dbACP: A Comprehensive Database of Anti-Cancer Peptides

680 result(s) have been found!

Accession Name Sequence Source/Organism Mechanism Assay Type Cell Line Cancer Type Activity
dbacp00322 [C/U, G1K, L5Y, K8R]cGm KURRYUYRQRUVTYURGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay CRL-1739 Epithelial cancer CC50 : 46.2 ± 7.6 μM
dbacp00323 [C/U, G1K, L5Y, K8R]cGm KURRYUYRQRUVTYURGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay CRL-1739 Chronic myeloid Leukemia CC50 : 46.2 ± 7.6 μM
dbacp00324 [C/U, G1K, L5Y, K8R]cGm KURRYUYRQRUVTYURGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay CRL-1739 Gastric cancer CC50 : 46.2 ± 7.6 μM
dbacp00325 [C/U, G1K, L5Y, K8R]cGm KURRYUYRQRUVTYURGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay CRL-1739 Breast cancer CC50 : 46.2 ± 7.6 μM
dbacp00326 [C/U, G1K, L5Y, K8R]cGm KURRYUYRQRUVTYURGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay CRL-1739 Cervical cancer CC50 : 46.2 ± 7.6 μM
dbacp00327 [C/U, G1K, L5Y, K8R]cGm KURRYUYRQRUVTYURGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay MM96L Epithelial cancer CC50 : 2.3 ± 0.2 μM
dbacp00328 [C/U, G1K, L5Y, K8R]cGm KURRYUYRQRUVTYURGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay MM96L Chronic myeloid Leukemia CC50 : 2.3 ± 0.2 μM
dbacp00329 [C/U, G1K, L5Y, K8R]cGm KURRYUYRQRUVTYURGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay MM96L Gastric cancer CC50 : 2.3 ± 0.2 μM
dbacp00330 [C/U, G1K, L5Y, K8R]cGm KURRYUYRQRUVTYURGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay MM96L Breast cancer CC50 : 2.3 ± 0.2 μM
dbacp00331 [C/U, G1K, L5Y, K8R]cGm KURRYUYRQRUVTYURGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay MM96L Cervical cancer CC50 : 2.3 ± 0.2 μM
dbacp00332 [C/U, G1K, L5Y, K8R]cGm KURRYUYRQRUVTYURGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay HFF-1 Epithelial cancer CC50 : 30.8 ± 2.0 μM
dbacp00333 [C/U, G1K, L5Y, K8R]cGm KURRYUYRQRUVTYURGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay HFF-1 Chronic myeloid Leukemia CC50 : 30.8 ± 2.0 μM
dbacp00334 [C/U, G1K, L5Y, K8R]cGm KURRYUYRQRUVTYURGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay HFF-1 Gastric cancer CC50 : 30.8 ± 2.0 μM
dbacp00335 [C/U, G1K, L5Y, K8R]cGm KURRYUYRQRUVTYURGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay HFF-1 Breast cancer CC50 : 30.8 ± 2.0 μM
dbacp00336 [C/U, G1K, L5Y, K8R]cGm KURRYUYRQRUVTYURGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay HFF-1 Cervical cancer CC50 : 30.8 ± 2.0 μM
dbacp00337 [C/U, G1K, L5Y, K8R]cGm KURRYUYRQRUVTYURGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay HeLa Epithelial cancer CC50 : 36.2 ± 2.8 μM
dbacp00338 [C/U, G1K, L5Y, K8R]cGm KURRYUYRQRUVTYURGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay HeLa Chronic myeloid Leukemia CC50 : 36.2 ± 2.8 μM
dbacp00339 [C/U, G1K, L5Y, K8R]cGm KURRYUYRQRUVTYURGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay HeLa Gastric cancer CC50 : 36.2 ± 2.8 μM
dbacp00340 [C/U, G1K, L5Y, K8R]cGm KURRYUYRQRUVTYURGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay HeLa Breast cancer CC50 : 36.2 ± 2.8 μM
dbacp00341 [C/U, G1K, L5Y, K8R]cGm KURRYUYRQRUVTYURGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay HeLa Cervical cancer CC50 : 36.2 ± 2.8 μM
dbacp00342 [C/U, G1K, L5Y, K8R]cGm KURRYUYRQRUVTYURGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay MCF-7 Epithelial cancer CC50 : 29.0 ± 3.7 μM
dbacp00343 [C/U, G1K, L5Y, K8R]cGm KURRYUYRQRUVTYURGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay MCF-7 Chronic myeloid Leukemia CC50 : 29.0 ± 3.7 μM
dbacp00344 [C/U, G1K, L5Y, K8R]cGm KURRYUYRQRUVTYURGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay MCF-7 Gastric cancer CC50 : 29.0 ± 3.7 μM
dbacp00345 [C/U, G1K, L5Y, K8R]cGm KURRYUYRQRUVTYURGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay MCF-7 Breast cancer CC50 : 29.0 ± 3.7 μM
dbacp00346 [C/U, G1K, L5Y, K8R]cGm KURRYUYRQRUVTYURGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay MCF-7 Cervical cancer CC50 : 29.0 ± 3.7 μM
dbacp00347 [C/U, G1K, L5Y, K8R]cGm KURRYUYRQRUVTYURGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay K-562 Epithelial cancer CC50 : 6.4 ± 0.6 μM
dbacp00348 [C/U, G1K, L5Y, K8R]cGm KURRYUYRQRUVTYURGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay K-562 Chronic myeloid Leukemia CC50 : 6.4 ± 0.6 μM
dbacp00349 [C/U, G1K, L5Y, K8R]cGm KURRYUYRQRUVTYURGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay K-562 Gastric cancer CC50 : 6.4 ± 0.6 μM
dbacp00350 [C/U, G1K, L5Y, K8R]cGm KURRYUYRQRUVTYURGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay K-562 Breast cancer CC50 : 6.4 ± 0.6 μM
dbacp00351 [C/U, G1K, L5Y, K8R]cGm KURRYUYRQRUVTYURGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay K-562 Cervical cancer CC50 : 6.4 ± 0.6 μM
dbacp00352 [C/U, G1K, L5Y, K8R]cGm KURRYUYRQRUVTYURGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay HL-60 Epithelial cancer CC50 : 33.3 ±7.4 μM
dbacp00353 [C/U, G1K, L5Y, K8R]cGm KURRYUYRQRUVTYURGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay HL-60 Chronic myeloid Leukemia CC50 : 33.3 ±7.4 μM
dbacp00354 [C/U, G1K, L5Y, K8R]cGm KURRYUYRQRUVTYURGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay HL-60 Gastric cancer CC50 : 33.3 ±7.4 μM
dbacp00355 [C/U, G1K, L5Y, K8R]cGm KURRYUYRQRUVTYURGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay HL-60 Breast cancer CC50 : 33.3 ±7.4 μM
dbacp00356 [C/U, G1K, L5Y, K8R]cGm KURRYUYRQRUVTYURGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay HL-60 Cervical cancer CC50 : 33.3 ±7.4 μM
dbacp00357 [C/U, G1K, L5Y, K8R]cGm KURRYUYRQRUVTYURGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay PBMCs Epithelial cancer CC50 : 9.5 ± 0.5 μM
dbacp00358 [C/U, G1K, L5Y, K8R]cGm KURRYUYRQRUVTYURGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay PBMCs Chronic myeloid Leukemia CC50 : 9.5 ± 0.5 μM
dbacp00359 [C/U, G1K, L5Y, K8R]cGm KURRYUYRQRUVTYURGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay PBMCs Gastric cancer CC50 : 9.5 ± 0.5 μM
dbacp00360 [C/U, G1K, L5Y, K8R]cGm KURRYUYRQRUVTYURGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay PBMCs Breast cancer CC50 : 9.5 ± 0.5 μM
dbacp00361 [C/U, G1K, L5Y, K8R]cGm KURRYUYRQRUVTYURGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay PBMCs Cervical cancer CC50 : 9.5 ± 0.5 μM
dbacp00362 [C/U]cGm GURRLUYKQRUVTYURGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay CRL-1739 Epithelial cancer CC50 : 51.0 ± 4.6 μM
dbacp00363 [C/U]cGm GURRLUYKQRUVTYURGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay CRL-1739 Chronic myeloid Leukemia CC50 : 51.0 ± 4.6 μM
dbacp00364 [C/U]cGm GURRLUYKQRUVTYURGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay CRL-1739 Gastric cancer CC50 : 51.0 ± 4.6 μM
dbacp00365 [C/U]cGm GURRLUYKQRUVTYURGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay CRL-1739 Breast cancer CC50 : 51.0 ± 4.6 μM
dbacp00366 [C/U]cGm GURRLUYKQRUVTYURGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay CRL-1739 Cervical cancer CC50 : 51.0 ± 4.6 μM
dbacp00367 [C/U]cGm GURRLUYKQRUVTYURGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay MM96L Epithelial cancer CC50 : 4.6 ± 0.2 μM
dbacp00368 [C/U]cGm GURRLUYKQRUVTYURGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay MM96L Chronic myeloid Leukemia CC50 : 4.6 ± 0.2 μM
dbacp00369 [C/U]cGm GURRLUYKQRUVTYURGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay MM96L Gastric cancer CC50 : 4.6 ± 0.2 μM
dbacp00370 [C/U]cGm GURRLUYKQRUVTYURGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay MM96L Breast cancer CC50 : 4.6 ± 0.2 μM
dbacp00371 [C/U]cGm GURRLUYKQRUVTYURGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay MM96L Cervical cancer CC50 : 4.6 ± 0.2 μM
dbacp00372 [C/U]cGm GURRLUYKQRUVTYURGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay HFF-1 Epithelial cancer CC50 : 15.6 ± 3.6 μM
dbacp00373 [C/U]cGm GURRLUYKQRUVTYURGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay HFF-1 Chronic myeloid Leukemia CC50 : 15.6 ± 3.6 μM
dbacp00374 [C/U]cGm GURRLUYKQRUVTYURGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay HFF-1 Gastric cancer CC50 : 15.6 ± 3.6 μM
dbacp00375 [C/U]cGm GURRLUYKQRUVTYURGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay HFF-1 Breast cancer CC50 : 15.6 ± 3.6 μM
dbacp00376 [C/U]cGm GURRLUYKQRUVTYURGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay HFF-1 Cervical cancer CC50 : 15.6 ± 3.6 μM
dbacp00377 [C/U]cGm GURRLUYKQRUVTYURGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay HeLa Epithelial cancer CC50 : > 64 μM
dbacp00378 [C/U]cGm GURRLUYKQRUVTYURGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay HeLa Chronic myeloid Leukemia CC50 : > 64 μM
dbacp00379 [C/U]cGm GURRLUYKQRUVTYURGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay HeLa Gastric cancer CC50 : > 64 μM
dbacp00380 [C/U]cGm GURRLUYKQRUVTYURGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay HeLa Breast cancer CC50 : > 64 μM
dbacp00381 [C/U]cGm GURRLUYKQRUVTYURGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay HeLa Cervical cancer CC50 : > 64 μM
dbacp00382 [C/U]cGm GURRLUYKQRUVTYURGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay MCF-7 Epithelial cancer CC50 : 37.5 ± 3.3 μM
dbacp00383 [C/U]cGm GURRLUYKQRUVTYURGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay MCF-7 Chronic myeloid Leukemia CC50 : 37.5 ± 3.3 μM
dbacp00384 [C/U]cGm GURRLUYKQRUVTYURGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay MCF-7 Gastric cancer CC50 : 37.5 ± 3.3 μM
dbacp00385 [C/U]cGm GURRLUYKQRUVTYURGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay MCF-7 Breast cancer CC50 : 37.5 ± 3.3 μM
dbacp00386 [C/U]cGm GURRLUYKQRUVTYURGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay MCF-7 Cervical cancer CC50 : 37.5 ± 3.3 μM
dbacp00387 [C/U]cGm GURRLUYKQRUVTYURGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay K-562 Epithelial cancer CC50 : 1.4 ± 0.2 μM
dbacp00388 [C/U]cGm GURRLUYKQRUVTYURGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay K-562 Chronic myeloid Leukemia CC50 : 1.4 ± 0.2 μM
dbacp00389 [C/U]cGm GURRLUYKQRUVTYURGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay K-562 Gastric cancer CC50 : 1.4 ± 0.2 μM
dbacp00390 [C/U]cGm GURRLUYKQRUVTYURGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay K-562 Breast cancer CC50 : 1.4 ± 0.2 μM
dbacp00391 [C/U]cGm GURRLUYKQRUVTYURGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay K-562 Cervical cancer CC50 : 1.4 ± 0.2 μM
dbacp00392 [C/U]cGm GURRLUYKQRUVTYURGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay HL-60 Epithelial cancer CC50 : 38.5 ± 4.8 μM
dbacp00393 [C/U]cGm GURRLUYKQRUVTYURGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay HL-60 Chronic myeloid Leukemia CC50 : 38.5 ± 4.8 μM
dbacp00394 [C/U]cGm GURRLUYKQRUVTYURGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay HL-60 Gastric cancer CC50 : 38.5 ± 4.8 μM
dbacp00395 [C/U]cGm GURRLUYKQRUVTYURGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay HL-60 Breast cancer CC50 : 38.5 ± 4.8 μM
dbacp00396 [C/U]cGm GURRLUYKQRUVTYURGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay HL-60 Cervical cancer CC50 : 38.5 ± 4.8 μM
dbacp00397 [C/U]cGm GURRLUYKQRUVTYURGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay PBMCs Epithelial cancer CC50 : 15.5 ± 0.8 μM
dbacp00398 [C/U]cGm GURRLUYKQRUVTYURGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay PBMCs Chronic myeloid Leukemia CC50 : 15.5 ± 0.8 μM
dbacp00399 [C/U]cGm GURRLUYKQRUVTYURGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay PBMCs Gastric cancer CC50 : 15.5 ± 0.8 μM
dbacp00400 [C/U]cGm GURRLUYKQRUVTYURGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay PBMCs Breast cancer CC50 : 15.5 ± 0.8 μM
dbacp00401 [C/U]cGm GURRLUYKQRUVTYURGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay PBMCs Cervical cancer CC50 : 15.5 ± 0.8 μM
dbacp00403 [D-P L-P]cGm GCRRLCYKQRCVTYCRGpPR Synthetic construct Target and destroy tumor cell membranes Cell viability assay CRL-1739 Epithelial cancer CC50 : 22.5 ± 3.3 μM
dbacp00404 [D-P L-P]cGm GCRRLCYKQRCVTYCRGpPR Synthetic construct Target and destroy tumor cell membranes Cell viability assay CRL-1739 Chronic myeloid Leukemia CC50 : 22.5 ± 3.3 μM
dbacp00405 [D-P L-P]cGm GCRRLCYKQRCVTYCRGpPR Synthetic construct Target and destroy tumor cell membranes Cell viability assay CRL-1739 Gastric cancer CC50 : 22.5 ± 3.3 μM
dbacp00406 [D-P L-P]cGm GCRRLCYKQRCVTYCRGpPR Synthetic construct Target and destroy tumor cell membranes Cell viability assay CRL-1739 Breast cancer CC50 : 22.5 ± 3.3 μM
dbacp00407 [D-P L-P]cGm GCRRLCYKQRCVTYCRGpPR Synthetic construct Target and destroy tumor cell membranes Cell viability assay CRL-1739 Cervical cancer CC50 : 22.5 ± 3.3 μM
dbacp00408 [D-P L-P]cGm GCRRLCYKQRCVTYCRGpPR Synthetic construct Target and destroy tumor cell membranes Cell viability assay MM96L Epithelial cancer CC50 : 3.0 ± 0.1 μM
dbacp00409 [D-P L-P]cGm GCRRLCYKQRCVTYCRGpPR Synthetic construct Target and destroy tumor cell membranes Cell viability assay MM96L Chronic myeloid Leukemia CC50 : 3.0 ± 0.1 μM
dbacp00410 [D-P L-P]cGm GCRRLCYKQRCVTYCRGpPR Synthetic construct Target and destroy tumor cell membranes Cell viability assay MM96L Gastric cancer CC50 : 3.0 ± 0.1 μM
dbacp00411 [D-P L-P]cGm GCRRLCYKQRCVTYCRGpPR Synthetic construct Target and destroy tumor cell membranes Cell viability assay MM96L Breast cancer CC50 : 3.0 ± 0.1 μM
dbacp00412 [D-P L-P]cGm GCRRLCYKQRCVTYCRGpPR Synthetic construct Target and destroy tumor cell membranes Cell viability assay MM96L Cervical cancer CC50 : 3.0 ± 0.1 μM
dbacp00413 [D-P L-P]cGm GCRRLCYKQRCVTYCRGpPR Synthetic construct Target and destroy tumor cell membranes Cell viability assay HFF-1 Epithelial cancer CC50 : 14.9 ± 0.8 μM
dbacp00414 [D-P L-P]cGm GCRRLCYKQRCVTYCRGpPR Synthetic construct Target and destroy tumor cell membranes Cell viability assay HFF-1 Chronic myeloid Leukemia CC50 : 14.9 ± 0.8 μM
dbacp00415 [D-P L-P]cGm GCRRLCYKQRCVTYCRGpPR Synthetic construct Target and destroy tumor cell membranes Cell viability assay HFF-1 Gastric cancer CC50 : 14.9 ± 0.8 μM
dbacp00416 [D-P L-P]cGm GCRRLCYKQRCVTYCRGpPR Synthetic construct Target and destroy tumor cell membranes Cell viability assay HFF-1 Breast cancer CC50 : 14.9 ± 0.8 μM
dbacp00417 [D-P L-P]cGm GCRRLCYKQRCVTYCRGpPR Synthetic construct Target and destroy tumor cell membranes Cell viability assay HFF-1 Cervical cancer CC50 : 14.9 ± 0.8 μM
