159 result(s) have been found!
| Accession | Name | Sequence | Source/Organism | Mechanism | Assay Type | Cell Line | Cancer Type | Activity |
|---|---|---|---|---|---|---|---|---|
| dbacp01174 | AP | ACDCRGDCFCGGGGIVRRADRAAVP | Endostatin derived synthetic peptide | Necrosis; Antiangiogenesis | MTT/MTS assay | BAE | Tumor | 50% inhibition at 2.5 µg/ml |
| dbacp01175 | AP | ACDCRGDCFCGGGGIVRRADRAAVP | Endostatin derived synthetic peptide | Necrosis; Antiangiogenesis | MTT/MTS assay | BAE | Tumor | 40% inhibition at 5 µg/ml |
| dbacp01176 | AP | ACDCRGDCFCGGGGIVRRADRAAVP | Endostatin derived synthetic peptide | Necrosis; Antiangiogenesis | MTT/MTS assay | BAE | Tumor | 75% inhibition at 10 µg/ml |
| dbacp01177 | AP(O) | ACDCRGDCFCGGGGIVRRADRAAVP | Endostatin derived synthetic peptide | Necrosis; Antiangiogenesis | MTT/MTS assay | BAE | Tumor | 40% inhibition at 2.5 µg/ml |
| dbacp01178 | AP(O) | ACDCRGDCFCGGGGIVRRADRAAVP | Endostatin derived synthetic peptide | Necrosis; Antiangiogenesis | MTT/MTS assay | BAE | Tumor | 42% inhibition at 5 µg/ml |
| dbacp01179 | AP(O) | ACDCRGDCFCGGGGIVRRADRAAVP | Endostatin derived synthetic peptide | Necrosis; Antiangiogenesis | MTT/MTS assay | BAE | Tumor | 52% inhibition at 10 µg/ml |
| dbacp01987 | Buforin 2 | TRSSRAGLQFPVGRVHRLLRK | Asiatic toad | Disruption of electric potential of the cell membrane; Necrosis, Membranolytic activity leading to apoptosis | MTT/MTS assay | U-937 | Lymphoma cancer | IC50 : 90-95 µg/ml |
| dbacp02105 | Buforin2 | TRSSRAGLQFPVGRVHRLLRK | Asiatic toad | Disruption of electric potential of the cell membrane; Necrosis; Membranolytic activity leading to apoptosis | MTT/MTS assay | U-937 | Lymphoma cancer | 5% Cytotoxicity at 0.5 µg/ml |
| dbacp02168 | C7A | KILRGVAKKIMRTFLRRISKDILTGKK | NK-2 peptide based derivatives | Apoptosis; Necrosis | Cell viability assay | HCT-116 | Colorectal cancer | Cell viability : >50% at 25μM approx. |
| dbacp02169 | C7A | KILRGVAKKIMRTFLRRISKDILTGKK | NK-2 peptide based derivatives | Apoptosis; Necrosis | Cell viability assay | HROC24 | Colorectal cancer | Cell viability : >60% at 25μM approx. |
| dbacp02170 | C7A | KILRGVAKKIMRTFLRRISKDILTGKK | NK-2 peptide based derivatives | Apoptosis; Necrosis | Cell viability assay | HROC40 | Colorectal cancer | Cell viability : >60% at 25μM approx. |
| dbacp02171 | C7A | KILRGVAKKIMRTFLRRISKDILTGKK | NK-2 peptide based derivatives | Apoptosis; Necrosis | Cell viability assay | HROC60 | Colorectal cancer | Cell viability : >50% at 25μM approx. |
| dbacp02172 | C7A | KILRGVAKKIMRTFLRRISKDILTGKK | NK-2 peptide based derivatives | Apoptosis; Necrosis | Cell viability assay | HROC32 | Colorectal cancer | Cell viability : >60% at 25μM approx. |
| dbacp02173 | C7A | KILRGVAKKIMRTFLRRISKDILTGKK | NK-2 peptide based derivatives | Apoptosis; Necrosis | Cell viability assay | HCT-116 | Colorectal cancer | Cell viability : >40% at 12.5μM approx. |
| dbacp02174 | C7A | KILRGVAKKIMRTFLRRISKDILTGKK | NK-2 peptide based derivatives | Apoptosis; Necrosis | Cell viability assay | HROC18 | Colorectal cancer | Cell viability : >55% at 12.5μM approx. |
| dbacp02175 | C7A | KILRGVAKKIMRTFLRRISKDILTGKK | NK-2 peptide based derivatives | Apoptosis; Necrosis | Cell viability assay | HROC24 | Colorectal cancer | Cell viability : >55% at 12.5μM approx. |
| dbacp02176 | C7A | KILRGVAKKIMRTFLRRISKDILTGKK | NK-2 peptide based derivatives | Apoptosis; Necrosis | Cell viability assay | HROC40 | Colorectal cancer | Cell viability : >45% at 12.5μM approx. |
| dbacp02177 | C7A | KILRGVAKKIMRTFLRRISKDILTGKK | NK-2 peptide based derivatives | Apoptosis; Necrosis | Cell viability assay | HROC60 | Colorectal cancer | Cell viability : >70% at 12.5μM approx. |
| dbacp02178 | C7A | KILRGVAKKIMRTFLRRISKDILTGKK | NK-2 peptide based derivatives | Apoptosis; Necrosis | Cell viability assay | HROC113 | Colorectal cancer | Cell viability : >80% at 12.5μM approx. |
