203 result(s) have been found!
| Accession | Name | Sequence | Source/Organism | Mechanism | Assay Type | Cell Line | Cancer Type | Activity |
|---|---|---|---|---|---|---|---|---|
| dbacp00308 | (ATAP) Amphipathic tail-anchoring peptide of Bfl-1 | KFEPKSGWMTFLEVTGKICEMLSLLKQYC | Anti apoptotic (MCL-1, BFL1) | Apoptosis inducing | Not specified | HeLa | Not found | Not found |
| dbacp00760 | 9S1R | RRRRRWCMNW | Nullomer derived anticancer peptides (NulloPs) | Cell membrane disintegration; Apoptosis | MTT/MTS assay | HUT-102 | Lymphoma cancer | IC50 : 43 µM |
| dbacp00761 | 9S1R | RRRRRWCMNW | Nullomer derived anticancer peptides (NulloPs) | Cell membrane disintegration; Apoptosis | MTT/MTS assay | HUT-102 | Lymphoma cancer | IC50 : 45 µM |
| dbacp00762 | 9S1R | RRRRRWCMNW | Nullomer derived anticancer peptides (NulloPs) | Cell membrane disintegration; Apoptosis | MTT/MTS assay | HUT-102 | Lymphoma cancer | IC50 : 36 µM |
| dbacp00763 | 9S1R | RRRRRWCMNW | Nullomer derived anticancer peptides (NulloPs) | Cell membrane disintegration; Apoptosis | MTT/MTS assay | J774A.1 | Tumor | IC50 : 26 µM |
| dbacp00764 | 9S1R | RRRRRWCMNW | Nullomer derived anticancer peptides (NulloPs) | Cell membrane disintegration; Apoptosis | MTT/MTS assay | J774A.1 | Tumor | IC50 : 17 µM |
| dbacp00979 | Adenoregulin | GLWSKIKEVGKEAAKAAAKAAGKAALGAVSEAV | South American frog, Giant leaf frog | Cell membrane disintegration | LDH leakage assay | PC-3 | Prostate cancer | GI50 : 1.24 ± 0.23 µM |
| dbacp00980 | Adenoregulin | GLWSKIKEVGKEAAKAAAKAAGKAALGAVSEAV | South American frog, Giant leaf frog | Cell membrane disintegration | LDH leakage assay | LNCaP | Prostate cancer | GI50 : 0.31 ± 0.15 µM |
| dbacp00981 | Adenoregulin | GLWSKIKEVGKEAAKAAAKAAGKAALGAVSEAV | South American frog, Giant leaf frog | Cell membrane disintegration | LDH leakage assay | DU-145 | Liver cancer | GI50 : 0.91 ± 0.04 µM |
| dbacp00982 | Adenoregulin | GLWSKIKEVGKEAAKAAAKAAGKAALGAVSEAV | South American frog, Giant leaf frog | Cell membrane disintegration | LDH leakage assay | MDA-MB-231 | Breast cancer | GI50 : 8.06 ± 0.50 µM |
| dbacp00983 | Adenoregulin | GLWSKIKEVGKEAAKAAAKAAGKAALGAVSEAV | South American frog, Giant leaf frog | Cell membrane disintegration | LDH leakage assay | Raji | Lymphoma cancer | GI50 : 2.57 ± 0.75 µM |
| dbacp01157 | Anthopleura anjunae anti-tumor peptide | YVPGP | Sea anemone anti-tumor peptide | Apoptosis inducing | MTT Cell Proliferation and Cytotoxicity assay | DU-145 | Prostate cancer | IC50 : 9.605 μM |
| dbacp01193 | ATAP-iRGD peptide-Parental | KFEPKSGWMTFLEVTGKIAEMLSLLKQYCRGDKGPDC | Anti apoptotic (MCL-1, BFL1) | Inducing apoptosis | MTT assay | DU-145 | Prostate cancer | IC50 : 1.6 μM |