dbacp00418 [D-P L-P]cGm GCRRLCYKQRCVTYCRGpPR Synthetic construct Target and destroy tumor cell membranes Cell viability assay HeLa Epithelial cancer CC50 : 51.5 ± 3.9 μM
dbacp00419 [D-P L-P]cGm GCRRLCYKQRCVTYCRGpPR Synthetic construct Target and destroy tumor cell membranes Cell viability assay HeLa Chronic myeloid Leukemia CC50 : 51.5 ± 3.9 μM
dbacp00420 [D-P L-P]cGm GCRRLCYKQRCVTYCRGpPR Synthetic construct Target and destroy tumor cell membranes Cell viability assay HeLa Gastric cancer CC50 : 51.5 ± 3.9 μM
dbacp00421 [D-P L-P]cGm GCRRLCYKQRCVTYCRGpPR Synthetic construct Target and destroy tumor cell membranes Cell viability assay HeLa Breast cancer CC50 : 51.5 ± 3.9 μM
dbacp00422 [D-P L-P]cGm GCRRLCYKQRCVTYCRGpPR Synthetic construct Target and destroy tumor cell membranes Cell viability assay HeLa Cervical cancer CC50 : 51.5 ± 3.9 μM
dbacp00423 [D-P L-P]cGm GCRRLCYKQRCVTYCRGpPR Synthetic construct Target and destroy tumor cell membranes Cell viability assay K-562 Epithelial cancer CC50 : 3.9 ± 0.2 μM
dbacp00424 [D-P L-P]cGm GCRRLCYKQRCVTYCRGpPR Synthetic construct Target and destroy tumor cell membranes Cell viability assay K-562 Chronic myeloid Leukemia CC50 : 3.9 ± 0.2 μM
dbacp00425 [D-P L-P]cGm GCRRLCYKQRCVTYCRGpPR Synthetic construct Target and destroy tumor cell membranes Cell viability assay K-562 Gastric cancer CC50 : 3.9 ± 0.2 μM
dbacp00426 [D-P L-P]cGm GCRRLCYKQRCVTYCRGpPR Synthetic construct Target and destroy tumor cell membranes Cell viability assay K-562 Breast cancer CC50 : 3.9 ± 0.2 μM
dbacp00427 [D-P L-P]cGm GCRRLCYKQRCVTYCRGpPR Synthetic construct Target and destroy tumor cell membranes Cell viability assay K-562 Cervical cancer CC50 : 3.9 ± 0.2 μM
dbacp00428 [D-P L-P]cGm GCRRLCYKQRCVTYCRGpPR Synthetic construct Target and destroy tumor cell membranes Cell viability assay PBMCs Epithelial cancer CC50 : 14.1 ± 0.9 μM
dbacp00429 [D-P L-P]cGm GCRRLCYKQRCVTYCRGpPR Synthetic construct Target and destroy tumor cell membranes Cell viability assay PBMCs Chronic myeloid Leukemia CC50 : 14.1 ± 0.9 μM
dbacp00430 [D-P L-P]cGm GCRRLCYKQRCVTYCRGpPR Synthetic construct Target and destroy tumor cell membranes Cell viability assay PBMCs Gastric cancer CC50 : 14.1 ± 0.9 μM
dbacp00431 [D-P L-P]cGm GCRRLCYKQRCVTYCRGpPR Synthetic construct Target and destroy tumor cell membranes Cell viability assay PBMCs Breast cancer CC50 : 14.1 ± 0.9 μM
dbacp00432 [D-P L-P]cGm GCRRLCYKQRCVTYCRGpPR Synthetic construct Target and destroy tumor cell membranes Cell viability assay PBMCs Cervical cancer CC50 : 14.1 ± 0.9 μM
dbacp00440 [G1K, K8R]cGm KCRRLCYRQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay CRL-1739 Epithelial cancer CC50 : 19.5 ± 0.5 μM
dbacp00441 [G1K, K8R]cGm KCRRLCYRQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay CRL-1739 Chronic myeloid Leukemia CC50 : 19.5 ± 0.5 μM
dbacp00442 [G1K, K8R]cGm KCRRLCYRQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay CRL-1739 Gastric cancer CC50 : 19.5 ± 0.5 μM
dbacp00443 [G1K, K8R]cGm KCRRLCYRQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay CRL-1739 Breast cancer CC50 : 19.5 ± 0.5 μM
dbacp00444 [G1K, K8R]cGm KCRRLCYRQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay CRL-1739 Cervical cancer CC50 : 19.5 ± 0.5 μM
dbacp00445 [G1K, K8R]cGm KCRRLCYRQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay MM96L Epithelial cancer CC50 : 1.7 ± 0.1 μM
dbacp00446 [G1K, K8R]cGm KCRRLCYRQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay MM96L Chronic myeloid Leukemia CC50 : 1.7 ± 0.1 μM
dbacp00447 [G1K, K8R]cGm KCRRLCYRQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay MM96L Gastric cancer CC50 : 1.7 ± 0.1 μM
dbacp00448 [G1K, K8R]cGm KCRRLCYRQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay MM96L Breast cancer CC50 : 1.7 ± 0.1 μM
dbacp00449 [G1K, K8R]cGm KCRRLCYRQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay MM96L Cervical cancer CC50 : 1.7 ± 0.1 μM
dbacp00450 [G1K, K8R]cGm KCRRLCYRQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay HFF-1 Epithelial cancer CC50 : 9.0 ± 0.5 μM
dbacp00451 [G1K, K8R]cGm KCRRLCYRQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay HFF-1 Chronic myeloid Leukemia CC50 : 9.0 ± 0.5 μM
dbacp00452 [G1K, K8R]cGm KCRRLCYRQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay HFF-1 Gastric cancer CC50 : 9.0 ± 0.5 μM
dbacp00453 [G1K, K8R]cGm KCRRLCYRQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay HFF-1 Breast cancer CC50 : 9.0 ± 0.5 μM
dbacp00454 [G1K, K8R]cGm KCRRLCYRQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay HFF-1 Cervical cancer CC50 : 9.0 ± 0.5 μM
dbacp00455 [G1K, K8R]cGm KCRRLCYRQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay HeLa Epithelial cancer CC50 : 44.2 ± 2.2 μM
dbacp00456 [G1K, K8R]cGm KCRRLCYRQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay HeLa Chronic myeloid Leukemia CC50 : 44.2 ± 2.2 μM
dbacp00457 [G1K, K8R]cGm KCRRLCYRQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay HeLa Gastric cancer CC50 : 44.2 ± 2.2 μM
dbacp00458 [G1K, K8R]cGm KCRRLCYRQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay HeLa Breast cancer CC50 : 44.2 ± 2.2 μM
dbacp00459 [G1K, K8R]cGm KCRRLCYRQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay HeLa Cervical cancer CC50 : 44.2 ± 2.2 μM
dbacp00460 [G1K, K8R]cGm KCRRLCYRQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay MCF-7 Epithelial cancer CC50 : 6.7 ± 0.7 μM
dbacp00461 [G1K, K8R]cGm KCRRLCYRQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay MCF-7 Chronic myeloid Leukemia CC50 : 6.7 ± 0.7 μM
dbacp00462 [G1K, K8R]cGm KCRRLCYRQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay MCF-7 Gastric cancer CC50 : 6.7 ± 0.7 μM
dbacp00463 [G1K, K8R]cGm KCRRLCYRQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay MCF-7 Breast cancer CC50 : 6.7 ± 0.7 μM
dbacp00464 [G1K, K8R]cGm KCRRLCYRQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay MCF-7 Cervical cancer CC50 : 6.7 ± 0.7 μM
dbacp00465 [G1K, K8R]cGm KCRRLCYRQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay K-562 Epithelial cancer CC50 : 2.1 ± 0.2 μM
dbacp00466 [G1K, K8R]cGm KCRRLCYRQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay K-562 Chronic myeloid Leukemia CC50 : 2.1 ± 0.2 μM
dbacp00467 [G1K, K8R]cGm KCRRLCYRQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay K-562 Gastric cancer CC50 : 2.1 ± 0.2 μM
dbacp00468 [G1K, K8R]cGm KCRRLCYRQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay K-562 Breast cancer CC50 : 2.1 ± 0.2 μM
dbacp00469 [G1K, K8R]cGm KCRRLCYRQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay K-562 Cervical cancer CC50 : 2.1 ± 0.2 μM
dbacp00470 [G1K, K8R]cGm KCRRLCYRQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay HL-60 Epithelial cancer CC50 : 9.0 ± 1.1μM
dbacp00471 [G1K, K8R]cGm KCRRLCYRQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay HL-60 Chronic myeloid Leukemia CC50 : 9.0 ± 1.1μM
dbacp00472 [G1K, K8R]cGm KCRRLCYRQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay HL-60 Gastric cancer CC50 : 9.0 ± 1.1μM
dbacp00473 [G1K, K8R]cGm KCRRLCYRQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay HL-60 Breast cancer CC50 : 9.0 ± 1.1μM
dbacp00474 [G1K, K8R]cGm KCRRLCYRQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay HL-60 Cervical cancer CC50 : 9.0 ± 1.1μM
dbacp00475 [G1K, K8R]cGm KCRRLCYRQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay PBMCs Epithelial cancer CC50 : 5.1 ± 0.3 μM
dbacp00476 [G1K, K8R]cGm KCRRLCYRQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay PBMCs Chronic myeloid Leukemia CC50 : 5.1 ± 0.3 μM
dbacp00477 [G1K, K8R]cGm KCRRLCYRQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay PBMCs Gastric cancer CC50 : 5.1 ± 0.3 μM
dbacp00478 [G1K, K8R]cGm KCRRLCYRQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay PBMCs Breast cancer CC50 : 5.1 ± 0.3 μM
dbacp00479 [G1K, K8R]cGm KCRRLCYRQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay PBMCs Cervical cancer CC50 : 5.1 ± 0.3 μM
dbacp00480 [G1K, L5Y, K8R]cGm KCRRYCYRQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay CRL-1739 Epithelial cancer CC50 : 26.5 ± 2.4 μM
dbacp00481 [G1K, L5Y, K8R]cGm KCRRYCYRQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay CRL-1739 Chronic myeloid Leukemia CC50 : 26.5 ± 2.4 μM
dbacp00482 [G1K, L5Y, K8R]cGm KCRRYCYRQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay CRL-1739 Gastric cancer CC50 : 26.5 ± 2.4 μM
dbacp00483 [G1K, L5Y, K8R]cGm KCRRYCYRQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay CRL-1739 Breast cancer CC50 : 26.5 ± 2.4 μM
dbacp00484 [G1K, L5Y, K8R]cGm KCRRYCYRQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay CRL-1739 Cervical cancer CC50 : 26.5 ± 2.4 μM
dbacp00485 [G1K, L5Y, K8R]cGm KCRRYCYRQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay MM96L Epithelial cancer CC50 : 2.0 ± 0.1 μM
dbacp00486 [G1K, L5Y, K8R]cGm KCRRYCYRQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay MM96L Chronic myeloid Leukemia CC50 : 2.0 ± 0.1 μM
dbacp00487 [G1K, L5Y, K8R]cGm KCRRYCYRQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay MM96L Gastric cancer CC50 : 2.0 ± 0.1 μM
dbacp00488 [G1K, L5Y, K8R]cGm KCRRYCYRQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay MM96L Breast cancer CC50 : 2.0 ± 0.1 μM
dbacp00489 [G1K, L5Y, K8R]cGm KCRRYCYRQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay MM96L Cervical cancer CC50 : 2.0 ± 0.1 μM
dbacp00490 [G1K, L5Y, K8R]cGm KCRRYCYRQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay HFF-1 Epithelial cancer CC50 : 14.7 ± 1.5 μM
dbacp00491 [G1K, L5Y, K8R]cGm KCRRYCYRQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay HFF-1 Chronic myeloid Leukemia CC50 : 14.7 ± 1.5 μM
dbacp00492 [G1K, L5Y, K8R]cGm KCRRYCYRQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay HFF-1 Gastric cancer CC50 : 14.7 ± 1.5 μM
dbacp00493 [G1K, L5Y, K8R]cGm KCRRYCYRQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay HFF-1 Breast cancer CC50 : 14.7 ± 1.5 μM
dbacp00494 [G1K, L5Y, K8R]cGm KCRRYCYRQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay HFF-1 Cervical cancer CC50 : 14.7 ± 1.5 μM
dbacp00495 [G1K, L5Y, K8R]cGm KCRRYCYRQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay HeLa Epithelial cancer CC50 : 20.9 ± 1.4 μM
dbacp00496 [G1K, L5Y, K8R]cGm KCRRYCYRQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay HeLa Chronic myeloid Leukemia CC50 : 20.9 ± 1.4 μM
dbacp00497 [G1K, L5Y, K8R]cGm KCRRYCYRQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay HeLa Gastric cancer CC50 : 20.9 ± 1.4 μM
dbacp00498 [G1K, L5Y, K8R]cGm KCRRYCYRQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay HeLa Breast cancer CC50 : 20.9 ± 1.4 μM
dbacp00499 [G1K, L5Y, K8R]cGm KCRRYCYRQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay HeLa Cervical cancer CC50 : 20.9 ± 1.4 μM
dbacp00500 [G1K, L5Y, K8R]cGm KCRRYCYRQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay MCF-7 Epithelial cancer CC50 : 15.2 ± 1.9 μM
dbacp00501 [G1K, L5Y, K8R]cGm KCRRYCYRQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay MCF-7 Chronic myeloid Leukemia CC50 : 15.2 ± 1.9 μM
dbacp00502 [G1K, L5Y, K8R]cGm KCRRYCYRQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay MCF-7 Gastric cancer CC50 : 15.2 ± 1.9 μM
dbacp00503 [G1K, L5Y, K8R]cGm KCRRYCYRQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay MCF-7 Breast cancer CC50 : 15.2 ± 1.9 μM
dbacp00504 [G1K, L5Y, K8R]cGm KCRRYCYRQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay MCF-7 Cervical cancer CC50 : 15.2 ± 1.9 μM
dbacp00505 [G1K, L5Y, K8R]cGm KCRRYCYRQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay K-562 Epithelial cancer CC50 : 1.3 ± 0.1 μM
dbacp00506 [G1K, L5Y, K8R]cGm KCRRYCYRQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay K-562 Chronic myeloid Leukemia CC50 : 1.3 ± 0.1 μM
dbacp00507 [G1K, L5Y, K8R]cGm KCRRYCYRQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay K-562 Gastric cancer CC50 : 1.3 ± 0.1 μM
dbacp00508 [G1K, L5Y, K8R]cGm KCRRYCYRQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay K-562 Breast cancer CC50 : 1.3 ± 0.1 μM
dbacp00509 [G1K, L5Y, K8R]cGm KCRRYCYRQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay K-562 Cervical cancer CC50 : 1.3 ± 0.1 μM
dbacp00510 [G1K, L5Y, K8R]cGm KCRRYCYRQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay HL-60 Epithelial cancer CC50 : 15.7 ±1.1μM
dbacp00511 [G1K, L5Y, K8R]cGm KCRRYCYRQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay HL-60 Chronic myeloid Leukemia CC50 : 15.7 ±1.1μM
dbacp00512 [G1K, L5Y, K8R]cGm KCRRYCYRQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay HL-60 Gastric cancer CC50 : 15.7 ±1.1μM
dbacp00513 [G1K, L5Y, K8R]cGm KCRRYCYRQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay HL-60 Breast cancer CC50 : 15.7 ±1.1μM
dbacp00514 [G1K, L5Y, K8R]cGm KCRRYCYRQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay HL-60 Cervical cancer CC50 : 15.7 ±1.1μM
dbacp00515 [G1K, L5Y, K8R]cGm KCRRYCYRQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay PBMCs Epithelial cancer CC50 : 10.4 ± 1.0 μM
dbacp00516 [G1K, L5Y, K8R]cGm KCRRYCYRQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay PBMCs Chronic myeloid Leukemia CC50 : 10.4 ± 1.0 μM
dbacp00517 [G1K, L5Y, K8R]cGm KCRRYCYRQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay PBMCs Gastric cancer CC50 : 10.4 ± 1.0 μM
dbacp00518 [G1K, L5Y, K8R]cGm KCRRYCYRQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay PBMCs Breast cancer CC50 : 10.4 ± 1.0 μM
dbacp00519 [G1K, L5Y, K8R]cGm KCRRYCYRQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay PBMCs Cervical cancer CC50 : 10.4 ± 1.0 μM
dbacp00520 [K8R]cGm GCRRLCYRQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay CRL-1739 Epithelial cancer CC50 : 29.4 ± 1.1 μM
dbacp00521 [K8R]cGm GCRRLCYRQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay CRL-1739 Chronic myeloid Leukemia CC50 : 29.4 ± 1.1 μM
dbacp00522 [K8R]cGm GCRRLCYRQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay CRL-1739 Gastric cancer CC50 : 29.4 ± 1.1 μM
dbacp00523 [K8R]cGm GCRRLCYRQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay CRL-1739 Breast cancer CC50 : 29.4 ± 1.1 μM
dbacp00524 [K8R]cGm GCRRLCYRQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay CRL-1739 Cervical cancer CC50 : 29.4 ± 1.1 μM