| dbacp02179 | C7A | KILRGVAKKIMRTFLRRISKDILTGKK | NK-2 peptide based derivatives | Apoptosis; Necrosis | Cell viability assay | HROC32 | Colorectal cancer | Cell viability : >55% at 12.5μM approx. |
| dbacp02180 | C7A | KILRGVAKKIMRTFLRRISKDILTGKK | NK-2 peptide based derivatives | Apoptosis; Necrosis | Cell viability assay | HROC107 | Colorectal cancer | Cell viability : >50% at 12.5μM approx. |
| dbacp02189 | C7A-D21K | KILRGVAKKIMRTFLRRISKKILTGKK | NK-2 peptide based derivatives | Apoptosis; Necrosis | Cell viability assay | HCT-116 | Colorectal cancer | Cell viability : 50% at 12.5μM approx. |
| dbacp02190 | C7A-D21K | KILRGVAKKIMRTFLRRISKKILTGKK | NK-2 peptide based derivatives | Apoptosis; Necrosis | Cell viability assay | HROC24 | Colorectal cancer | Cell viability : >50% at 25μM approx. |
| dbacp02191 | C7A-D21K | KILRGVAKKIMRTFLRRISKKILTGKK | NK-2 peptide based derivatives | Apoptosis; Necrosis | Cell viability assay | HROC40 | Colorectal cancer | Cell viability : >50% at 25μM approx.. |
| dbacp02192 | C7A-D21K | KILRGVAKKIMRTFLRRISKKILTGKK | NK-2 peptide based derivatives | Apoptosis; Necrosis | Cell viability assay | HROC60 | Colorectal cancer | Cell viability : >50% at 25μM approx. |
| dbacp02193 | C7A-D21K | KILRGVAKKIMRTFLRRISKKILTGKK | NK-2 peptide based derivatives | Apoptosis; Necrosis | Cell viability assay | HROC32 | Colorectal cancer | Cell viability : 50% at 12.5μM approx. |
| dbacp02194 | C7A-D21K | KILRGVAKKIMRTFLRRISKKILTGKK | NK-2 peptide based derivatives | Apoptosis; Necrosis | Cell viability assay | HCT-116 | Colorectal cancer | Cell viability : >40% at 12.5μM approx. |
| dbacp02195 | C7A-D21K | KILRGVAKKIMRTFLRRISKKILTGKK | NK-2 peptide based derivatives | Apoptosis; Necrosis | Cell viability assay | HROC18 | Colorectal cancer | Cell viability : >55% at 12.5μM approx. |
| dbacp02196 | C7A-D21K | KILRGVAKKIMRTFLRRISKKILTGKK | NK-2 peptide based derivatives | Apoptosis; Necrosis | Cell viability assay | HROC24 | Colorectal cancer | Cell viability : >55% at 12.5μM approx. |
| dbacp02197 | C7A-D21K | KILRGVAKKIMRTFLRRISKKILTGKK | NK-2 peptide based derivatives | Apoptosis; Necrosis | Cell viability assay | HROC40 | Colorectal cancer | Cell viability : >80% at 12.5μM approx. |
| dbacp02198 | C7A-D21K | KILRGVAKKIMRTFLRRISKKILTGKK | NK-2 peptide based derivatives | Apoptosis; Necrosis | Cell viability assay | HROC60 | Colorectal cancer | Cell viability : >60% at 12.5μM approx. |
| dbacp02199 | C7A-D21K | KILRGVAKKIMRTFLRRISKKILTGKK | NK-2 peptide based derivatives | Apoptosis; Necrosis | Cell viability assay | HROC113 | Colorectal cancer | Cell viability : >65% at 12.5μM approx. |
| dbacp02200 | C7A-D21K | KILRGVAKKIMRTFLRRISKKILTGKK | NK-2 peptide based derivatives | Apoptosis; Necrosis | Cell viability assay | HROC32 | Colorectal cancer | Cell viability : >80% at 12.5μM approx. |
| dbacp02201 | C7A-D21K | KILRGVAKKIMRTFLRRISKKILTGKK | NK-2 peptide based derivatives | Apoptosis; Necrosis | Cell viability assay | HROC107 | Colorectal cancer | Cell viability : >65% at 12.5μM approx. |
| dbacp02209 | C7A-Δ | KILRGVAKKIMRTFLRRISKDILTGKK | NK-2 peptide based derivatives | Apoptosis; Necrosis | Cell viability assay | HCT-116 | Colorectal cancer | Cell viability : >50% at 12.5μM approx. |
| dbacp02210 | C7A-Δ | KILRGVAKKIMRTFLRRISKDILTGKK | NK-2 peptide based derivatives | Apoptosis; Necrosis | Cell viability assay | HROC24 | Colorectal cancer | Cell viability : >60% at 25μM approx. |
| dbacp02211 | C7A-Δ | KILRGVAKKIMRTFLRRISKDILTGKK | NK-2 peptide based derivatives | Apoptosis; Necrosis | Cell viability assay | HROC40 | Colorectal cancer | Cell viability : >50% at 25μM approx. |
| dbacp02212 | C7A-Δ | KILRGVAKKIMRTFLRRISKDILTGKK | NK-2 peptide based derivatives | Apoptosis; Necrosis | Cell viability assay | HROC60 | Colorectal cancer | Cell viability : >50% at 25μM approx. |
