phylloseptin-1.3TR) | FLSLIPKIAGGIASLVKDL | Trinidad leaf frog | Cytotoxic | Cell viability assay | MDA‐MB231 | Not found | Not found |
| dbacp05513 | Phylloseptin-1.2TR (PLS-1.2TR) (Phylloseptin-1.3TR) | FLSLIPKIAGGIASLVKDL | Trinidad leaf frog | Cytotoxic | Cell viability assay | HT‐29 | Not found | Not found |
| dbacp05514 | Phylloseptin-2.1TR (PLS-2.1TR) (Phylloseptin-2.2TR) | FLSLIPHIATGIAALAKHL | Trinidad leaf frog | Cytotoxic | Cell viability assay | A549 | Not found | LC50 : 20 μM |
| dbacp05515 | Phylloseptin-2.1TR (PLS-2.1TR) (Phylloseptin-2.2TR) | FLSLIPHIATGIAALAKHL | Trinidad leaf frog | Cytotoxic | Cell viability assay | MDA‐MB231 | Not found | LC50 : 24 μM |
| dbacp05516 | Phylloseptin-2.1TR (PLS-2.1TR) (Phylloseptin-2.2TR) | FLSLIPHIATGIAALAKHL | Trinidad leaf frog | Cytotoxic | Cell viability assay | HT‐29 | Not found | LC50 : 38 μM |
| dbacp05517 | Phylloseptin-3.1TR (PLS-3.1TR) (Phylloseptin-3.3TR) | FFSMIPKIATGIASLVKNL | Trinidad leaf frog | Cytotoxic | Cell viability assay | A549 cells | Not found | LC50 : 18 μmolL−1 |
| dbacp05518 | Phylloseptin-3.1TR (PLS-3.1TR) (Phylloseptin-3.3TR) | FFSMIPKIATGIASLVKNL | Trinidad leaf frog | Cytotoxic | Cell viability assay | MDA‐MB231 | Not found | LC50 : 18 μmolL−1 |
| dbacp05519 | Phylloseptin-3.1TR (PLS-3.1TR) (Phylloseptin-3.3TR) | FFSMIPKIATGIASLVKNL | Trinidad leaf frog | Cytotoxic | Cell viability assay | HT‐29 | Not found | LC50 : 27 μmolL−1 |
| dbacp05520 | Phylloseptin-3.2TR (PLS-3.2TR) | FFSMIPKIATGIASLVKDL | Trinidad leaf frog | Cytotoxic | Cell viability assay | A549 | Not found | LC50 : 65 μM |
| dbacp05521 | Phylloseptin-3.2TR (PLS-3.2TR) | FFSMIPKIATGIASLVKDL | Trinidad leaf frog | Cytotoxic | Cell viability assay | MDA‐MB231 | Not found | Not found |
| dbacp05522 | Phylloseptin-3.2TR (PLS-3.2TR) | FFSMIPKIATGIASLVKDL | Trinidad leaf frog | Cytotoxic | Cell viability assay | HT‐29 | Not found | Not found |
| dbacp05525 | Phylloseptin-PBa1 | FLSLIPHIASGIASLVKNF | Burmeister's leaf frog, Brazil, South America | Disruption of cell membranes | MTT cell viability assay | U145 | Prostate cancer | IC50 : approx. 0.29 µM |
| dbacp05526 | Phylloseptin-PBa1 | FLSLIPHIASGIASLVKNF | Burmeister's leaf frog, Brazil, South America | Disruption of cell membranes | MTT cell viability assay | PC3 | Prostate cancer | IC50 : approx. 0.29 µM |
| dbacp05527 | Phylloseptin-PBa1 | FLSLIPHIASGIASLVKNF | Burmeister's leaf frog, Brazil, South America | Disruption of cell membranes | MTT cell viability assay | LNCaP | Prostate cancer | IC50 : approx. 0.29 µM |
| dbacp05528 | Phylloseptin-PBa1 | FLSLIPHIASGIASLVKNF | Burmeister's leaf frog, Brazil, South America | Disruption of cell membranes | MTT cell viability assay | H838 | Lung cancer | IC50 : approx. 0.29 µM |