| dbacp01194 | ATAP-iRGD-M1 | AFEPKSGWMTFLEVTGKIAEMLSLLKQYCRGDKGPDC | Anti apoptotic (MCL-1, BFL1) | Inducing apoptosis | MTT assay | DU-145 | Prostate cancer | IC50 : 36 μM |
| dbacp01195 | ATAP-iRGD-M2 | LFEPKSGWMTFLEVTGKIAEMLSLLKQYCRGDKGPDC | Anti apoptotic (MCL-1, BFL1) | Inducing apoptosis | MTT assay | DU-145 | Prostate cancer | IC50 : 68 μM |
| dbacp01196 | ATAP-iRGD-M3 | KFEPLSGWMTFLEVTGKIAEMLSLLKQYCRGDKGPDC | Anti apoptotic (MCL-1, BFL1) | Inducing apoptosis | MTT assay | DU-145 | Prostate cancer | IC50 : 25 μM |
| dbacp01197 | ATAP-iRGD-M5 | KFEPKSGWETFLEVTGKIAEMLSLLKQYCRGDKGPDC | Anti apoptotic (MCL-1, BFL1) | Inducing apoptosis | MTT assay | DU-145 | Prostate cancer | IC50 : 6 μM |
| dbacp01198 | ATAP-iRGD-M6 | KKFEPKSGWMTFLEVTGKIAEMLSLLKQYCRGDKGPDC | Anti apoptotic (MCL-1, BFL1) | Inducing apoptosis | MTT assay | DU-145 | Prostate cancer | IC50 : 3.1 μM |
| dbacp01199 | ATAP-iRGD-M7 | KFEPKSGWMTFLEVTGKIAEMLSLLKQYCRGDKGPDC | Anti apoptotic (MCL-1, BFL1) | Inducing apoptosis | MTT assay | DU-145 | Prostate cancer | IC50 : 2.1 μM |
| dbacp01200 | ATAP-iRGD-M8 | KKFEPKSGWMTFLEVTGKIAEMLSLLKQYCRGDKGPDC | Anti apoptotic (MCL-1, BFL1) | Inducing apoptosis | MTT assay | DU-145 | Prostate cancer | IC50 : 2.1 μM |
| dbacp01445 | Baceridin | WAIVLL | Plant-associated rod-shaped, Gram-positive bacteria | Apoptosis inducing | MTT assay | HCT116 | Not specified | Not found |
| dbacp01446 | Baceridin | WAIVLL | Plant-associated rod-shaped, Gram-positive bacteria | Apoptosis inducing | MTT assay | RKO | Not specified | Not found |
| dbacp01447 | Baceridin | WAIVLL | Plant-associated rod-shaped, Gram-positive bacteria | Apoptosis inducing | MTT assay | HeLa | Not specified | Not found |
| dbacp02164 | C7A | KILRGVAKKILRTFLRRISKDILTGKK | NK-2 variants | Physical membrane disruption | MTT/MTS assay | E42/02 | Skin cancer | IC50 : 10.6 ± 0.4 µM |
| dbacp02165 | C7A | KILRGVAKKILRTFLRRISKDILTGKK | NK-2 variants | Physical membrane disruption | MTT/MTS assay | E42/02 | Skin cancer | IC50 : 13.0 ± 1.0 µM |
| dbacp02166 | C7A | KILRGVAKKILRTFLRRISKDILTGKK | NK-2 variants | Physical membrane disruption | MTT/MTS assay | E42/02 | Skin cancer | IC50 : 12.1 ± 1.6 µM |
| dbacp02167 | C7A | KILRGVAKKILRTFLRRISKDILTGKK | NK-2 variants | Physical membrane disruption | MTT/MTS assay | E42/02 | Skin cancer | IC50 : 3.7 ± 4.3 µM |
| dbacp02185 | C7A-D21k | KILRGVAKKIMRTFLRRISKKILTGKK | NK-2 variants | Physical membrane disruption | MTT/MTS assay | E42/02 | Skin cancer | IC50 : 8.4 ± 0.2 µM |
| dbacp02186 | C7A-D21k | KILRGVAKKIMRTFLRRISKKILTGKK | NK-2 variants | Physical membrane disruption | MTT/MTS assay | E42/02 | Skin cancer | IC50 : 12.3 ± 2.0 µM |
| dbacp02187 | C7A-D21k | KILRGVAKKIMRTFLRRISKKILTGKK | NK-2 variants | Physical membrane disruption | MTT/MTS assay | E42/02 | Skin cancer | IC50 : 8.3 ± 0.5 µM |