| dbacp02213 | C7A-Δ | KILRGVAKKIMRTFLRRISKDILTGKK | NK-2 peptide based derivatives | Apoptosis; Necrosis | Cell viability assay | HROC32 | Colorectal cancer | Cell viability : 50% at 12.5μM approx. |
| dbacp02214 | C7A-Δ | KILRGVAKKIMRTFLRRISKDILTGKK | NK-2 peptide based derivatives | Apoptosis; Necrosis | Cell viability assay | HCT-116 | Colorectal cancer | Cell viability : >50% at 12.5μM approx. |
| dbacp02215 | C7A-Δ | KILRGVAKKIMRTFLRRISKDILTGKK | NK-2 peptide based derivatives | Apoptosis; Necrosis | Cell viability assay | HROC18 | Colorectal cancer | Cell viability : >75% at 12.5μM approx. |
| dbacp02216 | C7A-Δ | KILRGVAKKIMRTFLRRISKDILTGKK | NK-2 peptide based derivatives | Apoptosis; Necrosis | Cell viability assay | HROC24 | Colorectal cancer | Cell viability : >70% at 12.5μM approx. |
| dbacp02217 | C7A-Δ | KILRGVAKKIMRTFLRRISKDILTGKK | NK-2 peptide based derivatives | Apoptosis; Necrosis | Cell viability assay | HROC40 | Colorectal cancer | Cell viability : >85% at 12.5μM approx. |
| dbacp02218 | C7A-Δ | KILRGVAKKIMRTFLRRISKDILTGKK | NK-2 peptide based derivatives | Apoptosis; Necrosis | Cell viability assay | HROC60 | Colorectal cancer | Cell viability : >70% at 12.5μM approx. |
| dbacp02219 | C7A-Δ | KILRGVAKKIMRTFLRRISKDILTGKK | NK-2 peptide based derivatives | Apoptosis; Necrosis | Cell viability assay | HROC113 | Colorectal cancer | Cell viability : >70% at 12.5μM approx. |
| dbacp02220 | C7A-Δ | KILRGVAKKIMRTFLRRISKDILTGKK | NK-2 peptide based derivatives | Apoptosis; Necrosis | Cell viability assay | HROC32 | Colorectal cancer | Cell viability : >85% at 12.5μM approx. |
| dbacp02221 | C7A-Δ | KILRGVAKKIMRTFLRRISKDILTGKK | NK-2 peptide based derivatives | Apoptosis; Necrosis | Cell viability assay | HROC107 | Colorectal cancer | Cell viability : >70% at 12.5μM approx. |
| dbacp02338 | Cecropin A | KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK | Isolated from the giant silk moth, cecropia moth | Membrane damage; Apoptotic cell death; Necrosis | MTT/MTS assay | SCC12 | Skin cancer | IC50 : 1 µM |
| dbacp02339 | Cecropin A | KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK | Isolated from the giant silk moth, cecropia moth | Membrane damage; Apoptotic cell death; Necrosis | MTT/MTS assay | SCC25 | Skin cancer | IC50 : 2.2 µM |
| dbacp02340 | Cecropin A | KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK | Isolated from the giant silk moth, cecropia moth | Membrane damage; Apoptotic cell death; Necrosis | Cell viability assay | SCC25 | Skin cancer | 0.6 ± 0.6% cell growth inhibition at 10 µM |
| dbacp02341 | Cecropin A | KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK | Isolated from the giant silk moth, cecropia moth | Membrane damage; Apoptotic cell death; Necrosis | Cell viability assay | SCC25 | Skin cancer | 107.0 ± 5.0% cell growth inhibition at 1 µM |
| dbacp02466 | ChBac3.4 | RFRLPFRRPPIRIHPPPFYPPFRRFL | Goat | Cell necrosis; Inhibiting processes of protein synthesis; Damaging the mitochondrial membrane | TUNEL assay, Reactive oxygen intermediates (ROS) assay | A375 cells | Melanoma | Not found |
| dbacp02467 | ChBac3.4 | RFRLPFRRPPIRIHPPPFYPPFRRFL | Goat | Cell necrosis; Inhibiting processes of protein synthesis; Damaging the mitochondrial membrane | TUNEL assay, Reactive oxygen intermediates (ROS) assay | Not specified | Pancreatic cancer | Not found |
| dbacp02468 | ChBac3.4 | RFRLPFRRPPIRIHPPPFYPPFRRFL | Goat | Cell necrosis; Inhibiting processes of protein synthesis; Damaging the mitochondrial membrane | TUNEL assay, Reactive oxygen intermediates (ROS) assay | Not specified | Bladder cancer | Not found |
| dbacp02469 | ChBac3.4 | RFRLPFRRPPIRIHPPPFYPPFRRFL | Goat | Cell necrosis; Inhibiting processes of protein synthesis; Damaging the mitochondrial membrane | TUNEL assay, Reactive oxygen intermediates (ROS) assay | Not specified | Breast cancer | Not found |