| dbacp05529 | Phylloseptin-PBa1 | FLSLIPHIASGIASLVKNF | Burmeister's leaf frog, Brazil, South America | Disruption of cell membranes | MTT cell viability assay | H460 | Lung cancer | IC50 : approx. 0.29 µM |
| dbacp05530 | Phylloseptin-PBa1 | FLSLIPHIASGIASLVKNF | Burmeister's leaf frog, Brazil, South America | Disruption of cell membranes | MTT cell viability assay | H23 | Lung cancer | IC50 : approx. 0.29 µM |
| dbacp05531 | Phylloseptin-PBa1 | FLSLIPHIASGIASLVKNF | Burmeister's leaf frog, Brazil, South America | Disruption of cell membranes | MTT cell viability assay | H157 | Lung cancer | IC50 : approx. 0.29 µM |
| dbacp05532 | Phylloseptin-PBa1 | FLSLIPHIASGIASLVKNF | Burmeister's leaf frog, Brazil, South America | Disruption of cell membranes | MTT cell viability assay | MB231 | Breast cancer | IC50 : approx. 0.29 µM |
| dbacp05533 | Phylloseptin-PBa1 | FLSLIPHIASGIASLVKNF | Burmeister's leaf frog, Brazil, South America | Disruption of cell membranes | MTT cell viability assay | MB435s | Breast cancer | IC50 : approx. 0.29 µM |
| dbacp05534 | Phylloseptin-PBa1 | FLSLIPHIASGIASLVKNF | Burmeister's leaf frog, Brazil, South America | Disruption of cell membranes | MTT cell viability assay | MCF-7 | Breast cancer | IC50 : approx. 0.29 µM |
| dbacp05535 | Phylloseptin-PBa1 | FLSLIPHIASGIASLVKNF | Burmeister's leaf frog, Brazil, South America | Disruption of cell membranes | MTT cell viability assay | U251MG | Neurospongioma | IC50 : approx. 0.29 µM |
| dbacp05536 | Phylloseptin-PBa2 | FLSLLPHIASGIASLVSKF | Burmeister's leaf frog, Brazil, South America | Disruption of cell membranes | MTT cell viability assay | U145 | Prostate cancer | IC50 : approx. 0.50 µM |
| dbacp05537 | Phylloseptin-PBa2 | FLSLLPHIASGIASLVSKF | Burmeister's leaf frog, Brazil, South America | Disruption of cell membranes | MTT cell viability assay | PC3 | Prostate cancer | IC50 : approx. 0.50 µM |
| dbacp05538 | Phylloseptin-PBa2 | FLSLLPHIASGIASLVSKF | Burmeister's leaf frog, Brazil, South America | Disruption of cell membranes | MTT cell viability assay | LNCaP | Prostate cancer | IC50 : approx. 0.50 µM |
| dbacp05539 | Phylloseptin-PBa2 | FLSLLPHIASGIASLVSKF | Burmeister's leaf frog, Brazil, South America | Disruption of cell membranes | MTT cell viability assay | H838 | Lung cancer | IC50 : approx. 0.50 µM |
| dbacp05540 | Phylloseptin-PBa2 | FLSLLPHIASGIASLVSKF | Burmeister's leaf frog, Brazil, South America | Disruption of cell membranes | MTT cell viability assay | H460 | Lung cancer | IC50 : approx. 0.50 µM |
| dbacp05541 | Phylloseptin-PBa2 | FLSLLPHIASGIASLVSKF | Burmeister's leaf frog, Brazil, South America | Disruption of cell membranes | MTT cell viability assay | H23 | Lung cancer | IC50 : approx. 0.50 µM |
| dbacp05542 | Phylloseptin-PBa2 | FLSLLPHIASGIASLVSKF | Burmeister's leaf frog, Brazil, South America | Disruption of cell membranes | MTT cell viability assay | H157 | Lung cancer | IC50 : approx. 0.50 µM |