| dbacp02188 | C7A-D21k | KILRGVAKKIMRTFLRRISKKILTGKK | NK-2 variants | Physical membrane disruption | MTT/MTS assay | E42/02 | Skin cancer | IC50 : 12.3 ± 1.0 µM |
| dbacp02202 | C7A-Δ | KILRGVAKKIMRTFLRRILTGKK | NK-2 variants | Physical membrane disruption | MTT/MTS assay | E42/02 | Skin cancer | IC50 : 7.5 ± 0.4 µM |
| dbacp02203 | C7A-Δ | KILRGVAKKIMRTFLRRILTGKK | NK-2 variants | Physical membrane disruption | MTT/MTS assay | E42/02 | Skin cancer | IC50 : 13.8 ± 2.0 µM |
| dbacp02204 | C7A-Δ | KILRGVAKKIMRTFLRRILTGKK | NK-2 variants | Physical membrane disruption | MTT/MTS assay | E42/02 | Skin cancer | IC50 : 9.3 ± 1.5 µM |
| dbacp02205 | C7A-Δ | KILRGVAKKIMRTFLRRILTGKK | NK-2 variants | Physical membrane disruption | MTT/MTS assay | E42/02 | Skin cancer | IC50 : 13.1 ± 0.9 µM |
| dbacp02293 | Carcinoembryonic antigen glypican-3 GPC3(144-152) | FVGEFFTDV | Carcinoembryonic antigen glypican-3 GPC3(144-152) | Immune response to tumor cell recognition | Cytotoxicity assay | HepG2 | Not specified | Not found |
| dbacp02294 | Carcinoembryonic antigen glypican-3 GPC3(144-152) | FVGEFFTDV | Carcinoembryonic antigen glypican-3 GPC3(144-152) | Immune response to tumor cell recognition | Cytotoxicity assay | G-401 | Wilm's tumor | Not found |
| dbacp02295 | Carcinoembryonic antigen glypican-3 GPC3(144-152) | FVGEFFTDV | Carcinoembryonic antigen glypican-3 GPC3(144-152) | Immune response to tumor cell recognition | Cytotoxicity assay | SK-N-DZ | Wilm's tumor | Not found |
| dbacp02296 | Carcinoembryonic antigen glypican-3 GPC3(144-152) | FVGEFFTDV | Carcinoembryonic antigen glypican-3 GPC3(144-152) | Immune response to tumor cell recognition | Cytotoxicity assay | HuH-6 | Wilm's tumor | Not found |
| dbacp02297 | Carcinoembryonic antigen glypican-3 GPC3(298-306) | EYILSLEEL | Carcinoembryonic antigen glypican-3 GPC3(298-306) | Immune response to tumor cell recognition | Cytotoxicity assay | MDA-MB-231 | Not specified | Not found |
| dbacp02298 | Carcinoembryonic antigen glypican-3 GPC3(298-306) | EYILSLEEL | Carcinoembryonic antigen glypican-3 GPC3(298-306) | Immune response to tumor cell recognition | Cytotoxicity assay | MCF-7 | Not specified | Not found |
| dbacp02338 | Cecropin A | KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK | Isolated from the giant silk moth, cecropia moth | Membrane damage; Apoptotic cell death; Necrosis | MTT/MTS assay | SCC12 | Skin cancer | IC50 : 1 µM |
| dbacp02339 | Cecropin A | KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK | Isolated from the giant silk moth, cecropia moth | Membrane damage; Apoptotic cell death; Necrosis | MTT/MTS assay | SCC25 | Skin cancer | IC50 : 2.2 µM |
| dbacp02340 | Cecropin A | KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK | Isolated from the giant silk moth, cecropia moth | Membrane damage; Apoptotic cell death; Necrosis | Cell viability assay | SCC25 | Skin cancer | 0.6 ± 0.6% cell growth inhibition at 10 µM |