| dbacp02470 | ChBac3.4 | RFRLPFRRPPIRIHPPPFYPPFRRFL | Goat | Cell necrosis; Inhibiting processes of protein synthesis; Damaging the mitochondrial membrane | TUNEL assay, Reactive oxygen intermediates (ROS) assay | Not specified | Ovarian cancer | Not found |
| dbacp02487 | Citropin 1.1 | GLFDVIKKVASVIGGL | Australian blue mountains tree frog | Disruption of electric potential of the cell membrane; Necrosis; Membranolytic activity leading to apoptosis | MTT/MTS assay | U-938 | Lymphoma cancer | IC50 :40 µg/ml |
| dbacp02512 | Citropin1.1 | GLFDVIKKVASVIGGL | Australian blue mountains tree frog | Disruption of electric potential of the cell membrane; Necrosis; Membranolytic activity leading to apoptosis | MTT/MTS assay | U-937 | Lymphoma cancer | 60% Cytotoxicity at 0.5 µg/ml |
| dbacp02513 | Citropin1.1 | GLFDVIKKVASVIGGL | Australian blue mountains tree frog | Disruption of electric potential of the cell membrane; Necrosis; Membranolytic activity leading to apoptosis | MTT/MTS assay | U-937 | Lymphoma cancer | 60% Cytotoxicity at 0.5 µg/ml |
| dbacp02620 | D-K6L9 | LKlLKKLlkKLLkLL | Not found | Necrosis; Membrane disruption | Enzyme Immunoassay (EIA) | 22RV1 | Prostate cancer | LC50 : 6 µMol/L |
| dbacp02621 | D-K6L9 | LKlLKKLlkKLLkLL | Not found | Necrosis; Membrane disruption | Enzyme Immunoassay (EIA) | CL-1 | Lung cancer | LC50 : 3 µMol/L |
| dbacp02622 | D-K6L9 | LKlLKKLlkKLLkLL | Not found | Necrosis; Membrane disruption | Enzyme Immunoassay (EIA) | MB-231 | Prostate cancer | LC50 : 3 µMol/L |
| dbacp02637 | Decoralin | SLLSLIRKLI | Solitary eumenine wasp | Mediate necrosis | MTT assay | MCF-7 | Breast cancer | IC50 : 12.5 μmolL−1 |
| dbacp02640 | Defensin coprisin | MAKLIAFALVASLCLSMVLCNPLPEEVQEEGLVRQKRVTCDVLSFEAKGIAVNHSACALHCIALRKKGGSCQNGVCVCRN | Dung beetle | Induces apoptosis and necrosis | Radial diffusion assay, MIC assay | SNU-484 | Gastric cancer | MIC : ≤ 50 μM |
| dbacp02641 | Defensin coprisin | MAKLIAFALVASLCLSMVLCNPLPEEVQEEGLVRQKRVTCDVLSFEAKGIAVNHSACALHCIALRKKGGSCQNGVCVCRN | Dung beetle | Induces apoptosis and necrosis | Radial diffusion assay, MIC assay | SNU-601 | Gastric cancer | MIC : ≤ 50 μM |
| dbacp02642 | Defensin coprisin | MAKLIAFALVASLCLSMVLCNPLPEEVQEEGLVRQKRVTCDVLSFEAKGIAVNHSACALHCIALRKKGGSCQNGVCVCRN | Dung beetle | Induces apoptosis and necrosis | Radial diffusion assay, MIC assay | SNU-638 | Gastric cancer | MIC : ≤ 50 μM |
| dbacp02643 | Defensin coprisin | MAKLIAFALVASLCLSMVLCNPLPEEVQEEGLVRQKRVTCDVLSFEAKGIAVNHSACALHCIALRKKGGSCQNGVCVCRN | Dung beetle | Induces apoptosis and necrosis | Radial diffusion assay, MIC assay | SNU-668 | Gastric cancer | MIC : ≤ 50 μM |
| dbacp02646 | Demegen P-113 | AKRHHGYKRKFH | Thrush | Disruption of electric potential of the cell membrane; Necrosis; Membranolytic activity leading to apoptosis | MTT/MTS assay | U-939 | Lymphoma cancer | IC50 : 85-90 µg/ml |
| dbacp02647 | Demegen P-113 | AKRHHGYKRKFH | Amphibian skin peptide | Disruption of electric potential of the cell membrane; Necrosis; Membranolytic activity leading to apoptosis | MTT/MTS assay | U-937 | Lymphoma cancer | 15% Cytotoxicity at 0.5 µg/ml |
| dbacp02914 | ES-2 | IVRRADRAAVP | Endostatin derived synthetic peptide | Necrosis; Anti-angiogenesis | MTT/MTS assay | BAE | Tumor | 60% inhibition at 2.5µg/ml |
| dbacp02915 | ES-2 | IVRRADRAAVP | Endostatin derived synthetic peptide | Necrosis; Anti-angiogenesis | MTT/MTS assay | BAE | Tumor | 60% inhibition at 5µg/ml |
| dbacp02916 | ES-2 | IVRRADRAAVP | Endostatin derived synthetic peptide | Necrosis; Anti-angiogenesis | MTT/MTS assay | BAE | Tumor | 60% inhibition at 10µg/ml |
| dbacp02949 | Figainin 2 | FLGAILKIGHALAKTVLPMVTNAFKPKQ | Skin secretions, Chaco tree frog, South America | Cell membrane interaction; Necrosis; Apoptosis | MTT/MTS assay | B16F10 | Murien melanoma | IC50 : 12.8 µM |
| dbacp02950 | Figainin 2 | FLGAILKIGHALAKTVLPMVTNAFKPKQ | Skin secretions, Chaco tree frog, South America | Cell membrane interaction; Necrosis; Apoptosis | MTT/MTS assay | MCF-7 | Murien melanoma | IC50 : 15.3 µM |