| dbacp05543 | Phylloseptin-PBa2 | FLSLLPHIASGIASLVSKF | Burmeister's leaf frog, Brazil, South America | Disruption of cell membranes | MTT cell viability assay | MB231 | Breast cancer | IC50 : approx. 0.50 µM |
| dbacp05544 | Phylloseptin-PBa2 | FLSLLPHIASGIASLVSKF | Burmeister's leaf frog, Brazil, South America | Disruption of cell membranes | MTT cell viability assay | MB435s | Breast cancer | IC50 : approx. 0.50 µM |
| dbacp05545 | Phylloseptin-PBa2 | FLSLLPHIASGIASLVSKF | Burmeister's leaf frog, Brazil, South America | Disruption of cell membranes | MTT cell viability assay | MCF-7 | Breast cancer | IC50 : approx. 0.50 µM |
| dbacp05546 | Phylloseptin-PBa2 | FLSLLPHIASGIASLVSKF | Burmeister's leaf frog, Brazil, South America | Disruption of cell membranes | MTT cell viability assay | U251MG | neurospongioma | IC50 : approx. 0.50 µM |
| dbacp05547 | Phylloseptin-PHa | FLSLIPAAISAVSALANHF | Skin secretions, Orange-legged Leaf Frog, South America | Membrane disruption | MTT cell viability assay | NCI-H157 | Lung cancer | IC50 : 14.10 μM |
| dbacp05554 | Phylloseptin-PTa | FLSLIPKIAGGIAALAKHL | Skin secretions, the Brown-bellied Leaf Frog, South America | Membrane disruption | MTT Cell viability assay | NCI-H157 | Lung cancer | IC50 : 6.73 μM |
| dbacp05596 | Polyphemusin II | RRWCFRVCYKGFCYRKCR-NH2 | Atlantic horseshoe crab | Induce necrotic cell death | Cell viability assay | K562 | Human erythroleukemia | EC50 : 22 μM |
| dbacp05676 | Ps-1Pb | IKIPSFFRNILKKVGKEAVSLIAGALKQS | Merlin's dwarf gray frog | Immunomodulatory properties | Cytotoxicity assays, CellTiter-Glo Luminescent cell viability assay | A549 | Lung adenocarcinoma | LC50 : < 12 μM |
| dbacp05677 | Ps-1Pb | IKIPSFFRNILKKVGKEAVSLIAGALKQS | Merlin's dwarf gray frog | Immunomodulatory properties | Cytotoxicity assays, CellTiter-Glo Luminescent cell viability assay | MDA-MB-231 | Breast adenocarcinoma | LC50 : < 12 μM |
| dbacp05678 | Ps-1Pb | IKIPSFFRNILKKVGKEAVSLIAGALKQS | Merlin's dwarf gray frog | Immunomodulatory properties | Cytotoxicity assays, CellTiter-Glo Luminescent cell viability assay | HT-29 | Colorectal adenocarcinoma | LC50 : < 12 μM |
| dbacp05679 | Ps-2Pa | GIFPIFAKLLGKVIKVASSLISKGRTE | Merlin's dwarf gray frog | Immunomodulatory properties | Cytotoxicity assays, CellTiter-Glo Luminescent cell viability assay | A549 | Lung adenocarcinoma | LC50 : < 12 μM |
| dbacp05680 | Ps-2Pa | GIFPIFAKLLGKVIKVASSLISKGRTE | Merlin's dwarf gray frog | Immunomodulatory properties | Cytotoxicity assays, CellTiter-Glo Luminescent cell viability assay | MDA-MB-231 | Breast adenocarcinoma | LC50 : < 12 μM |
| dbacp05681 | Ps-2Pa | GIFPIFAKLLGKVIKVASSLISKGRTE | Merlin's dwarf gray frog | Immunomodulatory properties | Cytotoxicity assays, CellTiter-Glo Luminescent cell viability assay | HT-29 | Colorectal adenocarcinoma | LC50 : < 12 μM |