| dbacp02341 | Cecropin A | KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK | Isolated from the giant silk moth, cecropia moth | Membrane damage; Apoptotic cell death; Necrosis | Cell viability assay | SCC25 | Skin cancer | 107.0 ± 5.0% cell growth inhibition at 1 µM |
| dbacp02343 | Cecropin A | KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK | Giant silk moth, cecropia moth | Cell membrane disintegration | Not specified | Not found | Not found | Not found |
| dbacp02472 | Chickpea peptide | ADLPGLK | Plant sources | Inducing apoptosis | SRB assay | A-549 | Human endometrial cancer | IC50 : 126.4 ± 1.98 µM |
| dbacp02473 | Chickpea peptide | ADLPGLK | Plant sources | Inducing apoptosis | SRB assay | HepG-2 | Human endometrial cancer | IC50 : 113.7 ± 0.99 µM |
| dbacp02474 | Chickpea peptide | ADLPGLK | Plant sources | Inducing apoptosis | SRB assay | Ishikawa | Human endometrial cancer | IC50 : 101.5 ± 1.83 µM |
| dbacp02475 | Chickpea peptide | ADLPGLK | Plant sources | Inducing apoptosis | SRB assay | MCF-7 | Human endometrial cancer | IC50 : 110.3 ± 2.97µM |
| dbacp02476 | Chickpea peptide | ADLPGLK | Plant sources | Inducing apoptosis | SRB assay | MDA-MB-231 | Human endometrial cancer | IIC50 : 107.2 ± 1.62µM |
| dbacp02477 | Chickpea peptide | ADLPGLK | Plant sources | Inducing apoptosis | SRB assay | PA-1 | Human endometrial cancer | IC50 : 133.4 ± 0.70µM |
| dbacp02655 | Dermaseptin-B2 | GLWSKIKEVGKEAAKAAAKAAGKAALGAVSEAV | Giant leaf frog | Immunomodulatory properties | Cytotoxicity assays, Cell Titer-Glo Luminescent Cell viability assay | A549 | Lung adenocarcinoma | LC50 : < 12 μM |
| dbacp02656 | Dermaseptin-B2 | GLWSKIKEVGKEAAKAAAKAAGKAALGAVSEAV | Giant leaf frog | Immunomodulatory properties | Cytotoxicity assays, Cell Titer-Glo Luminescent Cell viability assay | MDA-MB-231 | Breast adenocarcinoma | LC50 : < 12 μM |
| dbacp02657 | Dermaseptin-B2 | GLWSKIKEVGKEAAKAAAKAAGKAALGAVSEAV | Giant leaf frog | Immunomodulatory properties | Cytotoxicity assays, Cell Titer-Glo Luminescent Cell viability assay | HT-29 | Colorectal adenocarcinoma | LC50 : < 12 μM |
| dbacp02658 | Dermaseptin-B2 | GLWSKIKEVGKEAAKAAAKAAGKAALGAVSEAV | Skin, Giant leaf frog, South America | Selective lysis of cellular membrane | Enzyme immunoassay, Antifungal bioassay | Not found | Not specified | Not found |
| dbacp02659 | Dermaseptin-B3 | ALWKnMLKGIGKLAGQAALGAVKTLVGAE | Giant leaf frog | Membrane lysis | In vitro proliferation assay, Soft agar assay | PC-3 | Human epithelial prostate adenocarcinoma | EC50 : 2 μM |
| dbacp02660 | Dermaseptin-B3 | ALWKnMLKGIGKLAGQAALGAVKTLVGA | South American frog, Giant leaf frog | Apoptosis inducing | Thymidine Incorporation assay | MCF-7 | Breast cancer | Not found |