dbacp00525 [K8R]cGm GCRRLCYRQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay MM96L Epithelial cancer CC50 : 5.0 ± 0.3 μM
dbacp00526 [K8R]cGm GCRRLCYRQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay MM96L Chronic myeloid Leukemia CC50 : 5.0 ± 0.3 μM
dbacp00527 [K8R]cGm GCRRLCYRQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay MM96L Gastric cancer CC50 : 5.0 ± 0.3 μM
dbacp00528 [K8R]cGm GCRRLCYRQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay MM96L Breast cancer CC50 : 5.0 ± 0.3 μM
dbacp00529 [K8R]cGm GCRRLCYRQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay MM96L Cervical cancer CC50 : 5.0 ± 0.3 μM
dbacp00530 [K8R]cGm GCRRLCYRQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay HFF-1 Epithelial cancer CC50 : 34.5 ± 3.6 μM
dbacp00531 [K8R]cGm GCRRLCYRQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay HFF-1 Chronic myeloid Leukemia CC50 : 34.5 ± 3.6 μM
dbacp00532 [K8R]cGm GCRRLCYRQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay HFF-1 Gastric cancer CC50 : 34.5 ± 3.6 μM
dbacp00533 [K8R]cGm GCRRLCYRQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay HFF-1 Breast cancer CC50 : 34.5 ± 3.6 μM
dbacp00534 [K8R]cGm GCRRLCYRQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay HFF-1 Cervical cancer CC50 : 34.5 ± 3.6 μM
dbacp00535 [K8R]cGm GCRRLCYRQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay HeLa Epithelial cancer CC50 : 39.4 ± 2.6 μM
dbacp00536 [K8R]cGm GCRRLCYRQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay HeLa Chronic myeloid Leukemia CC50 : 39.4 ± 2.6 μM
dbacp00537 [K8R]cGm GCRRLCYRQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay HeLa Gastric cancer CC50 : 39.4 ± 2.6 μM
dbacp00538 [K8R]cGm GCRRLCYRQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay HeLa Breast cancer CC50 : 39.4 ± 2.6 μM
dbacp00539 [K8R]cGm GCRRLCYRQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay HeLa Cervical cancer CC50 : 39.4 ± 2.6 μM
dbacp00540 [K8R]cGm GCRRLCYRQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay K-562 Epithelial cancer CC50 : 3.1 ± 0.1 μM
dbacp00541 [K8R]cGm GCRRLCYRQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay K-562 Chronic myeloid Leukemia CC50 : 3.1 ± 0.1 μM
dbacp00542 [K8R]cGm GCRRLCYRQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay K-562 Gastric cancer CC50 : 3.1 ± 0.1 μM
dbacp00543 [K8R]cGm GCRRLCYRQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay K-562 Breast cancer CC50 : 3.1 ± 0.1 μM
dbacp00544 [K8R]cGm GCRRLCYRQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay K-562 Cervical cancer CC50 : 3.1 ± 0.1 μM
dbacp00545 [L5W]cGm GCRRWCYKQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay CRL-1739 Epithelial cancer CC50 : 18.3 ± 1.4 μM
dbacp00546 [L5W]cGm GCRRWCYKQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay CRL-1739 Chronic myeloid Leukemia CC50 : 18.3 ± 1.4 μM
dbacp00547 [L5W]cGm GCRRWCYKQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay CRL-1739 Gastric cancer CC50 : 18.3 ± 1.4 μM
dbacp00548 [L5W]cGm GCRRWCYKQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay CRL-1739 Breast cancer CC50 : 18.3 ± 1.4 μM
dbacp00549 [L5W]cGm GCRRWCYKQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay CRL-1739 Cervical cancer CC50 : 18.3 ± 1.4 μM
dbacp00550 [L5W]cGm GCRRWCYKQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay MM96L Epithelial cancer CC50 : 4.0 ± 0.1 μM
dbacp00551 [L5W]cGm GCRRWCYKQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay MM96L Chronic myeloid Leukemia CC50 : 4.0 ± 0.1 μM
dbacp00552 [L5W]cGm GCRRWCYKQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay MM96L Gastric cancer CC50 : 4.0 ± 0.1 μM
dbacp00553 [L5W]cGm GCRRWCYKQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay MM96L Breast cancer CC50 : 4.0 ± 0.1 μM
dbacp00554 [L5W]cGm GCRRWCYKQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay MM96L Cervical cancer CC50 : 4.0 ± 0.1 μM
dbacp00555 [L5W]cGm GCRRWCYKQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay HFF-1 Epithelial cancer CC50 : 25.0 ± 2.9 μM
dbacp00556 [L5W]cGm GCRRWCYKQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay HFF-1 Chronic myeloid Leukemia CC50 : 25.0 ± 2.9 μM
dbacp00557 [L5W]cGm GCRRWCYKQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay HFF-1 Gastric cancer CC50 : 25.0 ± 2.9 μM
dbacp00558 [L5W]cGm GCRRWCYKQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay HFF-1 Breast cancer CC50 : 25.0 ± 2.9 μM
dbacp00559 [L5W]cGm GCRRWCYKQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay HFF-1 Cervical cancer CC50 : 25.0 ± 2.9 μM
dbacp00560 [L5W]cGm GCRRWCYKQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay HeLa Epithelial cancer CC50 : 17.1 ± 0.7 μM
dbacp00561 [L5W]cGm GCRRWCYKQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay HeLa Chronic myeloid Leukemia CC50 : 17.1 ± 0.7 μM
dbacp00562 [L5W]cGm GCRRWCYKQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay HeLa Gastric cancer CC50 : 17.1 ± 0.7 μM
dbacp00563 [L5W]cGm GCRRWCYKQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay HeLa Breast cancer CC50 : 17.1 ± 0.7 μM
dbacp00564 [L5W]cGm GCRRWCYKQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay HeLa Cervical cancer CC50 : 17.1 ± 0.7 μM
dbacp00565 [L5W]cGm GCRRWCYKQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay K-562 Epithelial cancer CC50 : 1.0 ± 0.1 μM
dbacp00566 [L5W]cGm GCRRWCYKQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay K-562 Chronic myeloid Leukemia CC50 : 1.0 ± 0.1 μM
dbacp00567 [L5W]cGm GCRRWCYKQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay K-562 Gastric cancer CC50 : 1.0 ± 0.1 μM
dbacp00568 [L5W]cGm GCRRWCYKQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay K-562 Breast cancer CC50 : 1.0 ± 0.1 μM
dbacp00569 [L5W]cGm GCRRWCYKQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay K-562 Cervical cancer CC50 : 1.0 ± 0.1 μM
dbacp00573 [R4A, R18A]cGm GCRALCYKQRCVTYCRGA Synthetic construct Target and destroy tumor cell membranes Cell viability assay CRL-1739 Epithelial cancer CC50 : > 64 μM
dbacp00574 [R4A, R18A]cGm GCRALCYKQRCVTYCRGA Synthetic construct Target and destroy tumor cell membranes Cell viability assay CRL-1739 Chronic myeloid Leukemia CC50 : > 64 μM
dbacp00575 [R4A, R18A]cGm GCRALCYKQRCVTYCRGA Synthetic construct Target and destroy tumor cell membranes Cell viability assay CRL-1739 Gastric cancer CC50 : > 64 μM
dbacp00576 [R4A, R18A]cGm GCRALCYKQRCVTYCRGA Synthetic construct Target and destroy tumor cell membranes Cell viability assay CRL-1739 Breast cancer CC50 : > 64 μM
dbacp00577 [R4A, R18A]cGm GCRALCYKQRCVTYCRGA Synthetic construct Target and destroy tumor cell membranes Cell viability assay CRL-1739 Cervical cancer CC50 : > 64 μM
dbacp00578 [R4A, R18A]cGm GCRALCYKQRCVTYCRGA Synthetic construct Target and destroy tumor cell membranes Cell viability assay MM96L Epithelial cancer CC50 : 10.3 ± 1.1 μM
dbacp00579 [R4A, R18A]cGm GCRALCYKQRCVTYCRGA Synthetic construct Target and destroy tumor cell membranes Cell viability assay MM96L Chronic myeloid Leukemia CC50 : 10.3 ± 1.1 μM
dbacp00580 [R4A, R18A]cGm GCRALCYKQRCVTYCRGA Synthetic construct Target and destroy tumor cell membranes Cell viability assay MM96L Gastric cancer CC50 : 10.3 ± 1.1 μM
dbacp00581 [R4A, R18A]cGm GCRALCYKQRCVTYCRGA Synthetic construct Target and destroy tumor cell membranes Cell viability assay MM96L Breast cancer CC50 : 10.3 ± 1.1 μM
dbacp00582 [R4A, R18A]cGm GCRALCYKQRCVTYCRGA Synthetic construct Target and destroy tumor cell membranes Cell viability assay MM96L Cervical cancer CC50 : 10.3 ± 1.1 μM
dbacp00583 [R4A, R18A]cGm GCRALCYKQRCVTYCRGA Synthetic construct Target and destroy tumor cell membranes Cell viability assay HFF-1 Epithelial cancer CC50 : 51.2 ± 4.0 μM
dbacp00584 [R4A, R18A]cGm GCRALCYKQRCVTYCRGA Synthetic construct Target and destroy tumor cell membranes Cell viability assay HFF-1 Chronic myeloid Leukemia CC50 : 51.2 ± 4.0 μM
dbacp00585 [R4A, R18A]cGm GCRALCYKQRCVTYCRGA Synthetic construct Target and destroy tumor cell membranes Cell viability assay HFF-1 Gastric cancer CC50 : 51.2 ± 4.0 μM
dbacp00586 [R4A, R18A]cGm GCRALCYKQRCVTYCRGA Synthetic construct Target and destroy tumor cell membranes Cell viability assay HFF-1 Breast cancer CC50 : 51.2 ± 4.0 μM
dbacp00587 [R4A, R18A]cGm GCRALCYKQRCVTYCRGA Synthetic construct Target and destroy tumor cell membranes Cell viability assay HFF-1 Cervical cancer CC50 : 51.2 ± 4.0 μM
dbacp00588 [R4A, R18A]cGm GCRALCYKQRCVTYCRGA Synthetic construct Target and destroy tumor cell membranes Cell viability assay HeLa Epithelial cancer CC50 : > 64 μM
dbacp00589 [R4A, R18A]cGm GCRALCYKQRCVTYCRGA Synthetic construct Target and destroy tumor cell membranes Cell viability assay HeLa Chronic myeloid Leukemia CC50 : > 64 μM
dbacp00590 [R4A, R18A]cGm GCRALCYKQRCVTYCRGA Synthetic construct Target and destroy tumor cell membranes Cell viability assay HeLa Gastric cancer CC50 : > 64 μM
dbacp00591 [R4A, R18A]cGm GCRALCYKQRCVTYCRGA Synthetic construct Target and destroy tumor cell membranes Cell viability assay HeLa Breast cancer CC50 : > 64 μM
dbacp00592 [R4A, R18A]cGm GCRALCYKQRCVTYCRGA Synthetic construct Target and destroy tumor cell membranes Cell viability assay HeLa Cervical cancer CC50 : > 64 μM
dbacp00593 [R4A, R18A]cGm GCRALCYKQRCVTYCRGA Synthetic construct Target and destroy tumor cell membranes Cell viability assay MCF-7 Epithelial cancer CC50 : 48.4 ± 0.7 μM
dbacp00594 [R4A, R18A]cGm GCRALCYKQRCVTYCRGA Synthetic construct Target and destroy tumor cell membranes Cell viability assay MCF-7 Chronic myeloid Leukemia CC50 : 48.4 ± 0.7 μM
dbacp00595 [R4A, R18A]cGm GCRALCYKQRCVTYCRGA Synthetic construct Target and destroy tumor cell membranes Cell viability assay MCF-7 Gastric cancer CC50 : 48.4 ± 0.7 μM
dbacp00596 [R4A, R18A]cGm GCRALCYKQRCVTYCRGA Synthetic construct Target and destroy tumor cell membranes Cell viability assay MCF-7 Breast cancer CC50 : 48.4 ± 0.7 μM
dbacp00597 [R4A, R18A]cGm GCRALCYKQRCVTYCRGA Synthetic construct Target and destroy tumor cell membranes Cell viability assay MCF-7 Cervical cancer CC50 : 48.4 ± 0.7 μM
dbacp00598 [R4A, R18A]cGm GCRALCYKQRCVTYCRGA Synthetic construct Target and destroy tumor cell membranes Cell viability assay K-562 Epithelial cancer CC50 : 11.5 ± 0.6 μM
dbacp00599 [R4A, R18A]cGm GCRALCYKQRCVTYCRGA Synthetic construct Target and destroy tumor cell membranes Cell viability assay K-562 Chronic myeloid Leukemia CC50 : 11.5 ± 0.6 μM
dbacp00600 [R4A, R18A]cGm GCRALCYKQRCVTYCRGA Synthetic construct Target and destroy tumor cell membranes Cell viability assay K-562 Gastric cancer CC50 : 11.5 ± 0.6 μM
dbacp00601 [R4A, R18A]cGm GCRALCYKQRCVTYCRGA Synthetic construct Target and destroy tumor cell membranes Cell viability assay K-562 Breast cancer CC50 : 11.5 ± 0.6 μM
dbacp00602 [R4A, R18A]cGm GCRALCYKQRCVTYCRGA Synthetic construct Target and destroy tumor cell membranes Cell viability assay K-562 Cervical cancer CC50 : 11.5 ± 0.6 μM
dbacp00603 [R4A, R18A]cGm GCRALCYKQRCVTYCRGA Synthetic construct Target and destroy tumor cell membranes Cell viability assay HL-60 Epithelial cancer CC50 : 34.1 ± 3.9 μM
dbacp00604 [R4A, R18A]cGm GCRALCYKQRCVTYCRGA Synthetic construct Target and destroy tumor cell membranes Cell viability assay HL-60 Chronic myeloid Leukemia CC50 : 34.1 ± 3.9 μM
dbacp00605 [R4A, R18A]cGm GCRALCYKQRCVTYCRGA Synthetic construct Target and destroy tumor cell membranes Cell viability assay HL-60 Gastric cancer CC50 : 34.1 ± 3.9 μM
dbacp00606 [R4A, R18A]cGm GCRALCYKQRCVTYCRGA Synthetic construct Target and destroy tumor cell membranes Cell viability assay HL-60 Breast cancer CC50 : 34.1 ± 3.9 μM
dbacp00607 [R4A, R18A]cGm GCRALCYKQRCVTYCRGA Synthetic construct Target and destroy tumor cell membranes Cell viability assay HL-60 Cervical cancer CC50 : 34.1 ± 3.9 μM
dbacp00608 [R4A, R18A]cGm GCRALCYKQRCVTYCRGA Synthetic construct Target and destroy tumor cell membranes Cell viability assay PBMCs Epithelial cancer CC50 : 30.8 ± 2.5 μM
dbacp00609 [R4A, R18A]cGm GCRALCYKQRCVTYCRGA Synthetic construct Target and destroy tumor cell membranes Cell viability assay PBMCs Chronic myeloid Leukemia CC50 : 30.8 ± 2.5 μM
dbacp00610 [R4A, R18A]cGm GCRALCYKQRCVTYCRGA Synthetic construct Target and destroy tumor cell membranes Cell viability assay PBMCs Gastric cancer CC50 : 30.8 ± 2.5 μM
dbacp00611 [R4A, R18A]cGm GCRALCYKQRCVTYCRGA Synthetic construct Target and destroy tumor cell membranes Cell viability assay PBMCs Breast cancer CC50 : 30.8 ± 2.5 μM
dbacp00612 [R4A, R18A]cGm GCRALCYKQRCVTYCRGA Synthetic construct Target and destroy tumor cell membranes Cell viability assay PBMCs Cervical cancer CC50 : 30.8 ± 2.5 μM
dbacp00621 [Y14W]cGm GCRRLCYKQRCVTWCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay CRL-1739 Epithelial cancer CC50 : 30.3 ± 1.1 μM
dbacp00622 [Y14W]cGm GCRRLCYKQRCVTWCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay CRL-1739 Chronic myeloid Leukemia CC50 : 30.3 ± 1.1 μM
dbacp00623 [Y14W]cGm GCRRLCYKQRCVTWCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay CRL-1739 Gastric cancer CC50 : 30.3 ± 1.1 μM
dbacp00624 [Y14W]cGm GCRRLCYKQRCVTWCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay CRL-1739 Breast cancer CC50 : 30.3 ± 1.1 μM
dbacp00625 [Y14W]cGm GCRRLCYKQRCVTWCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay CRL-1739 Cervical cancer CC50 : 30.3 ± 1.1 μM
dbacp00626 [Y14W]cGm GCRRLCYKQRCVTWCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay MM96L Epithelial cancer CC50 : 4.0 ± 0.1 μM
dbacp00627 [Y14W]cGm GCRRLCYKQRCVTWCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay MM96L Chronic myeloid Leukemia CC50 : 4.0 ± 0.1 μM
dbacp00628 [Y14W]cGm GCRRLCYKQRCVTWCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay MM96L Gastric cancer CC50 : 4.0 ± 0.1 μM
dbacp00629 [Y14W]cGm GCRRLCYKQRCVTWCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay MM96L Breast cancer CC50 : 4.0 ± 0.1 μM
dbacp00630 [Y14W]cGm GCRRLCYKQRCVTWCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay MM96L Cervical cancer CC50 : 4.0 ± 0.1 μM
dbacp00631 [Y14W]cGm GCRRLCYKQRCVTWCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay HFF-1 Epithelial cancer CC50 : 68.4 ± 9.6 μM
dbacp00632 [Y14W]cGm GCRRLCYKQRCVTWCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay HFF-1 Chronic myeloid Leukemia CC50 : 68.4 ± 9.6 μM
dbacp00633 [Y14W]cGm GCRRLCYKQRCVTWCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay HFF-1 Gastric cancer CC50 : 68.4 ± 9.6 μM