| dbacp05696 | Psychrophilin D (1) | lw | Blue or green mold | Not specified | Cell viability assay | P-388 | Leukemia cancer | ID50 : 10.1 µg/ml |
| dbacp05901 | Ranatuerin-2PLx | GIMDTVKNAAKNLAGQLLDKLKCKITAC | Gram-negative purple non-sulfur bacteria | Inducing apoptosis | MTT Cell viability assay and Lactate dehydrogenase (LDH) leakage assay | H157 | Lung | IC50 : 5.90 µM |
| dbacp05902 | Ranatuerin-2PLx | GIMDTVKNAAKNLAGQLLDKLKCKITAC | Gram-negative purple non-sulfur bacteria | Inducing apoptosis | MTT Cell viability assay and Lactate dehydrogenase (LDH) leakage assay | MBD-MB-435s | Melanocyte | IC50 : 15.44 µM |
| dbacp05903 | Ranatuerin-2PLx | GIMDTVKNAAKNLAGQLLDKLKCKITAC | Gram-negative purple non-sulfur bacteria | Inducing apoptosis | MTT Cell viability assay and Lactate dehydrogenase (LDH) leakage assay | PC-3 | Human prostate carcinoma | IC50 : 5.79 µM |
| dbacp05904 | Ranatuerin-2PLx | GIMDTVKNAAKNLAGQLLDKLKCKITAC | Gram-negative purple non-sulfur bacteria | Inducing apoptosis | MTT Cell viability assay and Lactate dehydrogenase (LDH) leakage assay | U251-MG | Human glioblastoma astrocytoma | IC50 : 16.14 µm |
| dbacp05905 | Ranatuerin-2PLx | GIMDTVKNAAKNLAGQLLDKLKCKITAC | Gram-negative purple non-sulfur bacteria | Inducing apoptosis | MTT Cell viability assay and Lactate dehydrogenase (LDH) leakage assay | MCF-7 | Human breast cancer | IC50 : 20.19 µM |
| dbacp05906 | Ranatuerin-2PLx | GIMDTVKNAAKNLAGQLLDKLKCSITAC | Skin secretions, the pickerel frog, North America | Inducing apoptosis | MTT Cell viability assay and Lactate dehydrogenase (LDH) leakage assay | H157 | Lung cancer | IC50 : 5.90 µM |
| dbacp05907 | Ranatuerin-2PLx | GIMDTVKNAAKNLAGQLLDKLKCSITAC | Skin secretions, the pickerel frog, North America | Inducing apoptosis | MTT Cell viability assay and Lactate dehydrogenase (LDH) leakage assay | MDA-MB-435S | Breast cancer | IC50 : 15.44 µM |
| dbacp05908 | Ranatuerin-2PLx | GIMDTVKNAAKNLAGQLLDKLKCSITAC | Skin secretions, the pickerel frog, North America | Inducing apoptosis | MTT Cell viability assay and Lactate dehydrogenase (LDH) leakage assay | PC-3 | Human prostate carcinoma | IC50 : 5.79 µM |
| dbacp05909 | Ranatuerin-2PLx | GIMDTVKNAAKNLAGQLLDKLKCSITAC | Skin secretions, the pickerel frog, North America | Inducing apoptosis | MTT Cell viability assay and Lactate dehydrogenase (LDH) leakage assay | U251-MG | Glioma | IC50 : 16.14 µM |
| dbacp05910 | Ranatuerin-2PLx | GIMDTVKNAAKNLAGQLLDKLKCSITAC | Skin secretions, the pickerel frog, North America | Inducing apoptosis | MTT Cell viability assay and Lactate dehydrogenase (LDH) leakage assay | MCF-7 | Breast cancer | IC50 : 20.19 µM |
| dbacp05911 | Ranatuerin-2PLx | GIMDTVKNAAKNLAGQLLDKLKCSITAC | Skin secretions, the pickerel frog, North America | Inducing apoptosis | MTT Cell viability assay and Lactate dehydrogenase (LDH) leakage assay | HMEC-1 | Glioma | IC50 : 79.50 µM |