| dbacp02661 | Dermaseptin-B4 | ALWKDILKNVGKAAGKAVLNTVTDMVNQ | Giant leaf frog | Apoptosis inducing | Thymidine Incorporation assay | MCF-7 | Breast cancer | Not found |
| dbacp02742 | Dermaseptins B2 | GLWSKIKEVGKEAAKAAAKAAGKAALGAVSEAV-NH2 | Giant leaf frog | Interact with the lipids of the plasma membrane | In vitro proliferation assay, Lactate dehydrogenase (LDH)-release assay | PC3 | Human breast cancer | GI50 : 2.17 ± 0.48 μM |
| dbacp02743 | Dermaseptins B2 | GLWSKIKEVGKEAAKAAAKAAGKAALGAVSEAV-NH3 | Giant leaf frog | Interact with the lipids of the plasma membrane | In vitro proliferation assay, Lactate dehydrogenase (LDH)-release assay | U87MG | Human lung cancer | GI50 : >10 μM |
| dbacp02955 | Figainin 2BN | FLGVALKLGKVLGKALLPLASSLLHSQ | Norepinephrine-stimulated skin secretion, the Giant Gladiator Treefrog, the Rusty Treefrog, Trinidad, South America | Cell membrane penetration | Not specified | A549 | Lung carcinoma | LC50 : 7-14 µM |
| dbacp02956 | Figainin 2BN | FLGVALKLGKVLGKALLPLASSLLHSQ | Norepinephrine-stimulated skin secretion, the Giant Gladiator Treefrog, the Rusty Treefrog, Trinidad, South America | Cell membrane penetration | Not specified | MDA-MB-231 | Breast adenocarcinoma | LC50 : 7-14 µM |
| dbacp02957 | Figainin 2BN | FLGVALKLGKVLGKALLPLASSLLHSQ | Norepinephrine-stimulated skin secretion, the Giant Gladiator Treefrog, the Rusty Treefrog, Trinidad, South America | Cell membrane penetration | Not specified | HT-29 | Colon adenocarcinoma | LC50 : 7-14 µM |
| dbacp03122 | Gomesin | ECRRLCYKQRCVTYCRGR | Hemocytes, Tarantula spider sp. | Cell membrane disintegration | Not specified | Not found | Breast cancer | Not found |
| dbacp03123 | Gomesin | QCRRLCYKQRCVTYCRGR | Hemocytes, Tarantula spider sp. | Cell membrane disintegration | Not specified | Not found | Breast cancer | Not found |
| dbacp03124 | Gomesin | GCRRLCYKQRCVTYCRGR | Tarantula spider sp. | Membrane permeabilization | Lactate dehydrogenase (LDH) assay | U-87 MG | Glioblastoma | MIC : 10 mM |
| dbacp03125 | Gomesin | ZCRRLCYKQRCVTYCRGR | Tarantula spider sp. | Target and destroy tumor cell membranes | Fluorescence-based assay using a Fluorescence Imaging Plate Reader | MM96L | Epithelial cancer | CC50 : 3.7 ± 0.2 μM |
| dbacp03126 | Gomesin | ZCRRLCYKQRCVTYCRGR | Tarantula spider sp. | Target and destroy tumor cell membranes | Fluorescence-based assay using a Fluorescence Imaging Plate Reader | K-562 | Chronic myeloid leukemia | CC50 : 3.8 ± 0.3 μM |
| dbacp03127 | Gomesin | ZCRRLCYKQRCVTYCRGR | Tarantula spider sp. | Target and destroy tumor cell membranes | Fluorescence-based assay using a Fluorescence Imaging Plate Reader | CRL-1739 | Gastric cancer | CC50 : 67.0 ± 5.0 μM |