dbacp00634 [Y14W]cGm GCRRLCYKQRCVTWCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay HFF-1 Breast cancer CC50 : 68.4 ± 9.6 μM
dbacp00635 [Y14W]cGm GCRRLCYKQRCVTWCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay HFF-1 Cervical cancer CC50 : 68.4 ± 9.6 μM
dbacp00636 [Y14W]cGm GCRRLCYKQRCVTWCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay HeLa Epithelial cancer CC50 : 50.4 ± 2.4 μM
dbacp00637 [Y14W]cGm GCRRLCYKQRCVTWCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay HeLa Chronic myeloid Leukemia CC50 : 50.4 ± 2.4 μM
dbacp00638 [Y14W]cGm GCRRLCYKQRCVTWCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay HeLa Gastric cancer CC50 : 50.4 ± 2.4 μM
dbacp00639 [Y14W]cGm GCRRLCYKQRCVTWCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay HeLa Breast cancer CC50 : 50.4 ± 2.4 μM
dbacp00640 [Y14W]cGm GCRRLCYKQRCVTWCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay HeLa Cervical cancer CC50 : 50.4 ± 2.4 μM
dbacp00641 [Y14W]cGm GCRRLCYKQRCVTWCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay K-562 Epithelial cancer CC50 : 2.7 ± 0.1 μM
dbacp00642 [Y14W]cGm GCRRLCYKQRCVTWCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay K-562 Chronic myeloid Leukemia CC50 : 2.7 ± 0.1 μM
dbacp00643 [Y14W]cGm GCRRLCYKQRCVTWCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay K-562 Gastric cancer CC50 : 2.7 ± 0.1 μM
dbacp00644 [Y14W]cGm GCRRLCYKQRCVTWCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay K-562 Breast cancer CC50 : 2.7 ± 0.1 μM
dbacp00645 [Y14W]cGm GCRRLCYKQRCVTWCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay K-562 Cervical cancer CC50 : 2.7 ± 0.1 μM
dbacp00646 [Y7W, K8R, Y14W]cGm GCRRLCWRQRCVTWCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay CRL-1739 Epithelial cancer CC50 : 31.6 ± 1.3 μM
dbacp00647 [Y7W, K8R, Y14W]cGm GCRRLCWRQRCVTWCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay CRL-1739 Chronic myeloid Leukemia CC50 : 31.6 ± 1.3 μM
dbacp00648 [Y7W, K8R, Y14W]cGm GCRRLCWRQRCVTWCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay CRL-1739 Gastric cancer CC50 : 31.6 ± 1.3 μM
dbacp00649 [Y7W, K8R, Y14W]cGm GCRRLCWRQRCVTWCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay CRL-1739 Breast cancer CC50 : 31.6 ± 1.3 μM
dbacp00650 [Y7W, K8R, Y14W]cGm GCRRLCWRQRCVTWCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay CRL-1739 Cervical cancer CC50 : 31.6 ± 1.3 μM
dbacp00651 [Y7W, K8R, Y14W]cGm GCRRLCWRQRCVTWCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay MM96L Epithelial cancer CC50 : 5.4 ± 0.3 μM
dbacp00652 [Y7W, K8R, Y14W]cGm GCRRLCWRQRCVTWCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay MM96L Chronic myeloid Leukemia CC50 : 5.4 ± 0.3 μM
dbacp00653 [Y7W, K8R, Y14W]cGm GCRRLCWRQRCVTWCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay MM96L Gastric cancer CC50 : 5.4 ± 0.3 μM
dbacp00654 [Y7W, K8R, Y14W]cGm GCRRLCWRQRCVTWCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay MM96L Breast cancer CC50 : 5.4 ± 0.3 μM
dbacp00655 [Y7W, K8R, Y14W]cGm GCRRLCWRQRCVTWCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay MM96L Cervical cancer CC50 : 5.4 ± 0.3 μM
dbacp00656 [Y7W, K8R, Y14W]cGm GCRRLCWRQRCVTWCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay HFF-1 Epithelial cancer CC50 : 31.3 ± 2.6 μM
dbacp00657 [Y7W, K8R, Y14W]cGm GCRRLCWRQRCVTWCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay HFF-1 Chronic myeloid Leukemia CC50 : 31.3 ± 2.6 μM
dbacp00658 [Y7W, K8R, Y14W]cGm GCRRLCWRQRCVTWCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay HFF-1 Gastric cancer CC50 : 31.3 ± 2.6 μM
dbacp00659 [Y7W, K8R, Y14W]cGm GCRRLCWRQRCVTWCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay HFF-1 Breast cancer CC50 : 31.3 ± 2.6 μM
dbacp00660 [Y7W, K8R, Y14W]cGm GCRRLCWRQRCVTWCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay HFF-1 Cervical cancer CC50 : 31.3 ± 2.6 μM
dbacp00661 [Y7W, K8R, Y14W]cGm GCRRLCWRQRCVTWCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay HeLa Epithelial cancer CC50 : 41.0 ± 4.2 μM
dbacp00662 [Y7W, K8R, Y14W]cGm GCRRLCWRQRCVTWCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay HeLa Chronic myeloid Leukemia CC50 : 41.0 ± 4.2 μM
dbacp00663 [Y7W, K8R, Y14W]cGm GCRRLCWRQRCVTWCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay HeLa Gastric cancer CC50 : 41.0 ± 4.2 μM
dbacp00664 [Y7W, K8R, Y14W]cGm GCRRLCWRQRCVTWCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay HeLa Breast cancer CC50 : 41.0 ± 4.2 μM
dbacp00665 [Y7W, K8R, Y14W]cGm GCRRLCWRQRCVTWCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay HeLa Cervical cancer CC50 : 41.0 ± 4.2 μM
dbacp00666 [Y7W, K8R, Y14W]cGm GCRRLCWRQRCVTWCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay MCF-7 Epithelial cancer CC50 : 15.1 ± 1.4 μM
dbacp00667 [Y7W, K8R, Y14W]cGm GCRRLCWRQRCVTWCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay MCF-7 Chronic myeloid Leukemia CC50 : 15.1 ± 1.4 μM
dbacp00668 [Y7W, K8R, Y14W]cGm GCRRLCWRQRCVTWCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay MCF-7 Gastric cancer CC50 : 15.1 ± 1.4 μM
dbacp00669 [Y7W, K8R, Y14W]cGm GCRRLCWRQRCVTWCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay MCF-7 Breast cancer CC50 : 15.1 ± 1.4 μM
dbacp00670 [Y7W, K8R, Y14W]cGm GCRRLCWRQRCVTWCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay MCF-7 Cervical cancer CC50 : 15.1 ± 1.4 μM
dbacp00671 [Y7W, K8R, Y14W]cGm GCRRLCWRQRCVTWCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay K-562 Epithelial cancer CC50 : 3.9 ± 0.1 μM
dbacp00672 [Y7W, K8R, Y14W]cGm GCRRLCWRQRCVTWCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay K-562 Chronic myeloid Leukemia CC50 : 3.9 ± 0.1 μM
dbacp00673 [Y7W, K8R, Y14W]cGm GCRRLCWRQRCVTWCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay K-562 Gastric cancer CC50 : 3.9 ± 0.1 μM
dbacp00674 [Y7W, K8R, Y14W]cGm GCRRLCWRQRCVTWCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay K-562 Breast cancer CC50 : 3.9 ± 0.1 μM
dbacp00675 [Y7W, K8R, Y14W]cGm GCRRLCWRQRCVTWCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay K-562 Cervical cancer CC50 : 3.9 ± 0.1 μM
dbacp00676 [Y7W]cGm GCRRLCWKQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay CRL-1739 Epithelial cancer CC50 : 23.3 ± 0.4 μM
dbacp00677 [Y7W]cGm GCRRLCWKQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay CRL-1739 Chronic myeloid Leukemia CC50 : 23.3 ± 0.4 μM
dbacp00678 [Y7W]cGm GCRRLCWKQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay CRL-1739 Gastric cancer CC50 : 23.3 ± 0.4 μM
dbacp00679 [Y7W]cGm GCRRLCWKQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay CRL-1739 Breast cancer CC50 : 23.3 ± 0.4 μM
dbacp00680 [Y7W]cGm GCRRLCWKQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay CRL-1739 Cervical cancer CC50 : 23.3 ± 0.4 μM
dbacp00681 [Y7W]cGm GCRRLCWKQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay MM96L Epithelial cancer CC50 : 5.1 ± 0.3 μM
dbacp00682 [Y7W]cGm GCRRLCWKQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay MM96L Chronic myeloid Leukemia CC50 : 5.1 ± 0.3 μM
dbacp00683 [Y7W]cGm GCRRLCWKQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay MM96L Gastric cancer CC50 : 5.1 ± 0.3 μM
dbacp00684 [Y7W]cGm GCRRLCWKQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay MM96L Breast cancer CC50 : 5.1 ± 0.3 μM
dbacp00685 [Y7W]cGm GCRRLCWKQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay MM96L Cervical cancer CC50 : 5.1 ± 0.3 μM
dbacp00686 [Y7W]cGm GCRRLCWKQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay HFF-1 Epithelial cancer CC50 : 39.7 ± 3.8 μM
dbacp00687 [Y7W]cGm GCRRLCWKQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay HFF-1 Chronic myeloid Leukemia CC50 : 39.7 ± 3.8 μM
dbacp00688 [Y7W]cGm GCRRLCWKQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay HFF-1 Gastric cancer CC50 : 39.7 ± 3.8 μM
dbacp00689 [Y7W]cGm GCRRLCWKQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay HFF-1 Breast cancer CC50 : 39.7 ± 3.8 μM
dbacp00690 [Y7W]cGm GCRRLCWKQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay HFF-1 Cervical cancer CC50 : 39.7 ± 3.8 μM
dbacp00691 [Y7W]cGm GCRRLCWKQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay HeLa Epithelial cancer CC50 : > 64 μM
dbacp00692 [Y7W]cGm GCRRLCWKQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay HeLa Chronic myeloid Leukemia CC50 : > 64 μM
dbacp00693 [Y7W]cGm GCRRLCWKQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay HeLa Gastric cancer CC50 : > 64 μM
dbacp00694 [Y7W]cGm GCRRLCWKQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay HeLa Breast cancer CC50 : > 64 μM
dbacp00695 [Y7W]cGm GCRRLCWKQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay HeLa Cervical cancer CC50 : > 64 μM
dbacp00696 [Y7W]cGm GCRRLCWKQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay K-562 Epithelial cancer CC50 : 3.9 ± 0.2 μM
dbacp00697 [Y7W]cGm GCRRLCWKQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay K-562 Chronic myeloid Leukemia CC50 : 3.9 ± 0.2 μM
dbacp00698 [Y7W]cGm GCRRLCWKQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay K-562 Gastric cancer CC50 : 3.9 ± 0.2 μM
dbacp00699 [Y7W]cGm GCRRLCWKQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay K-562 Breast cancer CC50 : 3.9 ± 0.2 μM
dbacp00700 [Y7W]cGm GCRRLCWKQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay K-562 Cervical cancer CC50 : 3.9 ± 0.2 μM
dbacp01160 Antimicrobial peptide TsAP-1 MQIKHLITLFFLVLIVADQCSAFLSLIPSLVGGSISAFKGRRKREISAQIEQYKDLQKREAELEELLDRLPMY Brazilian scorpion Membrane disruption MTT Cell viability assay NCIeH157 Human squamous carcinoma IC50 : 0.83 - 2.0 μM
dbacp01161 Antimicrobial peptide TsAP-1 MQIKHLITLFFLVLIVADQCSAFLSLIPSLVGGSISAFKGRRKREISAQIEQYKDLQKREAELEELLDRLPMY Brazilian scorpion Membrane disruption MTT Cell viability assay NCIeH838 Human Lung adenocarcinoma IC50 : 0.83 - 2.0 μM
dbacp01162 Antimicrobial peptide TsAP-1 MQIKHLITLFFLVLIVADQCSAFLSLIPSLVGGSISAFKGRRKREISAQIEQYKDLQKREAELEELLDRLPMY Brazilian scorpion Membrane disruption MTT Cell viability assay PC-3 androgen-independent Prostate adenocarcinoma IC50 : 0.83 - 2.0 μM
dbacp01163 Antimicrobial peptide TsAP-1 MQIKHLITLFFLVLIVADQCSAFLSLIPSLVGGSISAFKGRRKREISAQIEQYKDLQKREAELEELLDRLPMY Brazilian scorpion Membrane disruption MTT Cell viability assay MCF-7 Human breast carcinoma IC50 : 0.83 - 2.0 μM
dbacp01164 Antimicrobial peptide TsAP-1 MQIKHLITLFFLVLIVADQCSAFLSLIPSLVGGSISAFKGRRKREISAQIEQYKDLQKREAELEELLDRLPMY Brazilian scorpion Membrane disruption MTT Cell viability assay U251 Human glioblastoma IC50 : 0.83 - 2.0 μM
dbacp02168 C7A KILRGVAKKIMRTFLRRISKDILTGKK NK-2 peptide based derivatives Apoptosis; Necrosis Cell viability assay HCT-116 Colorectal cancer Cell viability : >50% at 25μM approx.
dbacp02169 C7A KILRGVAKKIMRTFLRRISKDILTGKK NK-2 peptide based derivatives Apoptosis; Necrosis Cell viability assay HROC24 Colorectal cancer Cell viability : >60% at 25μM approx.
dbacp02170 C7A KILRGVAKKIMRTFLRRISKDILTGKK NK-2 peptide based derivatives Apoptosis; Necrosis Cell viability assay HROC40 Colorectal cancer Cell viability : >60% at 25μM approx.
dbacp02171 C7A KILRGVAKKIMRTFLRRISKDILTGKK NK-2 peptide based derivatives Apoptosis; Necrosis Cell viability assay HROC60 Colorectal cancer Cell viability : >50% at 25μM approx.
dbacp02172 C7A KILRGVAKKIMRTFLRRISKDILTGKK NK-2 peptide based derivatives Apoptosis; Necrosis Cell viability assay HROC32 Colorectal cancer Cell viability : >60% at 25μM approx.
dbacp02173 C7A KILRGVAKKIMRTFLRRISKDILTGKK NK-2 peptide based derivatives Apoptosis; Necrosis Cell viability assay HCT-116 Colorectal cancer Cell viability : >40% at 12.5μM approx.
dbacp02174 C7A KILRGVAKKIMRTFLRRISKDILTGKK NK-2 peptide based derivatives Apoptosis; Necrosis Cell viability assay HROC18 Colorectal cancer Cell viability : >55% at 12.5μM approx.
dbacp02175 C7A KILRGVAKKIMRTFLRRISKDILTGKK NK-2 peptide based derivatives Apoptosis; Necrosis Cell viability assay HROC24 Colorectal cancer Cell viability : >55% at 12.5μM approx.
dbacp02176 C7A KILRGVAKKIMRTFLRRISKDILTGKK NK-2 peptide based derivatives Apoptosis; Necrosis Cell viability assay HROC40 Colorectal cancer Cell viability : >45% at 12.5μM approx.
dbacp02177 C7A KILRGVAKKIMRTFLRRISKDILTGKK NK-2 peptide based derivatives Apoptosis; Necrosis Cell viability assay HROC60 Colorectal cancer Cell viability : >70% at 12.5μM approx.
dbacp02178 C7A KILRGVAKKIMRTFLRRISKDILTGKK NK-2 peptide based derivatives Apoptosis; Necrosis Cell viability assay HROC113 Colorectal cancer Cell viability : >80% at 12.5μM approx.
dbacp02179 C7A KILRGVAKKIMRTFLRRISKDILTGKK NK-2 peptide based derivatives Apoptosis; Necrosis Cell viability assay HROC32 Colorectal cancer Cell viability : >55% at 12.5μM approx.
dbacp02180 C7A KILRGVAKKIMRTFLRRISKDILTGKK NK-2 peptide based derivatives Apoptosis; Necrosis Cell viability assay HROC107 Colorectal cancer Cell viability : >50% at 12.5μM approx.
dbacp02189 C7A-D21K KILRGVAKKIMRTFLRRISKKILTGKK NK-2 peptide based derivatives Apoptosis; Necrosis Cell viability assay HCT-116 Colorectal cancer Cell viability : 50% at 12.5μM approx.
dbacp02190 C7A-D21K KILRGVAKKIMRTFLRRISKKILTGKK NK-2 peptide based derivatives Apoptosis; Necrosis Cell viability assay HROC24 Colorectal cancer Cell viability : >50% at 25μM approx.
dbacp02191 C7A-D21K KILRGVAKKIMRTFLRRISKKILTGKK NK-2 peptide based derivatives Apoptosis; Necrosis Cell viability assay HROC40 Colorectal cancer Cell viability : >50% at 25μM approx..
dbacp02192 C7A-D21K KILRGVAKKIMRTFLRRISKKILTGKK NK-2 peptide based derivatives Apoptosis; Necrosis Cell viability assay HROC60 Colorectal cancer Cell viability : >50% at 25μM approx.
dbacp02193 C7A-D21K KILRGVAKKIMRTFLRRISKKILTGKK NK-2 peptide based derivatives Apoptosis; Necrosis Cell viability assay HROC32 Colorectal cancer Cell viability : 50% at 12.5μM approx.
dbacp02194 C7A-D21K KILRGVAKKIMRTFLRRISKKILTGKK NK-2 peptide based derivatives Apoptosis; Necrosis Cell viability assay HCT-116 Colorectal cancer Cell viability : >40% at 12.5μM approx.
dbacp02195 C7A-D21K KILRGVAKKIMRTFLRRISKKILTGKK NK-2 peptide based derivatives Apoptosis; Necrosis Cell viability assay HROC18 Colorectal cancer Cell viability : >55% at 12.5μM approx.
dbacp02196 C7A-D21K KILRGVAKKIMRTFLRRISKKILTGKK NK-2 peptide based derivatives Apoptosis; Necrosis Cell viability assay HROC24 Colorectal cancer Cell viability : >55% at 12.5μM approx.