| dbacp06023 | Sansalv amide A | NA | Synthetic Peptide | Apoptosis | Cell viability assay | S2-13 | Pancreatic cancer | EC50 : 7.5 µM |
| dbacp06326 | Transactivator of transcript-DV1-Bcl-2, AT-DV1-BH3 | RRRQRRKKRGGGGLGASWHRPDK | Transactivator of transcript-DV1-Bcl-2 TAT-DV1-BH3 | Apoptosis inducing | Cell viability assay, Transwell invasion assay | MDA-MB-231 | Breast cancer | Not specified |
| dbacp06327 | Transactivator of transcript-DV1-Bcl-2, AT-DV1-BH3 | RRRQRRKKRGGGGLGASWHRPDK | Transactivator of transcript-DV1-Bcl-2 TAT-DV1-BH4 | Apoptosis inducing | Cell viability assay, Transwell invasion assay | MCF-7 | Breast cancer | Not specified |
| dbacp06328 | Transactivator of transcript-DV1-Bcl-2, AT-DV1-BH3 | RRRQRRKKRGGGGLGASWHRPDK | Transactivator of transcript-DV1-Bcl-2 TAT-DV1-BH5 | Apoptosis inducing | Cell viability assay, Transwell invasion assay | HEK-293 | Kidney cancer | Not specified |
| dbacp06388 | Turgencin B | GIKEML_CnMACAQTVC_KKSGGPLCDTCQAACKALG-NH2 | Tunicate | Disruption of cell membranes | Human cell viability assay | A2058 | Melanoma cancer | IC50 : 4.1μM |
| dbacp06389 | Turgencin A | GPKTKAACKMACKLATCGKKPGGWKCKLCELGCDAV | Tunicate | Disruption of cell membranes | Human cell viability assay | A2058 | Melanoma cancer | IC50 : 1.4 μM |
| dbacp06390 | Turgencin A | GPKTKAACKMACKLATCGKKPGGWKCKLCELGCDAV-NH2 | Tunicate | Disruption of cell membranes | Human cell viability assay | A2058 | Melanoma cancer | IC50 : 1.4 μM |
| dbacp06391 | Turgencin A | GPKTKAACKMACKLATCGKKPGGWKCKLCELGCDAV | Tunicate | Disruption of cell membranes | Human cell viability assay | A2058 | Melanoma cancer | IC50 : 1.4 μM |
| dbacp06392 | Turgencin B | GIKEMLCnMACAQTVCKKSGGPLCDTCQAACKALG | Tunicate | Disruption of cell membranes | Human cell viability assay | A2059 | Melanoma cancer | IC50 : 4.1 μM |
| dbacp06393 | Turgencin B | GIKEMLCnMACAQTVCKKSGGPLCDTCQAACKALG | Tunicate | Disruption of cell membranes | Human cell viability assay | A2059 | Melanoma cancer | IC50 : 4.1 μM |
| dbacp06651 | LUNA18 | Not Available | Synthetic | Not available | CellTiter-Glo Cell Viability assay | NCI-H2122 | NSCLC | IC50 = 1.4 ± 0.3 nmol/L |
| dbacp06652 | LUNA18 | Not Available | Synthetic | Not available | CellTiter-Glo Cell Viability assay | MiaPaCa.2 | Pancreatic Cancer | IC50 = 1.4 ± 0.2 nmol/L |
| dbacp06653 | LUNA18 | Not Available | Synthetic | Not available | CellTiter-Glo Cell Viability assay | NCI-H441 | NSCLC | IC50 = 2.9 ± 0.7 nmol/L |
| dbacp06654 | LUNA18 | Not Available | Synthetic | Not available | CellTiter-Glo Cell Viability assay | LS 180 | Colon Cancer | IC50 = 2.7 ± 0.4 nmol/L |
| dbacp06655 | LUNA18 | Not Available | Synthetic | Not available | CellTiter-Glo Cell Viability assay | GSU | Stomach Cancer | IC50 = 0.17 ± 0.02 nmol/L |