| dbacp03128 | Gomesin | ZCRRLCYKQRCVTYCRGR | Tarantula spider sp. | Target and destroy tumor cell membranes | Fluorescence-based assay using a Fluorescence Imaging Plate Reader | HeLa | Cervical cancer | CC50 : 54.1 ± 5.0 μM |
| dbacp03129 | Gomesin | ZCRRLCYKQRCVTYCRGR | Tarantula spider sp. | Target and destroy tumor cell membranes | Cell viability assay | K-562 | Epithelial cancer | CC50 : 3.8 ± 0.3 μM |
| dbacp03130 | Gomesin | ZCRRLCYKQRCVTYCRGR | Tarantula spider sp. | Target and destroy tumor cell membranes | Cell viability assay | K-562 | Chronic myeloid leukemia | CC50 : 3.8 ± 0.3 μM |
| dbacp03131 | Gomesin | ZCRRLCYKQRCVTYCRGR | Tarantula spider sp. | Target and destroy tumor cell membranes | Cell viability assay | K-562 | Gastric cancer | CC50 : 3.8 ± 0.3 μM |
| dbacp03132 | Gomesin | ZCRRLCYKQRCVTYCRGR | Tarantula spider sp. | Target and destroy tumor cell membranes | Cell viability assay | K-562 | Breast cancer | CC50 : 3.8 ± 0.3 μM |
| dbacp03133 | Gomesin | ZCRRLCYKQRCVTYCRGR | Tarantula spider sp. | Target and destroy tumor cell membranes | Cell viability assay | K-562 | Cervical cancer | CC50 : 3.8 ± 0.3 μM |
| dbacp03134 | Gomesin | ZCRRLCYKQRCVTYCRGR | Tarantula spider sp. | Target and destroy tumor cell membranes | Cell viability assay | CRL-1739 | Epithelial cancer | CC50 : 67.0 ± 5.0 μM |
| dbacp03135 | Gomesin | ZCRRLCYKQRCVTYCRGR | Tarantula spider sp. | Target and destroy tumor cell membranes | Cell viability assay | CRL-1739 | Chronic myeloid leukemia | CC50 : 67.0 ± 5.0 μM |
| dbacp03136 | Gomesin | ZCRRLCYKQRCVTYCRGR | Tarantula spider sp. | Target and destroy tumor cell membranes | Cell viability assay | CRL-1739 | Gastric cancer | CC50 : 67.0 ± 5.0 μM |
| dbacp03137 | Gomesin | ZCRRLCYKQRCVTYCRGR | Tarantula spider sp. | Target and destroy tumor cell membranes | Cell viability assay | CRL-1739 | Breast cancer | CC50 : 67.0 ± 5.0 μM |
| dbacp03138 | Gomesin | ZCRRLCYKQRCVTYCRGR | Tarantula spider sp. | Target and destroy tumor cell membranes | Cell viability assay | CRL-1739 | Cervical cancer | CC50 : 67.0 ± 5.0 μM |
| dbacp03139 | Gomesin | ZCRRLCYKQRCVTYCRGR | Tarantula spider sp. | Target and destroy tumor cell membranes | Cell viability assay | MM96L | Epithelial cancer | CC50 : 3.7 ± 0.2 μM |
| dbacp03140 | Gomesin | ZCRRLCYKQRCVTYCRGR | Tarantula spider sp. | Target and destroy tumor cell membranes | Cell viability assay | MM96L | Chronic myeloid leukemia | CC50 : 3.7 ± 0.2 μM |
| dbacp03141 | Gomesin | ZCRRLCYKQRCVTYCRGR | Tarantula spider sp. | Target and destroy tumor cell membranes | Cell viability assay | MM96L | Gastric cancer | CC50 : 3.7 ± 0.2 μM |
| dbacp03142 | Gomesin | ZCRRLCYKQRCVTYCRGR | Tarantula spider sp. | Target and destroy tumor cell membranes | Cell viability assay | MM96L | Breast cancer | CC50 : 3.7 ± 0.2 μM |