dbacp02197 C7A-D21K KILRGVAKKIMRTFLRRISKKILTGKK NK-2 peptide based derivatives Apoptosis; Necrosis Cell viability assay HROC40 Colorectal cancer Cell viability : >80% at 12.5μM approx.
dbacp02198 C7A-D21K KILRGVAKKIMRTFLRRISKKILTGKK NK-2 peptide based derivatives Apoptosis; Necrosis Cell viability assay HROC60 Colorectal cancer Cell viability : >60% at 12.5μM approx.
dbacp02199 C7A-D21K KILRGVAKKIMRTFLRRISKKILTGKK NK-2 peptide based derivatives Apoptosis; Necrosis Cell viability assay HROC113 Colorectal cancer Cell viability : >65% at 12.5μM approx.
dbacp02200 C7A-D21K KILRGVAKKIMRTFLRRISKKILTGKK NK-2 peptide based derivatives Apoptosis; Necrosis Cell viability assay HROC32 Colorectal cancer Cell viability : >80% at 12.5μM approx.
dbacp02201 C7A-D21K KILRGVAKKIMRTFLRRISKKILTGKK NK-2 peptide based derivatives Apoptosis; Necrosis Cell viability assay HROC107 Colorectal cancer Cell viability : >65% at 12.5μM approx.
dbacp02209 C7A-Δ KILRGVAKKIMRTFLRRISKDILTGKK NK-2 peptide based derivatives Apoptosis; Necrosis Cell viability assay HCT-116 Colorectal cancer Cell viability : >50% at 12.5μM approx.
dbacp02210 C7A-Δ KILRGVAKKIMRTFLRRISKDILTGKK NK-2 peptide based derivatives Apoptosis; Necrosis Cell viability assay HROC24 Colorectal cancer Cell viability : >60% at 25μM approx.
dbacp02211 C7A-Δ KILRGVAKKIMRTFLRRISKDILTGKK NK-2 peptide based derivatives Apoptosis; Necrosis Cell viability assay HROC40 Colorectal cancer Cell viability : >50% at 25μM approx.
dbacp02212 C7A-Δ KILRGVAKKIMRTFLRRISKDILTGKK NK-2 peptide based derivatives Apoptosis; Necrosis Cell viability assay HROC60 Colorectal cancer Cell viability : >50% at 25μM approx.
dbacp02213 C7A-Δ KILRGVAKKIMRTFLRRISKDILTGKK NK-2 peptide based derivatives Apoptosis; Necrosis Cell viability assay HROC32 Colorectal cancer Cell viability : 50% at 12.5μM approx.
dbacp02214 C7A-Δ KILRGVAKKIMRTFLRRISKDILTGKK NK-2 peptide based derivatives Apoptosis; Necrosis Cell viability assay HCT-116 Colorectal cancer Cell viability : >50% at 12.5μM approx.
dbacp02215 C7A-Δ KILRGVAKKIMRTFLRRISKDILTGKK NK-2 peptide based derivatives Apoptosis; Necrosis Cell viability assay HROC18 Colorectal cancer Cell viability : >75% at 12.5μM approx.
dbacp02216 C7A-Δ KILRGVAKKIMRTFLRRISKDILTGKK NK-2 peptide based derivatives Apoptosis; Necrosis Cell viability assay HROC24 Colorectal cancer Cell viability : >70% at 12.5μM approx.
dbacp02217 C7A-Δ KILRGVAKKIMRTFLRRISKDILTGKK NK-2 peptide based derivatives Apoptosis; Necrosis Cell viability assay HROC40 Colorectal cancer Cell viability : >85% at 12.5μM approx.
dbacp02218 C7A-Δ KILRGVAKKIMRTFLRRISKDILTGKK NK-2 peptide based derivatives Apoptosis; Necrosis Cell viability assay HROC60 Colorectal cancer Cell viability : >70% at 12.5μM approx.
dbacp02219 C7A-Δ KILRGVAKKIMRTFLRRISKDILTGKK NK-2 peptide based derivatives Apoptosis; Necrosis Cell viability assay HROC113 Colorectal cancer Cell viability : >70% at 12.5μM approx.
dbacp02220 C7A-Δ KILRGVAKKIMRTFLRRISKDILTGKK NK-2 peptide based derivatives Apoptosis; Necrosis Cell viability assay HROC32 Colorectal cancer Cell viability : >85% at 12.5μM approx.
dbacp02221 C7A-Δ KILRGVAKKIMRTFLRRISKDILTGKK NK-2 peptide based derivatives Apoptosis; Necrosis Cell viability assay HROC107 Colorectal cancer Cell viability : >70% at 12.5μM approx.
dbacp02330 Cecropin A KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK Silkmoth Membrane disruption Cell viability assay 486P Bladder cancer IC50 : 69.2 µg/ml
dbacp02331 Cecropin A KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK Silkmoth Membrane disruption Cell viability assay RT4 Bladder cancer IC50 : 96.22 µg/ml
dbacp02332 Cecropin A KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK Silkmoth Membrane disruption Cell viability assay 647V Bladder cancer IC50 : 28.74 µg/ml
dbacp02333 Cecropin A KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK Silkmoth Membrane disruption Cell viability assay J82 Bladder cancer IC50 : 99.01 µg/ml
dbacp02340 Cecropin A KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK Isolated from the giant silk moth, cecropia moth Membrane damage; Apoptotic cell death; Necrosis Cell viability assay SCC25 Skin cancer 0.6 ± 0.6% cell growth inhibition at 10 µM
dbacp02341 Cecropin A KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK Isolated from the giant silk moth, cecropia moth Membrane damage; Apoptotic cell death; Necrosis Cell viability assay SCC25 Skin cancer 107.0 ± 5.0% cell growth inhibition at 1 µM
dbacp02349 Cecropin B KWKIFKKIEKVGRNIRNGIIKAGPAVAVLGEAKAL Chinese oak silk moth Membrane disruption Cell viability assay 486P Bladder cancer IC50 : 87.47 µg/ml
dbacp02350 Cecropin B KWKIFKKIEKVGRNIRNGIIKAGPAVAVLGEAKAL Chinese oak silk moth Membrane disruption Cell viability assay RT4 Bladder cancer IC50 : 92.9 µg/ml
dbacp02351 Cecropin B KWKIFKKIEKVGRNIRNGIIKAGPAVAVLGEAKAL Chinese oak silk moth Membrane disruption Cell viability assay 647V Bladder cancer IC50 : 61.86 µg/ml
dbacp02352 Cecropin B KWKIFKKIEKVGRNIRNGIIKAGPAVAVLGEAKAL Chinese oak silk moth Membrane disruption Cell viability assay J82 Bladder cancer IC50 : 77.51 µg/ml
dbacp02395 cGm (Derived from Gm) GCRRLCYKQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay CRL-1739 Epithelial cancer CC50 : 39.8 ± 1.0 μM
dbacp02396 cGm (Derived from Gm) GCRRLCYKQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay CRL-1739 Chronic myeloid leukemia CC50 : 39.8 ± 1.0 μM
dbacp02397 cGm (Derived from Gm) GCRRLCYKQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay CRL-1739 Gastric cancer CC50 : 39.8 ± 1.0 μM
dbacp02398 cGm (Derived from Gm) GCRRLCYKQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay CRL-1739 Breast cancer CC50 : 39.8 ± 1.0 μM
dbacp02399 cGm (Derived from Gm) GCRRLCYKQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay CRL-1739 Cervical cancer CC50 : 39.8 ± 1.0 μM
dbacp02400 cGm (Derived from Gm) GCRRLCYKQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay MM96L Epithelial cancer CC50 : 2.9 ± 0.1 μM
dbacp02401 cGm (Derived from Gm) GCRRLCYKQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay MM96L Chronic myeloid leukemia CC50 : 2.9 ± 0.1 μM
dbacp02402 cGm (Derived from Gm) GCRRLCYKQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay MM96L Gastric cancer CC50 : 2.9 ± 0.1 μM
dbacp02403 cGm (Derived from Gm) GCRRLCYKQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay MM96L Breast cancer CC50 : 2.9 ± 0.1 μM
dbacp02404 cGm (Derived from Gm) GCRRLCYKQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay MM96L Cervical cancer CC50 : 2.9 ± 0.1 μM
dbacp02405 cGm (Derived from Gm) GCRRLCYKQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay HFF-1 Epithelial cancer CC50 : 71.7 ± 9.2 μM
dbacp02406 cGm (Derived from Gm) GCRRLCYKQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay HFF-1 Chronic myeloid leukemia CC50 : 71.7 ± 9.2 μM
dbacp02407 cGm (Derived from Gm) GCRRLCYKQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay HFF-1 Gastric cancer CC50 : 71.7 ± 9.2 μM
dbacp02408 cGm (Derived from Gm) GCRRLCYKQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay HFF-1 Breast cancer CC50 : 71.7 ± 9.2 μM
dbacp02409 cGm (Derived from Gm) GCRRLCYKQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay HFF-1 Cervical cancer CC50 : 71.7 ± 9.2 μM
dbacp02410 cGm (Derived from Gm) GCRRLCYKQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay HeLa Epithelial cancer CC50 : > 64 μM
dbacp02411 cGm (Derived from Gm) GCRRLCYKQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay HeLa Chronic myeloid leukemia CC50 : > 64 μM
dbacp02412 cGm (Derived from Gm) GCRRLCYKQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay HeLa Gastric cancer CC50 : > 64 μM
dbacp02413 cGm (Derived from Gm) GCRRLCYKQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay HeLa Breast cancer CC50 : > 64 μM
dbacp02414 cGm (Derived from Gm) GCRRLCYKQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay HeLa Cervical cancer CC50 : > 64 μM
dbacp02415 cGm (Derived from Gm) GCRRLCYKQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay MCF-7 Epithelial cancer CC50 : 15.3 ± 1.4 μM
dbacp02416 cGm (Derived from Gm) GCRRLCYKQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay MCF-7 Chronic myeloid leukemia CC50 : 15.3 ± 1.4 μM
dbacp02417 cGm (Derived from Gm) GCRRLCYKQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay MCF-7 Gastric cancer CC50 : 15.3 ± 1.4 μM
dbacp02418 cGm (Derived from Gm) GCRRLCYKQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay MCF-7 Breast cancer CC50 : 15.3 ± 1.4 μM
dbacp02419 cGm (Derived from Gm) GCRRLCYKQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay MCF-7 Cervical cancer CC50 : 15.3 ± 1.4 μM
dbacp02420 cGm (Derived from Gm) GCRRLCYKQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay K-562 Epithelial cancer CC50 : 2.7 ± 0.1 μM
dbacp02421 cGm (Derived from Gm) GCRRLCYKQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay K-562 Chronic myeloid leukemia CC50 : 2.7 ± 0.1 μM
dbacp02422 cGm (Derived from Gm) GCRRLCYKQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay K-562 Gastric cancer CC50 : 2.7 ± 0.1 μM
dbacp02423 cGm (Derived from Gm) GCRRLCYKQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay K-562 Breast cancer CC50 : 2.7 ± 0.1 μM
dbacp02424 cGm (Derived from Gm) GCRRLCYKQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay K-562 Cervical cancer CC50 : 2.7 ± 0.1 μM
dbacp02425 cGm (Derived from Gm) GCRRLCYKQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay PBMCs Epithelial cancer CC50 : 12.7 ± 1.1 μM
dbacp02426 cGm (Derived from Gm) GCRRLCYKQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay PBMCs Chronic myeloid leukemia CC50 : 12.7 ± 1.1 μM
dbacp02427 cGm (Derived from Gm) GCRRLCYKQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay PBMCs Gastric cancer CC50 : 12.7 ± 1.1 μM
dbacp02428 cGm (Derived from Gm) GCRRLCYKQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay PBMCs Breast cancer CC50 : 12.7 ± 1.1 μM
dbacp02429 cGm (Derived from Gm) GCRRLCYKQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay PBMCs Cervical cancer CC50 : 12.7 ± 1.1 μM
dbacp02631 DC1 GAFLKCGESCVYLPCLTTVVGCSCQNSVCYRD Snake-needle grass Apoptosis inducing Colorimetric Cell viability assay,Migration assay ,Wound healing assay and Human prostate cancer xenograft assay DC3 Prostate cancer Not found
dbacp02632 DC1 GAFLKCGESCVYLPCLTTVVGCSCQNSVCYRD Snake-needle grass Apoptosis inducing Colorimetric Cell viability assay,Migration assay ,Wound healing assay and Human prostate cancer xenograft assay LNCap Prostate cancer Not found
dbacp02633 DC2 GAVPCGETCVYLPCITPDIGCSCQNKVCYRD Snake-needle grass Apoptosis inducing Colorimetric Cell viability assay,Migration assay ,Wound healing assay and Human prostate cancer xenograft assay DC3 Prostate cancer Not found
dbacp02634 DC2 GAVPCGETCVYLPCITPDIGCSCQNKVCYRD Snake-needle grass Apoptosis inducing Colorimetric Cell viability assay,Migration assay ,Wound healing assay and Human prostate cancer xenograft assay LNCap Prostate cancer Not found
dbacp02635 DC3 GTSCGETCVLLPCLSSVLGCTCQNKRCYKD Snake-needle grass Apoptosis inducing Colorimetric Cell viability assay,Migration assay ,Wound healing assay and Human prostate cancer xenograft assay DC3 Prostate cancer Not found
dbacp02636 DC3 GTSCGETCVLLPCLSSVLGCTCQNKRCYKD Snake-needle grass Apoptosis inducing Colorimetric Cell viability assay,Migration assay ,Wound healing assay and Human prostate cancer xenograft assay LNCap Prostate cancer Not found
dbacp02655 Dermaseptin-B2 GLWSKIKEVGKEAAKAAAKAAGKAALGAVSEAV Giant leaf frog Immunomodulatory properties Cytotoxicity assays, Cell Titer-Glo Luminescent Cell viability assay A549 Lung adenocarcinoma LC50 : < 12 μM
dbacp02656 Dermaseptin-B2 GLWSKIKEVGKEAAKAAAKAAGKAALGAVSEAV Giant leaf frog Immunomodulatory properties Cytotoxicity assays, Cell Titer-Glo Luminescent Cell viability assay MDA-MB-231 Breast adenocarcinoma LC50 : < 12 μM
dbacp02657 Dermaseptin-B2 GLWSKIKEVGKEAAKAAAKAAGKAALGAVSEAV Giant leaf frog Immunomodulatory properties Cytotoxicity assays, Cell Titer-Glo Luminescent Cell viability assay HT-29 Colorectal adenocarcinoma LC50 : < 12 μM
dbacp02779 Distinctin-Like-Peptide-PH NLVSALIEGRKYLKNVLKKLNRLKEKNKAKNSKENN Skin Secretion, Northern orange-legged leaf frog, South America Membrane lysis via pore formation MTT Cell viability assay, LDH assay H157 Prostate carcinoma MIC : ≥ 4.197 μM
dbacp02780 Distinctin-Like-Peptide-PH NLVSALIEGRKYLKNVLKKLNRLKEKNKAKNSKENN Skin Secretion, Northern orange-legged leaf frog, South America Membrane lysis via pore formation MTT Cell viability assay, LDH assay H158 Prostate carcinoma IC50 : 15.41 μg/mL
dbacp02781 Distinctin-Like-Peptide-PH NLVSALIEGRKYLKNVLKKLNRLKEKNKAKNSKENN Skin Secretion, Northern orange-legged leaf frog, South America Membrane lysis via pore formation MTT Cell viability assay, LDH assay PC3 Lung cancer MIC : ≥ 4.197 μM
dbacp02782 Distinctin-Like-Peptide-PH NLVSALIEGRKYLKNVLKKLNRLKEKNKAKNSKENN Skin Secretion, Northern orange-legged leaf frog, South America Membrane lysis via pore formation MTT Cell viability assay, LDH assay PC3 Lung cancer IC50 : 32.25 μg/mL