| dbacp06763 | M1-21 | rrrqrrkkrg-QTQPRLGPPQTPAGGCSILIF | Synthetic | FOXM1 inhibitor | Cell Viability assay | MDA-MB-231 | Breast Cancer | IC50 = 24.25 µM |
| dbacp06764 | M1-21 | rrrqrrkkrg-QTQPRLGPPQTPAGGCSILIF | Synthetic | FOXM1 inhibitor | Cell Viability assay | 5637 | Bladder cancer | IC50 = 9.33 µM |
| dbacp06765 | M1-21 | rrrqrrkkrg-QTQPRLGPPQTPAGGCSILIF | Synthetic | FOXM1 inhibitor | Cell Viability assay | HeLa | Cervical Cancer | IC50 = 31.83 µM |
| dbacp06766 | M1-21 | rrrqrrkkrg-QTQPRLGPPQTPAGGCSILIF | Synthetic | FOXM1 inhibitor | Cell Viability assay | 786-0 | Renal Cancer | IC50 = 13.5 µM |
| dbacp06767 | M1-21 | rrrqrrkkrg-QTQPRLGPPQTPAGGCSILIF | Synthetic | FOXM1 inhibitor | Cell Viability assay | HCT-116 | Colon Cancer | IC50 = 9.08 µM |
| dbacp06768 | M1-21 | rrrqrrkkrg-QTQPRLGPPQTPAGGCSILIF | Synthetic | FOXM1 inhibitor | Cell Viability assay | A-549 | Lung Cancer | IC50 = 22.00 µM |
| dbacp06769 | M1-21 | rrrqrrkkrg-QTQPRLGPPQTPAGGCSILIF | Synthetic | FOXM1 inhibitor | Cell Viability assay | U-251 | BrainTumor | IC50 = 18.17 µM |
| dbacp06770 | M1-21 | rrrqrrkkrg-QTQPRLGPPQTPAGGCSILIF | Synthetic | FOXM1 inhibitor | Cell Viability assay | ZR-75-30 | Breast Cancer | IC50 = 12.92 µM |
| dbacp06852 | WP1 | RLLRLMRLRMLLRM | Derived from RLL peptide | Apoptosis inducing | Cell Viability assay | Huh-7 | Liver Cancer | IC50 = 43.74 ± 5.4 μM |
| dbacp06853 | WP1 | RLLRLMRLRMLLRM | Derived from RLL peptide | Apoptosis inducing | Cell Viability assay | HepG-2 | Liver Cancer | IC50 = 52.23 ± 0.9 μM |
| dbacp06854 | WP1 | RLLRLMRLRMLLRM | Derived from RLL peptide | Apoptosis inducing | Cell Viability assay | HT-29 | Colon Cancer | IC50 = 54.6 ± 2.1 μM |
| dbacp06856 | WP2 | RLLRLLRLRRLLRL | Derived from RLL peptide | Apoptosis inducing | Cell Viability assay | Huh-7 | Liver Cancer | IC50 = 28.12 ± 1.5 μM |
| dbacp06857 | WP2 | RLLRLLRLRRLLRL | Derived from RLL peptide | Apoptosis inducing | Cell Viability assay | HepG-2 | Liver Cancer | IC50 = 34.05 ± 0.53 μM |
| dbacp06858 | WP2 | RLLRLLRLRRLLRL | Derived from RLL peptide | Apoptosis inducing | Cell Viability assay | HT-29 | Colon Cancer | IC50 = 42.6 ± 4.0 μM |
| dbacp06979 | GV1001 | EARPALLTSRLRFIPK | Human telomerase reverse transcriptase (hTERT) | Inhibition of angiogenesis | Cell Viability assay | A-549 | Lung Cancer | Graph Fig 2A |
| dbacp07986 | SmacN7-Arg8 fused peptide P4 | Ahx-AVPIAQK(KRRRRRRRRRE) | Synthetic | Apoptosis inducing | Cell Titer Blue Cell Viability assay | U-266 | Skin Cancer | Cell viability < 50% at 50 μM |
| dbacp07987 | SmacN7-Arg8 fused peptide P5 | Ahx-(KAVPIAQKE)RRRRRRRR | Synthetic | Apoptosis inducing | Cell Titer Blue Cell Viability assay | U-266 | Skin Cancer | Cell viability < 50% at 50 μM |
| dbacp07988 | SmacN7-Arg8 fused peptide P7 | Ahx-(KAVPIAQKE)GG(KRRRRRRRRE) | Synthetic | Apoptosis inducing | Cell Titer Blue Cell Viability assay | U-266 | Skin Cancer | Cell viability < 50% at 50 μM |