| dbacp03143 | Gomesin | ZCRRLCYKQRCVTYCRGR | Tarantula spider sp. | Target and destroy tumor cell membranes | Cell viability assay | MM96L | Cervical cancer | CC50 : 3.7 ± 0.2 μM |
| dbacp03144 | Gomesin | ZCRRLCYKQRCVTYCRGR | Tarantula spider sp. | Target and destroy tumor cell membranes | Cell viability assay | HFF-1 | Epithelial cancer | CC50 : 49.9 ±16.6 μM |
| dbacp03145 | Gomesin | ZCRRLCYKQRCVTYCRGR | Tarantula spider sp. | Target and destroy tumor cell membranes | Cell viability assay | HFF-1 | Chronic myeloid leukemia | CC50 : 49.9 ±16.6 μM |
| dbacp03146 | Gomesin | ZCRRLCYKQRCVTYCRGR | Tarantula spider sp. | Target and destroy tumor cell membranes | Cell viability assay | HFF-1 | Gastric cancer | CC50 : 49.9 ±16.6 μM |
| dbacp03147 | Gomesin | ZCRRLCYKQRCVTYCRGR | Tarantula spider sp. | Target and destroy tumor cell membranes | Cell viability assay | HFF-1 | Breast cancer | CC50 : 49.9 ±16.6 μM |
| dbacp03148 | Gomesin | ZCRRLCYKQRCVTYCRGR | Tarantula spider sp. | Target and destroy tumor cell membranes | Cell viability assay | HFF-1 | Cervical cancer | CC50 : 49.9 ±16.6 μM |
| dbacp03149 | Gomesin | ZCRRLCYKQRCVTYCRGR | Tarantula spider sp. | Target and destroy tumor cell membranes | Cell viability assay | HeLa | Epithelial cancer | CC50 : 54.1 ± 5.0 μM |
| dbacp03150 | Gomesin | ZCRRLCYKQRCVTYCRGR | Tarantula spider sp. | Target and destroy tumor cell membranes | Cell viability assay | HeLa | Chronic myeloid leukemia | CC50 : 54.1 ± 5.0 μM |
| dbacp03151 | Gomesin | ZCRRLCYKQRCVTYCRGR | Tarantula spider sp. | Target and destroy tumor cell membranes | Cell viability assay | HeLa | Gastric cancer | CC50 : 54.1 ± 5.0 μM |
| dbacp03152 | Gomesin | ZCRRLCYKQRCVTYCRGR | Tarantula spider sp. | Target and destroy tumor cell membranes | Cell viability assay | HeLa | Breast cancer | CC50 : 54.1 ± 5.0 μM |
| dbacp03153 | Gomesin | ZCRRLCYKQRCVTYCRGR | Tarantula spider sp. | Target and destroy tumor cell membranes | Cell viability assay | HeLa | Cervical cancer | CC50 : 54.1 ± 5.0 μM |
| dbacp03387 | Interferon gamma (IFN-gamma) | MNYTSYILAFQLCVILCSSGYYCQAMFFKEIENLKEYFNASNPDVADGGPLFLDILKNWREESDKTIIQSQIVSFYLKLFENFKDNQIIQRSMDTIKEDMLFKFFNSSTSKRSDFLKLIQIPVNDMQVQRKAINELIKVMNDLSPRSNLRKRKRSQNLFRGRRASK | Giant panda | Regulation of immune response | Whole-blood IFN-gamma assay,Real-time reverse transcription–polymerase chain reaction (RT-PCR) assay | HEK293 | Renal cancer | No activity |
| dbacp03413 | Interferon gamma (IFN-gamma) | MKYTSYFLAFQLCVILGSSGSYCQAPFFKEIQNLKEYFNASNPDVAGGGPLFLEILENWKDESDKKIIQSQIVSFYFKLFENLKGNQIIQRSMDIIKQDMFQKFLNGSSEKLDDFKKLIQIPVDDLQIQRKAISELIRVMKDLSPRSNLRKRRRSQNLFRGQRASK | Atlantic bottle-nosed dolphin | Immunomodulatory activity | Not specified | Not found | Not found | Not found |