| dbacp02951 | Figainin 2 | MAFLKKSLFLVLFLGIVSLSVCEEEKREGEEKEEKREEEEGKEENEDGNEEHKEKRFLGAILKIGHALAKTVLPMVTNAFKPKQ | Chaco tree frog | Necrosis; Apoptosis | MTT/MTS assay | B16F10 | Skin cancer | IC50 : 12.8 µM |
| dbacp02952 | Figainin 2 | MAFLKKSLFLVLFLGIVSLSVCEEEKREGEEKEEKREEEEGKEENEDGNEEHKEKRFLGAILKIGHALAKTVLPMVTNAFKPKQ | Chaco tree frog | Necrosis; Apoptosis | MTT/MTS assay | B16F10 | Breast cancer | IC50 : 12.8 µM |
| dbacp02953 | Figainin 2 | MAFLKKSLFLVLFLGIVSLSVCEEEKREGEEKEEKREEEEGKEENEDGNEEHKEKRFLGAILKIGHALAKTVLPMVTNAFKPKQ | Chaco tree frog | Necrosis; Apoptosis | MTT/MTS assay | MCF-7 | Skin cancer | IC50 : 15.3 µM |
| dbacp02954 | Figainin 2 | MAFLKKSLFLVLFLGIVSLSVCEEEKREGEEKEEKREEEEGKEENEDGNEEHKEKRFLGAILKIGHALAKTVLPMVTNAFKPKQ | Chaco tree frog | Necrosis; Apoptosis | MTT/MTS assay | MCF-7 | Breast cancer | IC50 : 15.3 µM |
| dbacp03363 | Hα-Defensin HNPs-1 | NA | Not found | Cellular necrosis | Cell viability assay | RCCs, HLA-DRB1*10301 | Tumor | Inhibition at 12.5 µg/ml |
| dbacp03364 | Hα-Defensin HNPs-2 | NA | Not found | Cellular necrosis | Cell viability assay | RCCs, HLA-DRB1*10301 | Tumor | Inhibition at 12.5 µg/ml |
| dbacp03365 | Hα-Defensin HNPs-3 | NA | Not found | Cellular necrosis | Cell viability assay | RCCs, HLA-DRB1*10301 | Tumor | Inhibition at 12.5 µg/ml |
| dbacp03418 | Interferon gamma (IFN-gamma) | MSYTSYILAFQLCLILGSYGCYCQDTLTRETEHLKAYLKANTSDVANGGPLFLNILRNWKEESDNKIIQSQIVSFYFKLFDNLKDHEVIKKSMESIKEDIFVKFFNSNLTKMDDFQNLTRISVDDRLVQRKAVSELSNVLNFLSPKSNLKKRKRSQTLFRGRRASKY | Rabbit | Necrosis | Not specified | Not found | Not found | Not found |
| dbacp03419 | Interferon gamma (IFN-gamma) | MNYTSFILAFQLCAILGSSTYYCQAAFFKEIENLKEYFNASNPDVGDGGPLFLDILKNWKEDSDKKIIQSQIVSFYFKLFENLKDNQVIQKSMDTIKEDLFVKFFNSSTSKLEDFQKLIQIPVNDLKVQRKAISELIKVMNDLSPKANLRKRKRSQNPFRGRRALQ | Horse | Necrosis; Immunomodulatory activity | Not specified | Not found | Not found | Not found |
| dbacp03473 | K4R2-Nal2-S1 | Ac-KKKKRR-NAl-NAl-KKWRKWLAKK-NH2 | Not found | Necrosis or apoptosis | MTT assay | PC9 | Human lung cancer | MIC : 25 μM |
| dbacp03474 | K4R2-Nal2-S1 | Ac-KKKKRR-NAl-NAl-KKWRKWLAKK-NH2 | Not found | Necrosis or apoptosis | MTT assay | PC9-G | Oral cancer | MIC : 25 μM |
| dbacp03475 | K4R2-Nal2-S1 | Ac-KKKKRR-NAl-NAl-KKWRKWLAKK-NH2 | Not found | Necrosis or apoptosis | MTT assay | A549 | Human lung cancer | MIC : 25 μM |
| dbacp03476 | K4R2-Nal2-S1 | Ac-KKKKRR-NAl-NAl-KKWRKWLAKK-NH2 | Not found | Necrosis or apoptosis | MTT assay | C9 | Oral cancer | MIC : 25 μM |
| dbacp03477 | K4R2-Nal2-S1 | Ac-KKKKRR-NAl-NAl-KKWRKWLAKK-NH2 | Not found | Necrosis or apoptosis | MTT assay | OECM-1 | Human lung cancer | MIC : 25 μM |
| dbacp03478 | K4R2-Nal2-S1 | Ac-KKKKRR-NAl-NAl-KKWRKWLAKK-NH2 | Not found | Necrosis or apoptosis | MTT assay | SAS | Oral cancer | MIC : 25 μM |
| dbacp03479 | K6-Nal2-S1 | Ac-KKKKKK-NAl-NAl-KKWRKWLAKK-NH2 | Not found | Necrosis or apoptosis | MTT assay | PC9 | Human lung cancer | MIC : 3.1 μM |
| dbacp03480 | K6-Nal2-S1 | Ac-KKKKKK-NAl-NAl-KKWRKWLAKK-NH2 | Not found | Necrosis or apoptosis | MTT assay | PC9-G | Oral cancer | MIC : 3.1 μM |
| dbacp03481 | K6-Nal2-S1 | Ac-KKKKKK-NAl-NAl-KKWRKWLAKK-NH2 | Not found | Necrosis or apoptosis | MTT assay | A549 | Human lung cancer | MIC : 3.1 μM |
| dbacp03482 | K6-Nal2-S1 | Ac-KKKKKK-NAl-NAl-KKWRKWLAKK-NH2 | Not found | Necrosis or apoptosis | MTT assay | C9 | Oral cancer | MIC : 3.1 μM |
| dbacp03483 | K6-Nal2-S1 | Ac-KKKKKK-NAl-NAl-KKWRKWLAKK-NH2 | Not found | Necrosis or apoptosis | MTT assay | OECM-1 | Human lung cancer | MIC : 3.1 μM |
| dbacp03484 | K6-Nal2-S1 | Ac-KKKKKK-NAl-NAl-KKWRKWLAKK-NH2 | Not found | Necrosis or apoptosis | MTT assay | SAS | Oral cancer | MIC : 3.1 μM |
| dbacp03600 | l3,10,13K7,8K4R2L9 | KLlRLLkkLlRLlLK | Diastereomeric peptide | Plasma membrane perturbation; Necrosis | XTT assay | B16-F10 | Skin cancer | LC50 : 2.5 µM |