dbacp02802 Dolastatin 10 2-[[2-(dimethylamino)-3-methylbutanoyl]amino]-N-[3-methoxy-1-[2-[1-methoxy-2-methyl-3-oxo-3-[[2-phenyl-1-(1,3-thiazol-2-yl)ethyl]amino]propyl]pyrrolidin-1-yl]-5-methyl-1-oxoheptan-4-yl]-N,3-dimethylbutaNAmide Wedge sea hare Apoptosis inducing Cell viability assay DB Lymphoma cancer IC50 : 0.0013 - 0.013 nM
dbacp02803 Dolastatin 10 2-[[2-(dimethylamino)-3-methylbutanoyl]amino]-N-[3-methoxy-1-[2-[1-methoxy-2-methyl-3-oxo-3-[[2-phenyl-1-(1,3-thiazol-2-yl)ethyl]amino]propyl]pyrrolidin-1-yl]-5-methyl-1-oxoheptan-4-yl]-N,3-dimethylbutaNAmide Wedge sea hare Apoptosis inducing Cell viability assay HT Lymphoma cancer IC50 : 0.0013 - 0.013 nM
dbacp02804 Dolastatin 10 2-[[2-(dimethylamino)-3-methylbutanoyl]amino]-N-[3-methoxy-1-[2-[1-methoxy-2-methyl-3-oxo-3-[[2-phenyl-1-(1,3-thiazol-2-yl)ethyl]amino]propyl]pyrrolidin-1-yl]-5-methyl-1-oxoheptan-4-yl]-N,3-dimethylbutaNAmide Wedge sea hare Apoptosis inducing Cell viability assay RL Lymphoma cancer IC50 : 0.0013 - 0.013 nM
dbacp02805 Dolastatin 10 2-[[2-(dimethylamino)-3-methylbutanoyl]amino]-N-[3-methoxy-1-[2-[1-methoxy-2-methyl-3-oxo-3-[[2-phenyl-1-(1,3-thiazol-2-yl)ethyl]amino]propyl]pyrrolidin-1-yl]-5-methyl-1-oxoheptan-4-yl]-N,3-dimethylbutaNAmide Wedge sea hare Apoptosis inducing Cell viability assay SR Leukemia cancer IC50 : 0.0013 - 0.013 nM
dbacp02806 Dolastatin 15 VV-nMe-VPP-2hydroxyisovaleryl-2-oxo-4-methoxy-5-benzyl-3-pyrroline Wedge sea hare Apoptosis inducing Cell viability assay DB Lymphoma cancer IC50 : 0.0013 - 0.013 nM
dbacp02807 Dolastatin 15 VV-nMe-VPP-2hydroxyisovaleryl-2-oxo-4-methoxy-5-benzyl-3-pyrroline Wedge sea hare Apoptosis inducing Cell viability assay HT Lymphoma cancer IC50 : 0.0013 - 0.013 nM
dbacp02808 Dolastatin 15 VV-nMe-VPP-2hydroxyisovaleryl-2-oxo-4-methoxy-5-benzyl-3-pyrroline Wedge sea hare Apoptosis inducing Cell viability assay RL Lymphoma cancer IC50 : 0.0013 - 0.013 nM
dbacp02809 Dolastatin 15 VV-nMe-VPP-2hydroxyisovaleryl-2-oxo-4-methoxy-5-benzyl-3-pyrroline Wedge sea hare Apoptosis inducing Cell viability assay SR Leukemia cancer IC50 : 0.0013 - 0.013 nM
dbacp02829 Elastin derived peptide VGVAPG Elastin derived Apoptosis inducing Cell viability assay MCF-7 Breast cancer Not found
dbacp02830 Elastin derived peptide VGVAPG Elastin derived Apoptosis inducing Cell viability assay A549 Lung cancer Not found
dbacp02919 Esculentin-2CHa GFSSIFRGVAKFASKGLGKDLAKLGVDLVACKISKQC Chiricahua leopard frog Membrane disruption and cell lysis Cytotoxicity assay, Cell TiterGlo Luminescent cell viability assay A549 cells Lung adenocarcinoma LC50 : 10μM
dbacp02969 Frenatin 2.1S GLVGTLLGHIGKAILG Skin secretions, the Orinoco lime frog, north central Guyana, South America Immunomodulatory activity Cytotoxicity assay, Cell Titer-Glo Luminescent Cell Viability assay A549 Lung adenocarcinoma LC50 : 80 ± 6 μM
dbacp02970 Frenatin 2.1S (F2.3S) MAFLKKSLFLVLFLGLVSLSMGEREKREEEEEEEEENKEEEANEEGKGESEEKRGLVGTLLGHIGKAILGG Orinoco lime treefrog Not specified Cytotoxicity assay, Cell Titer-Glo Luminescent Cell Viability assay A549 Lung adenocarcinoma LC50 : 80 ± 6 µM
dbacp02971 Frenatin 2.2S GLVGTLLGHIGKAILS Skin secretions, the Orinoco lime frog, north central Guyana, South America Immunomodulatory activity Cytotoxicity assay, Cell Titer-Glo Luminescent Cell Viability assay A549 Lung adenocarcinoma LC50 : 75 ± 5 μM
dbacp03129 Gomesin ZCRRLCYKQRCVTYCRGR Tarantula spider sp. Target and destroy tumor cell membranes Cell viability assay K-562 Epithelial cancer CC50 : 3.8 ± 0.3 μM
dbacp03130 Gomesin ZCRRLCYKQRCVTYCRGR Tarantula spider sp. Target and destroy tumor cell membranes Cell viability assay K-562 Chronic myeloid leukemia CC50 : 3.8 ± 0.3 μM
dbacp03131 Gomesin ZCRRLCYKQRCVTYCRGR Tarantula spider sp. Target and destroy tumor cell membranes Cell viability assay K-562 Gastric cancer CC50 : 3.8 ± 0.3 μM
dbacp03132 Gomesin ZCRRLCYKQRCVTYCRGR Tarantula spider sp. Target and destroy tumor cell membranes Cell viability assay K-562 Breast cancer CC50 : 3.8 ± 0.3 μM
dbacp03133 Gomesin ZCRRLCYKQRCVTYCRGR Tarantula spider sp. Target and destroy tumor cell membranes Cell viability assay K-562 Cervical cancer CC50 : 3.8 ± 0.3 μM
dbacp03134 Gomesin ZCRRLCYKQRCVTYCRGR Tarantula spider sp. Target and destroy tumor cell membranes Cell viability assay CRL-1739 Epithelial cancer CC50 : 67.0 ± 5.0 μM
dbacp03135 Gomesin ZCRRLCYKQRCVTYCRGR Tarantula spider sp. Target and destroy tumor cell membranes Cell viability assay CRL-1739 Chronic myeloid leukemia CC50 : 67.0 ± 5.0 μM
dbacp03136 Gomesin ZCRRLCYKQRCVTYCRGR Tarantula spider sp. Target and destroy tumor cell membranes Cell viability assay CRL-1739 Gastric cancer CC50 : 67.0 ± 5.0 μM
dbacp03137 Gomesin ZCRRLCYKQRCVTYCRGR Tarantula spider sp. Target and destroy tumor cell membranes Cell viability assay CRL-1739 Breast cancer CC50 : 67.0 ± 5.0 μM
dbacp03138 Gomesin ZCRRLCYKQRCVTYCRGR Tarantula spider sp. Target and destroy tumor cell membranes Cell viability assay CRL-1739 Cervical cancer CC50 : 67.0 ± 5.0 μM
dbacp03139 Gomesin ZCRRLCYKQRCVTYCRGR Tarantula spider sp. Target and destroy tumor cell membranes Cell viability assay MM96L Epithelial cancer CC50 : 3.7 ± 0.2 μM
dbacp03140 Gomesin ZCRRLCYKQRCVTYCRGR Tarantula spider sp. Target and destroy tumor cell membranes Cell viability assay MM96L Chronic myeloid leukemia CC50 : 3.7 ± 0.2 μM
dbacp03141 Gomesin ZCRRLCYKQRCVTYCRGR Tarantula spider sp. Target and destroy tumor cell membranes Cell viability assay MM96L Gastric cancer CC50 : 3.7 ± 0.2 μM
dbacp03142 Gomesin ZCRRLCYKQRCVTYCRGR Tarantula spider sp. Target and destroy tumor cell membranes Cell viability assay MM96L Breast cancer CC50 : 3.7 ± 0.2 μM
dbacp03143 Gomesin ZCRRLCYKQRCVTYCRGR Tarantula spider sp. Target and destroy tumor cell membranes Cell viability assay MM96L Cervical cancer CC50 : 3.7 ± 0.2 μM
dbacp03144 Gomesin ZCRRLCYKQRCVTYCRGR Tarantula spider sp. Target and destroy tumor cell membranes Cell viability assay HFF-1 Epithelial cancer CC50 : 49.9 ±16.6 μM
dbacp03145 Gomesin ZCRRLCYKQRCVTYCRGR Tarantula spider sp. Target and destroy tumor cell membranes Cell viability assay HFF-1 Chronic myeloid leukemia CC50 : 49.9 ±16.6 μM
dbacp03146 Gomesin ZCRRLCYKQRCVTYCRGR Tarantula spider sp. Target and destroy tumor cell membranes Cell viability assay HFF-1 Gastric cancer CC50 : 49.9 ±16.6 μM
dbacp03147 Gomesin ZCRRLCYKQRCVTYCRGR Tarantula spider sp. Target and destroy tumor cell membranes Cell viability assay HFF-1 Breast cancer CC50 : 49.9 ±16.6 μM
dbacp03148 Gomesin ZCRRLCYKQRCVTYCRGR Tarantula spider sp. Target and destroy tumor cell membranes Cell viability assay HFF-1 Cervical cancer CC50 : 49.9 ±16.6 μM
dbacp03149 Gomesin ZCRRLCYKQRCVTYCRGR Tarantula spider sp. Target and destroy tumor cell membranes Cell viability assay HeLa Epithelial cancer CC50 : 54.1 ± 5.0 μM
dbacp03150 Gomesin ZCRRLCYKQRCVTYCRGR Tarantula spider sp. Target and destroy tumor cell membranes Cell viability assay HeLa Chronic myeloid leukemia CC50 : 54.1 ± 5.0 μM
dbacp03151 Gomesin ZCRRLCYKQRCVTYCRGR Tarantula spider sp. Target and destroy tumor cell membranes Cell viability assay HeLa Gastric cancer CC50 : 54.1 ± 5.0 μM
dbacp03152 Gomesin ZCRRLCYKQRCVTYCRGR Tarantula spider sp. Target and destroy tumor cell membranes Cell viability assay HeLa Breast cancer CC50 : 54.1 ± 5.0 μM
dbacp03153 Gomesin ZCRRLCYKQRCVTYCRGR Tarantula spider sp. Target and destroy tumor cell membranes Cell viability assay HeLa Cervical cancer CC50 : 54.1 ± 5.0 μM
dbacp03352 Hymenochirin-1B KLSPETKDNLKKVLKGAIKGAIVAKMV Zaire dwarf clawed frog Membrane disruption and cell lysis Cytotoxicity assay, Cell TiterGlo Luminescent Cell viability assay A549 Lung cancer LC50 : 2.5 ± 0.2 μM
dbacp03353 Hymenochirin-1B KLSPETKDNLKKVLKGAIKGAIVAKMV Zaire dwarf clawed frog Membrane disruption and cell lysis Cytotoxicity assay, Cell TiterGlo Luminescent Cell viability assay MDA-MB-231 Breast cancer LC50 : 9.0 ± 0.3 μM
dbacp03354 Hymenochirin-1B KLSPETKDNLKKVLKGAIKGAIVAKMV Zaire dwarf clawed frog Membrane disruption and cell lysis Cytotoxicity assay, Cell TiterGlo Luminescent Cell viability assay HT-29 Colon cancer LC50 : 9.7 ± 0.2 μM
dbacp03355 Hymenochirin-1B KLSPETKDNLKKVLKGAIKGAIVAKMV Zaire dwarf clawed frog Membrane disruption and cell lysis Cytotoxicity assay, Cell TiterGlo Luminescent Cell viability assay HepG2 Liver cancer LC50 : 22.5 ± 1.4 μM
dbacp03363 Hα-Defensin HNPs-1 NA Not found Cellular necrosis Cell viability assay RCCs, HLA-DRB1*10301 Tumor Inhibition at 12.5 µg/ml
dbacp03364 Hα-Defensin HNPs-2 NA Not found Cellular necrosis Cell viability assay RCCs, HLA-DRB1*10301 Tumor Inhibition at 12.5 µg/ml
dbacp03365 Hα-Defensin HNPs-3 NA Not found Cellular necrosis Cell viability assay RCCs, HLA-DRB1*10301 Tumor Inhibition at 12.5 µg/ml
dbacp03709 Laxaphycin A Aoc-Hse-E-Dhb-Hyp-Hse-FLIILG Terrestrial blue-green alga or the marine cyanobacterium Not specified Cell viability assay CEM-WT Leukemia cancer No inhibition at 4 µM
dbacp03710 Laxaphycin A Aoc-Hse-E-Dhb-Hyp-Hse-FLIILG Terrestrial blue-green alga or the marine cyanobacterium Not specified Cell viability assay CEM-VLB Leukemia cancer No inhibition at 4 µM
dbacp03711 Laxaphycin A Aoc-Hse-E-Dhb-Hyp-Hse-FLIILG Terrestrial blue-green alga or the marine cyanobacterium Not specified Cell viability assay CEM-VM1 Leukemia cancer No inhibition at 4 µM
dbacp03712 Laxaphycin B A-Hleu-QN-MeIle-Hasn-TPLT-Ade-V-Hleu Terrestrial blue-green alga or the marine cyanobacterium Not specified Cell viability assay CEM-WT Leukemia cancer 50% inhibition at 1 µM
dbacp03713 Laxaphycin B A-Hleu-QN-MeIle-Hasn-TPLT-Ade-V-Hleu Terrestrial blue-green alga or the marine cyanobacterium Not specified Cell viability assay CEM-WT Leukemia cancer 44% inhibition at 1 µM
dbacp03714 Laxaphycin B A-Hleu-QN-MeIle-Hasn-TPLT-Ade-V-Hleu Terrestrial blue-green alga or the marine cyanobacterium Not specified Cell viability assay CEM-VM1 Leukemia cancer 44% inhibition at 1 µM
dbacp03715 Laxaphycin B A-Hleu-QN-MeIle-Hasn-TPLT-Ade-V-Hleu Terrestrial blue-green alga or the marine cyanobacterium Not specified Cell viability assay CEM-VLB Leukemia cancer 44% inhibition at 1 µM
dbacp03716 Laxaphycin B A-Hleu-QN-MeIle-Hasn-TPLT-Ade-V-Hleu Terrestrial blue-green alga or the marine cyanobacterium Not specified Cell viability assay CEM-WT Leukemia cancer 40% inhibition at 1 µM
dbacp03717 Laxaphycin B A-Hleu-QN-MeIle-Hasn-TPLT-Ade-V-Hleu Terrestrial blue-green alga or the marine cyanobacterium Not specified Cell viability assay CEM-VM1 Leukemia cancer 40% inhibition at 1 µM
dbacp03718 Laxaphycin B A-Hleu-QN-MeIle-Hasn-TPLT-Ade-V-Hleu Terrestrial blue-green alga or the marine cyanobacterium Not specified Cell viability assay CEM-VLB Leukemia cancer 40% inhibition at 1 µM
dbacp04483 Magainin 2 GIGKFLHSAKKFGKAFVGEIMNS African clawed frog Membrane perforation Cell viability assay RT4(G1) Bladder cancer IC50 : 135.3 µM
dbacp04484 Magainin 2 GIGKFLHSAKKFGKAFVGEIMNS African clawed frog Membrane perforation Cell viability assay 647V(G2) Bladder cancer IC50 : 31 µM
dbacp04485 Magainin 2 GIGKFLHSAKKFGKAFVGEIMNS African clawed frog Membrane perforation Cell viability assay 486P(G4) Bladder cancer IC50 : 59.4 µM
dbacp04497 Magainin 2 GIGKFLHSAKKFGKAFVGEIMNS Yunnan firebelly toad Membrane perforation Cell viability assay 486P(G4) Bladder cancer IC50 : 59.4 µM
dbacp04578 Mastoparan-Cimals. XXA; UCLL1c) LNLKALLAVAKKIL Venom, the European Hornet Inducing apoptosis MTT cell viability assay and Lactate dehydrogenase (LDH) leakage assay H157 Lung cancer MIC : 6.26 - 36.65 μM
dbacp04579 Mastoparan-Cimals. XXA; UCLL1c) LNLKALLAVAKKIL Venom, the European Hornet Inducing apoptosis MTT cell viability assay and Lactate dehydrogenase (LDH) leakage assay MDA-MB-435S Breast cancer MIC : 6.26 - 36.65 μM
dbacp04580 Mastoparan-Cimals. XXA; UCLL1c) LNLKALLAVAKKIL Venom, the European Hornet Inducing apoptosis MTT cell viability assay and Lactate dehydrogenase (LDH) leakage assay PC-3 Human prostate carcinoma MIC : 6.26 - 36.65 μM
dbacp04581 Mastoparan-Cimals. XXA; UCLL1c) LNLKALLAVAKKIL Venom, the European Hornet Inducing apoptosis MTT cell viability assay and Lactate dehydrogenase (LDH) leakage assay U251-MG Glioma MIC : 6.26 - 36.65 μM
dbacp04582 Mastoparan-Cimals. XXA; UCLL1c) LNLKALLAVAKKIL Venom, the European Hornet Inducing apoptosis MTT cell viability assay and Lactate dehydrogenase (LDH) leakage assay MCF-7 Breast cancer MIC : 6.26 - 36.65 μM
dbacp04583 Mastoparan-Cimals. XXA; UCLL1c) LNLKALLAVAKKIL Venom, the European Hornet Inducing apoptosis MTT cell viability assay and Lactate dehydrogenase (LDH) leakage assay HMEC-1 Glioma MIC : 6.26 - 36.65 μM
dbacp04584 Mastoparan-Cimals. XXA; UCLL1c) LNLKALLAVAKKIL Venom, the European Hornet Inducing apoptosis MTT cell viability assay and Lactate dehydrogenase (LDH) leakage assay H157 Lung cancer IC50 : < 4 μM
dbacp04585 Mastoparan-Cimals. XXA; UCLL1c) LNLKALLAVAKKIL Venom, the European Hornet Inducing apoptosis MTT cell viability assay and Lactate dehydrogenase (LDH) leakage assay MDA-MB-435S Breast cancer IC50 : < 4 μM
dbacp04586 Mastoparan-Cimals. XXA; UCLL1c) LNLKALLAVAKKIL Venom, the European Hornet Inducing apoptosis MTT cell viability assay and Lactate dehydrogenase (LDH) leakage assay PC-3 Human prostate carcinoma IC50 : < 4 μM