| dbacp03601 | l3,10,13K7,8K4R2L9 | KLlRLLkkLlRLlLK | Diastereomeric peptide | Plasma membrane perturbation; Necrosis | XTT assay | D-122 | Lung cancer | LC50 : 4.5 µM |
| dbacp03602 | l3,4,8,10K5L7 | KlllKLKlKlLK | Diastereomeric peptide | Plasma membrane perturbation; Necrosis | XTT assay | B16-F10 | Skin cancer | LC50 : 100 µM |
| dbacp03603 | l3,4,8,10K5L7 | KLllKLKlKlLK | Diastereomeric peptide | Plasma membrane perturbation; Necrosis | XTT assay | D-122 | Lung cancer | LC50 : >50 µM |
| dbacp04302 | LTX-315 | KKWWKKW-Dip-K | Synthetic peptide | Necrosis | MTT/MTS assay | B16F1 | Skin cancer | IC50 : 13.3 µM |
| dbacp04303 | LTX-315 | KKWWKKW-Dip-K | Synthetic peptide | Necrosis | MTT/MTS assay | A375 | Skin cancer | IC50 : 12.7 µM |
| dbacp04304 | LTX-315 | KKWWKKW-Dip-K | Synthetic peptide | Necrosis | MTT/MTS assay | Fem-X | Skin cancer | IC50 : 15.3 µM |
| dbacp04308 | LTX-328 | KAQ-Dip-QKQAW | Synthetic peptide | Necrosis | MTT/MTS assay | Fem-X | Skin cancer | IC50 : >350 µM |
| dbacp04652 | Melittin | GIGAVLKVLTTGLPALISWIKRKRQQ | Main component of honey bee venom | Membrane damage; Apoptotic cell death; Necrosis | Cell viability assay | SCC25 | Skin cancer | 102.9 ± 4.1% cell growth inhibition at 1 µM |
| dbacp04694 | MK58911 (a peptide Analog from the mastoparan class of wasps) | INWLKIAKKVKGML | Greater wax moth | Apoptosis; Necrosis | Cytotoxicity test | MRC5 | Not found | IC50 : > 500 µg/mL |
| dbacp04695 | MK58911 (a peptide Analog from the mastoparan class of wasps) | INWLKIAKKVKGML | Greater wax moth | Apoptosis; Necrosis | Cytotoxicity test | U87 | Not found | IC50 : > 500 µg/mL |
| dbacp04820 | Nal2-S1 | Ac-KKWRKWLAKK-NH2 | Not found | Necrosis; Apoptosis | MTT assay | PC9 | Human Lung cancer | MIC : 25 μM |
| dbacp04821 | Nal2-S1 | Ac-KKWRKWLAKK-NH2 | Not found | Necrosis; Apoptosis | MTT assay | PC9-G | Oral cancer | MIC : 25 μM |
| dbacp04822 | Nal2-S1 | Ac-KKWRKWLAKK-NH2 | Not found | Necrosis; Apoptosis | MTT assay | A549 | Human Lung cancer | MIC : 25 μM |
| dbacp04823 | Nal2-S1 | Ac-KKWRKWLAKK-NH2 | Not found | Necrosis; Apoptosis | MTT assay | C9 | Oral cancer | MIC : 25 μM |
| dbacp04824 | Nal2-S1 | Ac-KKWRKWLAKK-NH2 | Not found | Necrosis; Apoptosis | MTT assay | OECM-1 | Human Lung cancer | MIC : 25 μM |
| dbacp04825 | Nal2-S1 | Ac-KKWRKWLAKK-NH2 | Not found | Necrosis; Apoptosis | MTT assay | SAS | Oral cancer | MIC : 25 μM |
| dbacp05012 | Omiganan MBI-226 | ILRWPWWPWRRK | Cattle neutrophils | Disruption of electric potential of the cell membrane; Necrosis; Membranolytic activity leading to apoptosis | MTT/MTS assay | U-937 | Lymphoma cancer | IC50 : 80 - 85 µg/ml |
| dbacp05013 | Omiganan MBI-226 | ILRWPWWPWRRK | Helical peptide with a predominance of one or more amino acids tryptophane-rich | Disruption of electric potential of the cell membrane; Necrosis; Membranolytic activity leading to apoptosis | MTT/MTS assay | U-937 | Lymphoma cancer | 27% Cytotoxicity at 0.5 µg/ml |
| dbacp05038 | P18 | KWKLFKKIPKFLHLAKKF | Bovine lactoferrin (Lf-B) | Necrosis; Cell membrane rupture | MTT/MTS assay | M14 | Skin cancer | 92.2 ± 1.02% cell viability at 10 µM |
| dbacp05039 | P18 | KWKLFKKIPKFLHLAKKF | Synthetic peptide | Necrosis; Cell membrane rupture | MTT/MTS assay | M14 | Skin cancer | 71.1 ± 2.84% cell viability at 20 µM |
| dbacp05040 | P18 | KWKLFKKIPKFLHLAKKF | Synthetic peptide | Necrosis; Cell membrane rupture | MTT/MTS assay | M14 | Skin cancer | 50 ± 3.09% cell viability at 40 µM |
| dbacp05041 | P18 | KWKLFKKIPKFLHLAKKF | Synthetic peptide | Necrosis; Cell membrane rupture | MTT/MTS assay | M14 | Skin cancer | 31.5 ± 1.49% cell viability at 60 µM |
| dbacp05042 | P18 | KWKLFKKIPKFLHLAKKF | Synthetic peptide | Necrosis; Cell membrane rupture | MTT/MTS assay | M14 | Skin cancer | 13.8 ± 1.44% cell viability at 80 µM |