dbacp04587 Mastoparan-Cimals. XXA; UCLL1c) LNLKALLAVAKKIL Venom, the European Hornet Inducing apoptosis MTT cell viability assay and Lactate dehydrogenase (LDH) leakage assay U251-MG Glioma IC50 : < 4 μM
dbacp04588 Mastoparan-Cimals. XXA; UCLL1c) LNLKALLAVAKKIL Venom, the European Hornet Inducing apoptosis MTT cell viability assay and Lactate dehydrogenase (LDH) leakage assay MCF-7 Breast cancer IC50 : < 4 μM
dbacp04589 Mastoparan-Cimals. XXA; UCLL1c) LNLKALLAVAKKIL Venom, the European Hornet Inducing apoptosis MTT cell viability assay and Lactate dehydrogenase (LDH) leakage assay HMEC-1 Glioma IC50 : < 4 μM
dbacp04652 Melittin GIGAVLKVLTTGLPALISWIKRKRQQ Main component of honey bee venom Membrane damage; Apoptotic cell death; Necrosis Cell viability assay SCC25 Skin cancer 102.9 ± 4.1% cell growth inhibition at 1 µM
dbacp04794 N29D PDEDAINDALNKVCSTGRRQRSICKQLLKK Synthetic peptide Apoptotic inducing Cell viability assay SW-480 Colon cancer > 100% cell viability at 5 µM
dbacp04795 N29D PDEDAINDALNKVCSTGRRQRSICKQLLKK Synthetic peptide Apoptotic inducing Cell viability assay SW-480 Colon cancer 60% cell viability at 50 µM
dbacp04796 N29D PDEDAINDALNKVCSTGRRQRSICKQLLKK Synthetic peptide Apoptotic inducing Cell viability assay U-937 Lymphoma cancer 100% cell viability at 5 µM
dbacp04797 N29D PDEDAINDALNKVCSTGRRQRSICKQLLKK Synthetic peptide Apoptotic inducing Cell viability assay U-937 Lymphoma cancer < 60% cell viability at 50 µM
dbacp04798 N29D PDEDAINDALNKVCSTGRRQRSICKQLLKK Synthetic peptide Apoptotic inducing Cell viability assay SNU-1 Gastric cancer < 100% cell viability at 5 µM
dbacp04799 N29D PDEDAINDALNKVCSTGRRQRSICKQLLKK Synthetic peptide Apoptotic inducing Cell viability assay SNU-1 Gastric cancer < 40% cell viability at 50 µM
dbacp04800 N29D PDEDAINDALNKVCSTGRRQRSICKQLLKK Synthetic peptide Apoptotic inducing Cell viability assay SW-480 Colon cancer > 100% cell viability at 5 µM
dbacp04801 N29D PDEDAINDALNKVCSTGRRQRSICKQLLKK Synthetic peptide Apoptotic inducing Cell viability assay SW-480 Colon cancer 60% cell viability at 50 µM
dbacp04802 N29D PDEDAINDALNKVCSTGRRQRSICKQLLKK Synthetic peptide Apoptotic inducing Cell viability assay U-937 Lymphoma cancer 100% cell viability at 5 µM
dbacp04803 N29D PDEDAINDALNKVCSTGRRQRSICKQLLKK Synthetic peptide Apoptotic inducing Cell viability assay U-937 Lymphoma cancer < 60% cell viability at 50 µM
dbacp04804 N29D PDEDAINDALNKVCSTGRRQRSICKQLLKK Synthetic peptide Apoptotic inducing Cell viability assay SNU-1 Gastric cancer 100% cell viability at 5 µM
dbacp04805 N29D PDEDAINDALNKVCSTGRRQRSICKQLLKK Synthetic peptide Apoptotic inducing Cell viability assay SNU-1 Gastric cancer < 40% cell viability at 50 µM
dbacp04806 N29N PDEDAINNALNKVCSTGRRQRSICKQLLKK Synthetic peptide Apoptotic inducing Cell viability assay SW-480 Colon cancer 100% cell viability at 5 µM
dbacp04807 N29N PDEDAINNALNKVCSTGRRQRSICKQLLKK Synthetic peptide Apoptotic inducing Cell viability assay SW-480 Colon cancer 40% cell viability at 50 µM
dbacp04808 N29N PDEDAINNALNKVCSTGRRQRSICKQLLKK Synthetic peptide Apoptotic inducing Cell viability assay U-937 Lymphoma cancer 100% cell viability at 5 µM
dbacp04809 N29N PDEDAINNALNKVCSTGRRQRSICKQLLKK Synthetic peptide Apoptotic inducing Cell viability assay U-937 Lymphoma cancer < 40% cell viability at 50 µM
dbacp04810 N29N PDEDAINNALNKVCSTGRRQRSICKQLLKK Synthetic peptide Apoptotic inducing Cell viability assay SNU-1 Gastric cancer < 100% cell viability at 5 µM
dbacp04811 N29N PDEDAINNALNKVCSTGRRQRSICKQLLKK Synthetic peptide Apoptotic inducing Cell viability assay SNU-1 Gastric cancer < 20% cell viability at 50 µM
dbacp04812 N29N PDEDAINNALNKVCSTGRRQRSICKQLLKK Synthetic peptide Apoptotic inducing Cell viability assay SW-480 Colon cancer 100% cell viability at 5 µM
dbacp04813 N29N PDEDAINNALNKVCSTGRRQRSICKQLLKK Synthetic peptide Apoptotic inducing Cell viability assay SW-480 Colon cancer 40% cell viability at 50 µM
dbacp04814 N29N PDEDAINNALNKVCSTGRRQRSICKQLLKK Synthetic peptide Apoptotic inducing Cell viability assay U-937 Lymphoma cancer 100% cell viability at 5 µM
dbacp04815 N29N PDEDAINNALNKVCSTGRRQRSICKQLLKK Synthetic peptide Apoptotic inducing Cell viability assay U-937 Lymphoma cancer < 40% cell viability at 50 µM
dbacp04816 N29N PDEDAINNALNKVCSTGRRQRSICKQLLKK Synthetic peptide Apoptotic inducing Cell viability assay SNU-1 Gastric cancer < 100% cell viability at 5 µM
dbacp04817 N29N PDEDAINNALNKVCSTGRRQRSICKQLLKK Synthetic peptide Apoptotic inducing Cell viability assay SNU-1 Gastric cancer < 20% cell viability at 50 µM
dbacp04818 N29N PDEDAINNALNKVCSTGRRQRSICKQLLKK Synthetic peptide Apoptotic inducing Cell viability assay SW-480 Colon cancer MIC : 5 µM
dbacp05103 PA10 RQIKIWFQNRRMKWKKGGGGNNETTSIQIAGSLHHHHHH Synthetic construct Cell proliferation inhibition; Cell penetration; Apoptosis Cell viability assay MDA-MB231 Breast cancer MIC : 10 μM
dbacp05104 PA10 RQIKIWFQNRRMKWKKGGGGNNETTSIQIAGSLHHHHHH Synthetic construct Cell proliferation inhibition; Cell penetration; Apoptosis Cell viability assay HCC1806 Breast cancer MIC : 10 μM
dbacp05105 PA10 RQIKIWFQNRRMKWKKGGGGNNETTSIQIAGSLHHHHHH Synthetic construct Cell proliferation inhibition; Cell penetration; Apoptosis Cell viability assay 184B5 Breast cancer MIC : 10 μM
dbacp05106 PA10 RQIKIWFQNRRMKWKKGGGGNNETTSIQIAGSLHHHHHH Synthetic construct Cell proliferation inhibition; Cell penetration; Apoptosis Cell viability assay MCF10A Breast cancer MIC : 10 μM
dbacp05107 PA15 RQIKIWFQNRRMKWKKGGSLSAACHEQWSLGAQHHHHHH Synthetic construct Cell proliferation inhibition; Cell penetration; Apoptosis Cell viability assay MDA-MB231 Breast cancer MIC : 10 μM
dbacp05108 PA15 RQIKIWFQNRRMKWKKGGSLSAACHEQWSLGAQHHHHHH Synthetic construct Cell proliferation inhibition; Cell penetration; Apoptosis Cell viability assay HCC1806 Breast cancer MIC : 10 μM
dbacp05109 PA15 RQIKIWFQNRRMKWKKGGSLSAACHEQWSLGAQHHHHHH Synthetic construct Cell proliferation inhibition; Cell penetration; Apoptosis Cell viability assay 184B5 Breast cancer MIC : 10 μM
dbacp05110 PA15 RQIKIWFQNRRMKWKKGGSLSAACHEQWSLGAQHHHHHH Synthetic construct Cell proliferation inhibition; Cell penetration; Apoptosis Cell viability assay MCF10A Breast cancer MIC : 10 μM
dbacp05111 PA2 RQIKIWFQNRRMKWKKGGATRPRVDTQPELCGMHHHHHH Synthetic construct Cell proliferation inhibition; Cell penetration; Apoptosis Cell viability assay MDA-MB231 Breast cancer MIC : 10 μM
dbacp05112 PA2 RQIKIWFQNRRMKWKKGGATRPRVDTQPELCGMHHHHHH Synthetic construct Cell proliferation inhibition; Cell penetration; Apoptosis Cell viability assay HCC1806 Breast cancer MIC : 10 μM
dbacp05113 PA2 RQIKIWFQNRRMKWKKGGATRPRVDTQPELCGMHHHHHH Synthetic construct Cell proliferation inhibition; Cell penetration; Apoptosis Cell viability assay 184B5 Breast cancer MIC : 10 μM
dbacp05114 PA2 RQIKIWFQNRRMKWKKGGATRPRVDTQPELCGMHHHHHH Synthetic construct Cell proliferation inhibition; Cell penetration; Apoptosis Cell viability assay MCF10A Breast cancer MIC : 10 μM
dbacp05115 PA3 RQIKIWFQNRRMKWKKGGDCLCISRRARLLRATHHHHHH Synthetic construct Cell proliferation inhibition; Cell penetration; Apoptosis Cell viability assay MDA-MB231 Breast cancer MIC : 10 μM
dbacp05116 PA3 RQIKIWFQNRRMKWKKGGDCLCISRRARLLRATHHHHHH Synthetic construct Cell proliferation inhibition; Cell penetration; Apoptosis Cell viability assay HCC1806 Breast cancer MIC : 10 μM
dbacp05117 PA3 RQIKIWFQNRRMKWKKGGDCLCISRRARLLRATHHHHHH Synthetic construct Cell proliferation inhibition; Cell penetration; Apoptosis Cell viability assay 184B5 Breast cancer MIC : 10 μM
dbacp05118 PA3 RQIKIWFQNRRMKWKKGGDCLCISRRARLLRATHHHHHH Synthetic construct Cell proliferation inhibition; Cell penetration; Apoptosis Cell viability assay MCF10A Breast cancer MIC : 10 μM
dbacp05119 PA38 RQIKIWFQNRRMKWKKGGKYNGRFTTHHLLHLLNHHHHHH Synthetic construct Cell proliferation inhibition; Cell penetration; Apoptosis Cell viability assay MDA-MB231 Breast cancer MIC : 10 μM
dbacp05120 PA38 RQIKIWFQNRRMKWKKGGKYNGRFTTHHLLHLLNHHHHHH Synthetic construct Cell proliferation inhibition; Cell penetration; Apoptosis Cell viability assay HCC1806 Breast cancer MIC : 10 μM
dbacp05121 PA38 RQIKIWFQNRRMKWKKGGKYNGRFTTHHLLHLLNHHHHHH Synthetic construct Cell proliferation inhibition; Cell penetration; Apoptosis Cell viability assay 184B5 Breast cancer MIC : 10 μM
dbacp05122 PA38 RQIKIWFQNRRMKWKKGGKYNGRFTTHHLLHLLNHHHHHH Synthetic construct Cell proliferation inhibition; Cell penetration; Apoptosis Cell viability assay MCF10A Breast cancer MIC : 10 μM
dbacp05123 PA49 RQIKIWFQNRRMKWKKGGAGVYTFLVGADNRGWEHHHHHH Synthetic construct Cell proliferation inhibition; Cell penetration; Apoptosis Cell viability assay MDA-MB231 Breast cancer MIC : 10 μM
dbacp05124 PA49 RQIKIWFQNRRMKWKKGGAGVYTFLVGADNRGWEHHHHHH Synthetic construct Cell proliferation inhibition; Cell penetration; Apoptosis Cell viability assay HCC1806 Breast cancer MIC : 10 μM
dbacp05125 PA49 RQIKIWFQNRRMKWKKGGAGVYTFLVGADNRGWEHHHHHH Synthetic construct Cell proliferation inhibition; Cell penetration; Apoptosis Cell viability assay 184B5 Breast cancer MIC : 10 μM
dbacp05126 PA49 RQIKIWFQNRRMKWKKGGAGVYTFLVGADNRGWEHHHHHH Synthetic construct Cell proliferation inhibition; Cell penetration; Apoptosis Cell viability assay MCF10A Breast cancer MIC : 10 μM
dbacp05371 peptide containing the BH3 regions from Bad NLWAAQRYGRELRRMSDEFEGSFKGL BH3-only, Sensizers (BAD, HRK, Noxa) Inducing apoptosis Cell viability assay FL5.12 Not specified Not found
dbacp05372 peptide containing the BH3 regions from Bad(145-160) QRYGRELRRMSDEFEG BH3-only, Sensizers (BAD, HRK, Noxa) Inducing apoptosis Cell viability assay FL5.12 Not specified Not found
dbacp05373 peptide containing the BH3 regions from Bak(72-87) GQVGRQLAIIGDDINR Effectors (BAK, BAX) Inducing apoptosis Cell viability assay FL5.12 Not specified Not found
dbacp05374 peptide containing the BH3 regions from Bak(72-94) GQVGRQLAIIGDDINRRYDSEFQ Effectors (BAK, BAX) Inducing apoptosis Cell viability assay FL5.12 Not specified Not found
dbacp05375 peptide containing the BH3 regions from Bax(57-72) KKLSECLKRIGDELDS Effectors (BAK, BAX) Inducing apoptosis Cell viability assay FL5.12 Not specified Not found
dbacp05508 Phylloseptin-1.1TR (PLS-1.1TR) FLSLIPKIAGGIASLVKNL Trinidad leaf frog Cytotoxic Cell viability assay A549 Not found LC50 : 20 μM
dbacp05509 Phylloseptin-1.1TR (PLS-1.1TR) FLSLIPKIAGGIASLVKNL Trinidad leaf frog Cytotoxic Cell viability assay MDA‐MB231 Not found LC50 : 20 μM
dbacp05510 Phylloseptin-1.1TR (PLS-1.1TR) FLSLIPKIAGGIASLVKNL Trinidad leaf frog Cytotoxic Cell viability assay HT‐29 Not found LC50 : 34 μM
dbacp05511 Phylloseptin-1.2TR (PLS-1.2TR) (Phylloseptin-1.3TR) FLSLIPKIAGGIASLVKDL Trinidad leaf frog Cytotoxic Cell viability assay A549 Not found LC50 : 55 μM
dbacp05512 Phylloseptin-1.2TR (PLS-1.2TR) (Phylloseptin-1.3TR) FLSLIPKIAGGIASLVKDL Trinidad leaf frog Cytotoxic Cell viability assay MDA‐MB231 Not found Not found
dbacp05513 Phylloseptin-1.2TR (PLS-1.2TR) (Phylloseptin-1.3TR) FLSLIPKIAGGIASLVKDL Trinidad leaf frog Cytotoxic Cell viability assay HT‐29 Not found Not found
dbacp05514 Phylloseptin-2.1TR (PLS-2.1TR) (Phylloseptin-2.2TR) FLSLIPHIATGIAALAKHL Trinidad leaf frog Cytotoxic Cell viability assay A549 Not found LC50 : 20 μM
dbacp05515 Phylloseptin-2.1TR (PLS-2.1TR) (Phylloseptin-2.2TR) FLSLIPHIATGIAALAKHL Trinidad leaf frog Cytotoxic Cell viability assay MDA‐MB231 Not found LC50 : 24 μM
dbacp05516 Phylloseptin-2.1TR (PLS-2.1TR) (Phylloseptin-2.2TR) FLSLIPHIATGIAALAKHL Trinidad leaf frog Cytotoxic Cell viability assay HT‐29 Not found LC50 : 38 μM
dbacp05517 Phylloseptin-3.1TR (PLS-3.1TR) (Phylloseptin-3.3TR) FFSMIPKIATGIASLVKNL Trinidad leaf frog Cytotoxic Cell viability assay A549 cells Not found LC50 : 18 μmolL−1
dbacp05518 Phylloseptin-3.1TR (PLS-3.1TR) (Phylloseptin-3.3TR) FFSMIPKIATGIASLVKNL Trinidad leaf frog Cytotoxic Cell viability assay MDA‐MB231 Not found LC50 : 18 μmolL−1
dbacp05519 Phylloseptin-3.1TR (PLS-3.1TR) (Phylloseptin-3.3TR) FFSMIPKIATGIASLVKNL Trinidad leaf frog Cytotoxic Cell viability assay HT‐29 Not found LC50 : 27 μmolL−1
dbacp05520 Phylloseptin-3.2TR (PLS-3.2TR) FFSMIPKIATGIASLVKDL Trinidad leaf frog Cytotoxic Cell viability assay A549 Not found LC50 : 65 μM
dbacp05521 Phylloseptin-3.2TR (PLS-3.2TR) FFSMIPKIATGIASLVKDL Trinidad leaf frog Cytotoxic Cell viability assay MDA‐MB231 Not found Not found
dbacp05522 Phylloseptin-3.2TR (PLS-3.2TR) FFSMIPKIATGIASLVKDL Trinidad leaf frog Cytotoxic Cell viability assay HT‐29 Not found Not found
dbacp05525 Phylloseptin-PBa1 FLSLIPHIASGIASLVKNF Burmeister's leaf frog, Brazil, South America Disruption of cell membranes MTT cell viability assay U145 Prostate cancer IC50 : approx. 0.29 µM
dbacp05526 Phylloseptin-PBa1 FLSLIPHIASGIASLVKNF Burmeister's leaf frog, Brazil, South America Disruption of cell membranes MTT cell viability assay PC3 Prostate cancer IC50 : approx. 0.29 µM
dbacp05527 Phylloseptin-PBa1 FLSLIPHIASGIASLVKNF Burmeister's leaf frog, Brazil, South America Disruption of cell membranes MTT cell viability assay LNCaP Prostate cancer IC50 : approx. 0.29 µM