| dbacp05043 | P18 | KWKLFKKIPKFLHLAKKF | Synthetic peptide | Necrosis; Cell membrane rupture | MTT/MTS assay | A-375 | Skin cancer | 86 ± 0.57% cell viability at 10 µM |
| dbacp05044 | P18 | KWKLFKKIPKFLHLAKKF | Synthetic peptide | Necrosis; Cell membrane rupture | MTT/MTS assay | A-375 | Skin cancer | 63.8 ± 0.8% cell viability at 20 µM |
| dbacp05045 | P18 | KWKLFKKIPKFLHLAKKF | Synthetic peptide | Necrosis; Cell membrane rupture | MTT/MTS assay | A-375 | Skin cancer | 47.5 ± 1.66% cell viability at 40 µM |
| dbacp05046 | P18 | KWKLFKKIPKFLHLAKKF | Synthetic peptide | Necrosis; Cell membrane rupture | MTT/MTS assay | A-375 | Skin cancer | 26.9 ± 0.5% cell viability at 60 µM |
| dbacp05047 | P18 | KWKLFKKIPKFLHLAKKF | Synthetic peptide | Necrosis; Cell membrane rupture | MTT/MTS assay | A-375 | Skin cancer | 6.5 ± 1.07% cell viability at 80 µM |
| dbacp05467 | Peptidoglycan recognition protein 1 | MLFACALLALLGLATSCSFIVPRSEWRALPSECSSRLGHPVRYVVISHTAGSFCNSPDSCEQQARNVQHYHKNELGWCDVAYNFLIGEDGHVYEGRGWNIKGDHTGPIWNPMSIGITFMGNFMDRVPAKRALRAALNLLECGVSRGFLRSNYEVKGHRDVQSTLSPGDQLYQVIQSWEHYRE | Mouse | Necrosis; Apoptosis | Cytotoxicity assay | VMR-0 | Mammary adenocarcinoma | Not found |
| dbacp05468 | Peptidoglycan recognition protein 1 | MLFACALLALLGLATSCSFIVPRSEWRALPSECSSRLGHPVRYVVISHTAGSFCNSPDSCEQQARNVQHYHKNELGWCDVAYNFLIGEDGHVYEGRGWNIKGDHTGPIWNPMSIGITFMGNFMDRVPAKRALRAALNLLECGVSRGFLRSNYEVKGHRDVQSTLSPGDQLYQVIQSWEHYRE | Mouse | Necrosis; Apoptosis | Cytotoxicity assay | VMR-L | Mammary adenocarcinoma | Not found |
| dbacp05469 | Peptidoglycan recognition protein 1 | MLFACALLALLGLATSCSFIVPRSEWRALPSECSSRLGHPVRYVVISHTAGSFCNSPDSCEQQARNVQHYHKNELGWCDVAYNFLIGEDGHVYEGRGWNIKGDHTGPIWNPMSIGITFMGNFMDRVPAKRALRAALNLLECGVSRGFLRSNYEVKGHRDVQSTLSPGDQLYQVIQSWEHYRE | Mouse | Necrosis; Apoptosis | Cytotoxicity assay | CSML-0 | Mammary adenocarcinoma | Not found |
| dbacp05470 | Peptidoglycan recognition protein 1 | MLFACALLALLGLATSCSFIVPRSEWRALPSECSSRLGHPVRYVVISHTAGSFCNSPDSCEQQARNVQHYHKNELGWCDVAYNFLIGEDGHVYEGRGWNIKGDHTGPIWNPMSIGITFMGNFMDRVPAKRALRAALNLLECGVSRGFLRSNYEVKGHRDVQSTLSPGDQLYQVIQSWEHYRE | Mouse | Necrosis; Apoptosis | Cytotoxicity assay | CSML-100 | Mammary adenocarcinoma | Not found |
| dbacp05488 | Pexiganan MSI-78 | GIGKFLKKAKKFGKAFVKILKK | Analog of African clawed frog | Disruption of electric potential of the cell membrane; Necrosis; Membranolytic activity leading to apoptosis | MTT/MTS assay | U-941 | Lymphoma cancer | IC50 : 20-30 µg/ml |
| dbacp05569 | Piscidin-4 | FIHHIIGGLFSAGKAIHRLIRRRRR | Nile tilapia | Necrosis | Adenosine triphosphate (ATP) assay | A549 | Non-small cell Lung cancer (NSCLC) | IC50 : 1.922 – 27.62 µM |
| dbacp05570 | Piscidin-4 | FIHHIIGGLFSAGKAIHRLIRRRRR | Nile tilapia | Necrosis | Adenosine triphosphate (ATP) assay | NCI-H661 | Non-small cell Lung cancer (NSCLC) | IC50 : 3.769 – 14.17 µM |
| dbacp05571 | Piscidin-4 | FIHHIIGGLFSAGKAIHRLIRRRRR | Nile tilapia | Necrosis | Adenosine triphosphate (ATP) assay | NCI-H1975 | Non-small cell Lung cancer (NSCLC) | IC50 : 1.241 – 5.472 µM |
| dbacp05572 | Piscidin-4 | FIHHIIGGLFSAGKAIHRLIRRRRR | Nile tilapia | Necrosis | Adenosine triphosphate (ATP) assay | HCC827 | Non-small cell Lung cancer (NSCLC) | IC50 :10.61 – 18.52 µM |
| dbacp05649 | Protegrin 1 | RGGRLCYCRRRFCVCVGR | Alpha helical peptide without cysteines | Disruption of electric potential of the cell membrane; Necrosis; Membranolytic activity leading to apoptosis | MTT/MTS assay | U-942 | Lymphoma cancer | IC50 : 30-40 µg/ml |
| dbacp05697 | Psyle A | GIACGESCVFLGCFIPGCSCKSKVCYFN | **Eumachia leptothyrsa**, New Guinea, Philippines, Sulawesi | Necrosis; Cell membrane rupture | Not specified | Not found | Not found | Not found |
| dbacp05698 | Psyle A | GIACGESCVFLGCFIPGCSCKSKVCYFN | **Eumachia leptothyrsa**, New Guinea, Philippines, Sulawesi | Necrosis; Cell membrane rupture | Not specified | Not found | Not found | Not found |