dbacp05528 Phylloseptin-PBa1 FLSLIPHIASGIASLVKNF Burmeister's leaf frog, Brazil, South America Disruption of cell membranes MTT cell viability assay H838 Lung cancer IC50 : approx. 0.29 µM
dbacp05529 Phylloseptin-PBa1 FLSLIPHIASGIASLVKNF Burmeister's leaf frog, Brazil, South America Disruption of cell membranes MTT cell viability assay H460 Lung cancer IC50 : approx. 0.29 µM
dbacp05530 Phylloseptin-PBa1 FLSLIPHIASGIASLVKNF Burmeister's leaf frog, Brazil, South America Disruption of cell membranes MTT cell viability assay H23 Lung cancer IC50 : approx. 0.29 µM
dbacp05531 Phylloseptin-PBa1 FLSLIPHIASGIASLVKNF Burmeister's leaf frog, Brazil, South America Disruption of cell membranes MTT cell viability assay H157 Lung cancer IC50 : approx. 0.29 µM
dbacp05532 Phylloseptin-PBa1 FLSLIPHIASGIASLVKNF Burmeister's leaf frog, Brazil, South America Disruption of cell membranes MTT cell viability assay MB231 Breast cancer IC50 : approx. 0.29 µM
dbacp05533 Phylloseptin-PBa1 FLSLIPHIASGIASLVKNF Burmeister's leaf frog, Brazil, South America Disruption of cell membranes MTT cell viability assay MB435s Breast cancer IC50 : approx. 0.29 µM
dbacp05534 Phylloseptin-PBa1 FLSLIPHIASGIASLVKNF Burmeister's leaf frog, Brazil, South America Disruption of cell membranes MTT cell viability assay MCF-7 Breast cancer IC50 : approx. 0.29 µM
dbacp05535 Phylloseptin-PBa1 FLSLIPHIASGIASLVKNF Burmeister's leaf frog, Brazil, South America Disruption of cell membranes MTT cell viability assay U251MG Neurospongioma IC50 : approx. 0.29 µM
dbacp05536 Phylloseptin-PBa2 FLSLLPHIASGIASLVSKF Burmeister's leaf frog, Brazil, South America Disruption of cell membranes MTT cell viability assay U145 Prostate cancer IC50 : approx. 0.50 µM
dbacp05537 Phylloseptin-PBa2 FLSLLPHIASGIASLVSKF Burmeister's leaf frog, Brazil, South America Disruption of cell membranes MTT cell viability assay PC3 Prostate cancer IC50 : approx. 0.50 µM
dbacp05538 Phylloseptin-PBa2 FLSLLPHIASGIASLVSKF Burmeister's leaf frog, Brazil, South America Disruption of cell membranes MTT cell viability assay LNCaP Prostate cancer IC50 : approx. 0.50 µM
dbacp05539 Phylloseptin-PBa2 FLSLLPHIASGIASLVSKF Burmeister's leaf frog, Brazil, South America Disruption of cell membranes MTT cell viability assay H838 Lung cancer IC50 : approx. 0.50 µM
dbacp05540 Phylloseptin-PBa2 FLSLLPHIASGIASLVSKF Burmeister's leaf frog, Brazil, South America Disruption of cell membranes MTT cell viability assay H460 Lung cancer IC50 : approx. 0.50 µM
dbacp05541 Phylloseptin-PBa2 FLSLLPHIASGIASLVSKF Burmeister's leaf frog, Brazil, South America Disruption of cell membranes MTT cell viability assay H23 Lung cancer IC50 : approx. 0.50 µM
dbacp05542 Phylloseptin-PBa2 FLSLLPHIASGIASLVSKF Burmeister's leaf frog, Brazil, South America Disruption of cell membranes MTT cell viability assay H157 Lung cancer IC50 : approx. 0.50 µM
dbacp05543 Phylloseptin-PBa2 FLSLLPHIASGIASLVSKF Burmeister's leaf frog, Brazil, South America Disruption of cell membranes MTT cell viability assay MB231 Breast cancer IC50 : approx. 0.50 µM
dbacp05544 Phylloseptin-PBa2 FLSLLPHIASGIASLVSKF Burmeister's leaf frog, Brazil, South America Disruption of cell membranes MTT cell viability assay MB435s Breast cancer IC50 : approx. 0.50 µM
dbacp05545 Phylloseptin-PBa2 FLSLLPHIASGIASLVSKF Burmeister's leaf frog, Brazil, South America Disruption of cell membranes MTT cell viability assay MCF-7 Breast cancer IC50 : approx. 0.50 µM
dbacp05546 Phylloseptin-PBa2 FLSLLPHIASGIASLVSKF Burmeister's leaf frog, Brazil, South America Disruption of cell membranes MTT cell viability assay U251MG neurospongioma IC50 : approx. 0.50 µM
dbacp05547 Phylloseptin-PHa FLSLIPAAISAVSALANHF Skin secretions, Orange-legged Leaf Frog, South America Membrane disruption MTT cell viability assay NCI-H157 Lung cancer IC50 : 14.10 μM
dbacp05554 Phylloseptin-PTa FLSLIPKIAGGIAALAKHL Skin secretions, the Brown-bellied Leaf Frog, South America Membrane disruption MTT Cell viability assay NCI-H157 Lung cancer IC50 : 6.73 μM
dbacp05596 Polyphemusin II RRWCFRVCYKGFCYRKCR-NH2 Atlantic horseshoe crab Induce necrotic cell death Cell viability assay K562 Human erythroleukemia EC50 : 22 μM
dbacp05676 Ps-1Pb IKIPSFFRNILKKVGKEAVSLIAGALKQS Merlin's dwarf gray frog Immunomodulatory properties Cytotoxicity assays, CellTiter-Glo Luminescent cell viability assay A549 Lung adenocarcinoma LC50 : < 12 μM
dbacp05677 Ps-1Pb IKIPSFFRNILKKVGKEAVSLIAGALKQS Merlin's dwarf gray frog Immunomodulatory properties Cytotoxicity assays, CellTiter-Glo Luminescent cell viability assay MDA-MB-231 Breast adenocarcinoma LC50 : < 12 μM
dbacp05678 Ps-1Pb IKIPSFFRNILKKVGKEAVSLIAGALKQS Merlin's dwarf gray frog Immunomodulatory properties Cytotoxicity assays, CellTiter-Glo Luminescent cell viability assay HT-29 Colorectal adenocarcinoma LC50 : < 12 μM
dbacp05679 Ps-2Pa GIFPIFAKLLGKVIKVASSLISKGRTE Merlin's dwarf gray frog Immunomodulatory properties Cytotoxicity assays, CellTiter-Glo Luminescent cell viability assay A549 Lung adenocarcinoma LC50 : < 12 μM
dbacp05680 Ps-2Pa GIFPIFAKLLGKVIKVASSLISKGRTE Merlin's dwarf gray frog Immunomodulatory properties Cytotoxicity assays, CellTiter-Glo Luminescent cell viability assay MDA-MB-231 Breast adenocarcinoma LC50 : < 12 μM
dbacp05681 Ps-2Pa GIFPIFAKLLGKVIKVASSLISKGRTE Merlin's dwarf gray frog Immunomodulatory properties Cytotoxicity assays, CellTiter-Glo Luminescent cell viability assay HT-29 Colorectal adenocarcinoma LC50 : < 12 μM
dbacp05696 Psychrophilin D (1) lw Blue or green mold Not specified Cell viability assay P-388 Leukemia cancer ID50 : 10.1 µg/ml
dbacp05901 Ranatuerin-2PLx GIMDTVKNAAKNLAGQLLDKLKCKITAC Gram-negative purple non-sulfur bacteria Inducing apoptosis MTT Cell viability assay and Lactate dehydrogenase (LDH) leakage assay H157 Lung IC50 : 5.90 µM
dbacp05902 Ranatuerin-2PLx GIMDTVKNAAKNLAGQLLDKLKCKITAC Gram-negative purple non-sulfur bacteria Inducing apoptosis MTT Cell viability assay and Lactate dehydrogenase (LDH) leakage assay MBD-MB-435s Melanocyte IC50 : 15.44 µM
dbacp05903 Ranatuerin-2PLx GIMDTVKNAAKNLAGQLLDKLKCKITAC Gram-negative purple non-sulfur bacteria Inducing apoptosis MTT Cell viability assay and Lactate dehydrogenase (LDH) leakage assay PC-3 Human prostate carcinoma IC50 : 5.79 µM
dbacp05904 Ranatuerin-2PLx GIMDTVKNAAKNLAGQLLDKLKCKITAC Gram-negative purple non-sulfur bacteria Inducing apoptosis MTT Cell viability assay and Lactate dehydrogenase (LDH) leakage assay U251-MG Human glioblastoma astrocytoma IC50 : 16.14 µm
dbacp05905 Ranatuerin-2PLx GIMDTVKNAAKNLAGQLLDKLKCKITAC Gram-negative purple non-sulfur bacteria Inducing apoptosis MTT Cell viability assay and Lactate dehydrogenase (LDH) leakage assay MCF-7 Human breast cancer IC50 : 20.19 µM
dbacp05906 Ranatuerin-2PLx GIMDTVKNAAKNLAGQLLDKLKCSITAC Skin secretions, the pickerel frog, North America Inducing apoptosis MTT Cell viability assay and Lactate dehydrogenase (LDH) leakage assay H157 Lung cancer IC50 : 5.90 µM
dbacp05907 Ranatuerin-2PLx GIMDTVKNAAKNLAGQLLDKLKCSITAC Skin secretions, the pickerel frog, North America Inducing apoptosis MTT Cell viability assay and Lactate dehydrogenase (LDH) leakage assay MDA-MB-435S Breast cancer IC50 : 15.44 µM
dbacp05908 Ranatuerin-2PLx GIMDTVKNAAKNLAGQLLDKLKCSITAC Skin secretions, the pickerel frog, North America Inducing apoptosis MTT Cell viability assay and Lactate dehydrogenase (LDH) leakage assay PC-3 Human prostate carcinoma IC50 : 5.79 µM
dbacp05909 Ranatuerin-2PLx GIMDTVKNAAKNLAGQLLDKLKCSITAC Skin secretions, the pickerel frog, North America Inducing apoptosis MTT Cell viability assay and Lactate dehydrogenase (LDH) leakage assay U251-MG Glioma IC50 : 16.14 µM
dbacp05910 Ranatuerin-2PLx GIMDTVKNAAKNLAGQLLDKLKCSITAC Skin secretions, the pickerel frog, North America Inducing apoptosis MTT Cell viability assay and Lactate dehydrogenase (LDH) leakage assay MCF-7 Breast cancer IC50 : 20.19 µM
dbacp05911 Ranatuerin-2PLx GIMDTVKNAAKNLAGQLLDKLKCSITAC Skin secretions, the pickerel frog, North America Inducing apoptosis MTT Cell viability assay and Lactate dehydrogenase (LDH) leakage assay HMEC-1 Glioma IC50 : 79.50 µM
dbacp06023 Sansalv amide A NA Synthetic Peptide Apoptosis Cell viability assay S2-13 Pancreatic cancer EC50 : 7.5 µM
dbacp06326 Transactivator of transcript-DV1-Bcl-2, AT-DV1-BH3 RRRQRRKKRGGGGLGASWHRPDK Transactivator of transcript-DV1-Bcl-2 TAT-DV1-BH3 Apoptosis inducing Cell viability assay, Transwell invasion assay MDA-MB-231 Breast cancer Not specified
dbacp06327 Transactivator of transcript-DV1-Bcl-2, AT-DV1-BH3 RRRQRRKKRGGGGLGASWHRPDK Transactivator of transcript-DV1-Bcl-2 TAT-DV1-BH4 Apoptosis inducing Cell viability assay, Transwell invasion assay MCF-7 Breast cancer Not specified
dbacp06328 Transactivator of transcript-DV1-Bcl-2, AT-DV1-BH3 RRRQRRKKRGGGGLGASWHRPDK Transactivator of transcript-DV1-Bcl-2 TAT-DV1-BH5 Apoptosis inducing Cell viability assay, Transwell invasion assay HEK-293 Kidney cancer Not specified
dbacp06388 Turgencin B GIKEML_CnMACAQTVC_KKSGGPLCDTCQAACKALG-NH2 Tunicate Disruption of cell membranes Human cell viability assay A2058 Melanoma cancer IC50 : 4.1μM
dbacp06389 Turgencin A GPKTKAACKMACKLATCGKKPGGWKCKLCELGCDAV Tunicate Disruption of cell membranes Human cell viability assay A2058 Melanoma cancer IC50 : 1.4 μM
dbacp06390 Turgencin A GPKTKAACKMACKLATCGKKPGGWKCKLCELGCDAV-NH2 Tunicate Disruption of cell membranes Human cell viability assay A2058 Melanoma cancer IC50 : 1.4 μM
dbacp06391 Turgencin A GPKTKAACKMACKLATCGKKPGGWKCKLCELGCDAV Tunicate Disruption of cell membranes Human cell viability assay A2058 Melanoma cancer IC50 : 1.4 μM
dbacp06392 Turgencin B GIKEMLCnMACAQTVCKKSGGPLCDTCQAACKALG Tunicate Disruption of cell membranes Human cell viability assay A2059 Melanoma cancer IC50 : 4.1 μM
dbacp06393 Turgencin B GIKEMLCnMACAQTVCKKSGGPLCDTCQAACKALG Tunicate Disruption of cell membranes Human cell viability assay A2059 Melanoma cancer IC50 : 4.1 μM
dbacp06651 LUNA18 Not Available Synthetic Not available CellTiter-Glo Cell Viability assay NCI-H2122 NSCLC IC50 = 1.4 ± 0.3 nmol/L
dbacp06652 LUNA18 Not Available Synthetic Not available CellTiter-Glo Cell Viability assay MiaPaCa.2 Pancreatic Cancer IC50 = 1.4 ± 0.2 nmol/L
dbacp06653 LUNA18 Not Available Synthetic Not available CellTiter-Glo Cell Viability assay NCI-H441 NSCLC IC50 = 2.9 ± 0.7 nmol/L
dbacp06654 LUNA18 Not Available Synthetic Not available CellTiter-Glo Cell Viability assay LS 180 Colon Cancer IC50 = 2.7 ± 0.4 nmol/L
dbacp06655 LUNA18 Not Available Synthetic Not available CellTiter-Glo Cell Viability assay GSU Stomach Cancer IC50 = 0.17 ± 0.02 nmol/L
dbacp06763 M1-21 rrrqrrkkrg-QTQPRLGPPQTPAGGCSILIF Synthetic FOXM1 inhibitor Cell Viability assay MDA-MB-231 Breast Cancer IC50 = 24.25 µM
dbacp06764 M1-21 rrrqrrkkrg-QTQPRLGPPQTPAGGCSILIF Synthetic FOXM1 inhibitor Cell Viability assay 5637 Bladder cancer IC50 = 9.33 µM
dbacp06765 M1-21 rrrqrrkkrg-QTQPRLGPPQTPAGGCSILIF Synthetic FOXM1 inhibitor Cell Viability assay HeLa Cervical Cancer IC50 = 31.83 µM
dbacp06766 M1-21 rrrqrrkkrg-QTQPRLGPPQTPAGGCSILIF Synthetic FOXM1 inhibitor Cell Viability assay 786-0 Renal Cancer IC50 = 13.5 µM
dbacp06767 M1-21 rrrqrrkkrg-QTQPRLGPPQTPAGGCSILIF Synthetic FOXM1 inhibitor Cell Viability assay HCT-116 Colon Cancer IC50 = 9.08 µM
dbacp06768 M1-21 rrrqrrkkrg-QTQPRLGPPQTPAGGCSILIF Synthetic FOXM1 inhibitor Cell Viability assay A-549 Lung Cancer IC50 = 22.00 µM
dbacp06769 M1-21 rrrqrrkkrg-QTQPRLGPPQTPAGGCSILIF Synthetic FOXM1 inhibitor Cell Viability assay U-251 BrainTumor IC50 = 18.17 µM
dbacp06770 M1-21 rrrqrrkkrg-QTQPRLGPPQTPAGGCSILIF Synthetic FOXM1 inhibitor Cell Viability assay ZR-75-30 Breast Cancer IC50 = 12.92 µM
dbacp06852 WP1 RLLRLMRLRMLLRM Derived from RLL peptide Apoptosis inducing Cell Viability assay Huh-7 Liver Cancer IC50 = 43.74 ± 5.4 μM
dbacp06853 WP1 RLLRLMRLRMLLRM Derived from RLL peptide Apoptosis inducing Cell Viability assay HepG-2 Liver Cancer IC50 = 52.23 ± 0.9 μM
dbacp06854 WP1 RLLRLMRLRMLLRM Derived from RLL peptide Apoptosis inducing Cell Viability assay HT-29 Colon Cancer IC50 = 54.6 ± 2.1 μM
dbacp06856 WP2 RLLRLLRLRRLLRL Derived from RLL peptide Apoptosis inducing Cell Viability assay Huh-7 Liver Cancer IC50 = 28.12 ± 1.5 μM
dbacp06857 WP2 RLLRLLRLRRLLRL Derived from RLL peptide Apoptosis inducing Cell Viability assay HepG-2 Liver Cancer IC50 = 34.05 ± 0.53 μM
dbacp06858 WP2 RLLRLLRLRRLLRL Derived from RLL peptide Apoptosis inducing Cell Viability assay HT-29 Colon Cancer IC50 = 42.6 ± 4.0 μM
dbacp06979 GV1001 EARPALLTSRLRFIPK Human telomerase reverse transcriptase (hTERT) Inhibition of angiogenesis Cell Viability assay A-549 Lung Cancer Graph Fig 2A
dbacp07986 SmacN7-Arg8 fused peptide P4 Ahx-AVPIAQK(KRRRRRRRRRE) Synthetic Apoptosis inducing Cell Titer Blue Cell Viability assay U-266 Skin Cancer Cell viability < 50% at 50 μM
dbacp07987 SmacN7-Arg8 fused peptide P5 Ahx-(KAVPIAQKE)RRRRRRRR Synthetic Apoptosis inducing Cell Titer Blue Cell Viability assay U-266 Skin Cancer Cell viability < 50% at 50 μM
dbacp07988 SmacN7-Arg8 fused peptide P7 Ahx-(KAVPIAQKE)GG(KRRRRRRRRE) Synthetic Apoptosis inducing Cell Titer Blue Cell Viability assay U-266 Skin Cancer Cell viability < 50% at 50 μM