| dbacp05699 | Psyle A | GIACGESCVFLGCFIPGCSCKSKVCYFN | **Eumachia leptothyrsa**, New Guinea, Philippines, Sulawesi | Necrosis; Cell membrane rupture | Not specified | Not found | Not found | Not found |
| dbacp05700 | Psyle C | KLCGETCFKFKCYTPGCSCSYPFCK | **Eumachia leptothyrsa**, New Guinea, Philippines, Sulawesi | Necrosis; Cell membrane rupture | Not specified | Not found | Not found | Not found |
| dbacp05701 | Psyle C | KLCGETCFKFKCYTPGCSCSYPFCK | **Eumachia leptothyrsa**, New Guinea, Philippines, Sulawesi | Necrosis; Cell membrane rupture | Not specified | Not found | Not found | Not found |
| dbacp05702 | Psyle C | KLCGETCFKFKCYTPGCSCSYPFCK | **Eumachia leptothyrsa**, New Guinea, Philippines, Sulawesi | Necrosis; Cell membrane rupture | Not specified | Not found | Not found | Not found |
| dbacp05703 | Psyle E | GVIPCGESCVFIPCISSVLGCSCKNKVCYRD | **Eumachia leptothyrsa**, New Guinea, Philippines, Sulawesi | Necrosis; Cell membrane rupture | Not specified | Not found | Not found | Not found |
| dbacp05704 | Psyle E | GVIPCGESCVFIPCISSVLGCSCKNKVCYRD | **Eumachia leptothyrsa**, New Guinea, Philippines, Sulawesi | Necrosis; Cell membrane rupture | Not specified | Not found | Not found | Not found |
| dbacp05705 | Psyle E | GVIPCGESCVFIPCISSVLGCSCKNKVCYRD | **Eumachia leptothyrsa**, New Guinea, Philippines, Sulawesi | Necrosis; Cell membrane rupture | Not specified | Not found | Not found | Not found |
| dbacp06008 | S1 (Ac-KKWRKWLAKK-NH2) | Ac-NAl-NAl-KKWRKWLAKK-NH2 | Not found | Necrosis or apoptosis | MTT assay | PC9 | Human Lung cancer | Not found |
| dbacp06009 | S1 (Ac-KKWRKWLAKK-NH2) | Ac-NAl-NAl-KKWRKWLAKK-NH2 | Not found | Necrosis or apoptosis | MTT assay | PC9-G | Oral cancer | Not found |
| dbacp06010 | S1 (Ac-KKWRKWLAKK-NH2) | Ac-NAl-NAl-KKWRKWLAKK-NH2 | Not found | Necrosis or apoptosis | MTT assay | A549 | Human lung cancer | Not found |
| dbacp06011 | S1 (Ac-KKWRKWLAKK-NH2) | Ac-NAl-NAl-KKWRKWLAKK-NH2 | Not found | Necrosis or apoptosis | MTT assay | C9 | Oral cancer | Not found |
| dbacp06012 | S1 (Ac-KKWRKWLAKK-NH2) | Ac-NAl-NAl-KKWRKWLAKK-NH2 | Not found | Necrosis or apoptosis | MTT assay | OECM-1 | Human lung cancer | Not found |
| dbacp06013 | S1 (Ac-KKWRKWLAKK-NH2) | Ac-NAl-NAl-KKWRKWLAKK-NH2 | Not found | Necrosis or apoptosis | MTT assay | SAS | Oral cancer | Not found |
| dbacp06226 | Temporin A | FLPLIGRVLSGIL | Common frog | Disruption of electric potential of the cell membrane; Necrosis; Membranolytic activity leading to apoptosis | MTT/MTS assay | U-943 | Lymphoma cancer | IC50 : 80-90 µg/ml |
| dbacp06324 | TP4 | FIHHIIGGLFSAGKAIHRLIRRRRR | Nile tilapia | Necrosis | Not specified | Not found | Brain cancer | Not found |
| dbacp06404 | Tyroserleutide | YSL | Synthetic Peptide | Necrosis; Immune regulation | MTT/MTS assay | B16-F10 | Skin cancer | 49.4% Cytotoxic at 0.1 µg/ml |
| dbacp06405 | Tyroserleutide | YSL | Synthetic Peptide | Necrosis; Immune regulation | MTT/MTS assay | B16-F10 | Skin cancer | 51.2% Cytotoxic at 1 µg/ml |
| dbacp06406 | Tyroserleutide | YSL | Synthetic Peptide | Necrosis; Immune regulation | MTT/MTS assay | B16-F10 | Skin cancer | 53.0% Cytotoxic at 10 µg/ml |
| dbacp06407 | Tyroserleutide | YSL | Synthetic Peptide | Necrosis; Immune regulation | MTT/MTS assay | B16-F10 | Skin cancer | 61.2% Cytotoxic at 100 µg/ml |
| dbacp06408 | Tyroserleutide | YSL | Synthetic Peptide | Necrosis; Immune regulation | MTT/MTS assay | BEL-7402 | Liver cancer | 39.0% Cytotoxic at 0.1 µg/ml |
| dbacp06409 | Tyroserleutide | YSL | Synthetic Peptide | Necrosis; Immune regulation | MTT/MTS assay | BEL-7402 | Liver cancer | 20.8% Cytotoxic at 1 µg/ml |
| dbacp06410 | Tyroserleutide | YSL | Synthetic Peptide | Necrosis; Immune regulation | MTT/MTS assay | BEL-7402 | Liver cancer | 33.8% Cytotoxic at 10 µg/ml |
| dbacp06411 | Tyroserleutide | YSL | Synthetic Peptide | Necrosis; Immune regulation | MTT/MTS assay | BEL-7402 | Liver cancer | 35.6% Cytotoxic at 100 µg/ml |