| dbacp03443 | Interferon gamma (IFN-gamma) | MKYTSYFLAFQLCVILGSSGSYCQAPFFKEIQNLKEYFNASNPDVAGGGPLFLEILENWKDESDKKIIQSQIVSFYFKLFENLKGNQIIQRSMDIIKQDMFQKFLNGSSEKLDDFKKLIQIPVDDLQIQRKAISELIRVMKDLSPRSNLRKRRRSQNLFRGQRASK | Atlantic bottle-nosed dolphin | Immunomodulatory activity | Not specified | Not found | Not found | Not found |
| dbacp03446 | Interferon gamma (IFN-gamma) | MNFTSYILAFQLCIILGSSSCCCQATFLKEIQNLKEYLNATDSDVADGGPLFIDILKNWKEDSDKKIIQSQIVSFYLEIFDNLKDNQVIQESVKTLEEDLFVKFFNSSSSKRDDFLKVMQTPVNDRNVQRKAISELSKVMNDLSHRSNGAKRKRRQYSFRGRRAST | Indian elephant | Immunoregulation | Not specified | Not found | Not found | Not found |
| dbacp03720 | LCP-3 | WLHV | Plant sources | Inducing apoptosis | Not specified | Caco-2 | Not specified | Not found |
| dbacp04103 | linear (RW)4-Dox | RWRWRWRW | Doxorubicin (Dox) is a well-known anthracycline which has been conjugated to a CPP | Inhibition of the cell proliferation | MTT/MTS assay | CCRF-CEM | Leukemia cancer | 46-69% anti-proliferative activity at 1 µM |
| dbacp04104 | linear (RW)4-Dox | RWRWRWRW | Doxorubicin (Dox) is a well-known anthracycline which has been conjugated to a CPP | Inhibition of the cell proliferation | MTT/MTS assay | SK-OV-3 | Ovarian cancer | 28-34% anti-proliferative activity at 1 µM |
| dbacp04105 | linear (RW)4-Dox | RWRWRWRW | Doxorubicin (Dox) is a well-known anthracycline which has been conjugated to a CPP | Inhibition of the cell proliferation | MTT/MTS assay | HCT-116 | Colon cancer | 21-61% anti-proliferative activity at 1 µM |
| dbacp04106 | linear (RW)4-Dox | RWRWRWRW | Doxorubicin (Dox) is a well-known anthracycline which has been conjugated to a CPP | Inhibition of the cell proliferation | MTT/MTS assay | MDA-MB-468 | Breast cancer | 60-74% anti-proliferative activity at 1 µM |
| dbacp04309 | Lunasin | SKWQHQQDSCRKQLQGVNLTPCEKHIMEKIQGRDDDDDDDDDD | Plant sources | Inducing apoptosis | MTT assay | HCT116-derived spheres | Colorectal cancer | IC50 : 161.0 ± 2.4 μM |
| dbacp04310 | Lunasin | SKWQHQQDSCRKQLQGVNLTPCEKHIMEKIQGRDDDDDDDDDD | Plant sources | Inducing apoptosis | MTT assay | HCT-116 parentl | Colorectal cancer | IC50 : 107.5 ± 1.9 μM |
| dbacp04337 | LVTX-8 | IWLTALKFLGKNLGKHLAKQQLSKL-NH2 | True tarantula | Promote apoptosis; Inhibits the proliferation and migration of lung cancer cells both in vitro and in vivo | CCK-8 assay, Flow cytometry, Colony formation assay, Transwell invasion and migration assay | A549 | Lung cancer | IC50 : approx. 8 µM |
| dbacp04338 | LVTX-8 | IWLTALKFLGKNLGKHLAKQQLSKL-NH2 | True tarantula | Promote apoptosis; Inhibits the proliferation and migration of lung cancer cells both in vitro and in vivo | CCK-8 assay, Flow cytometry, Colony formation assay, Transwell invasion and migration assay | H461 | Lung cancer | IC50 : approx. 8 µM |
| dbacp04339 | LVTX-9 | ASIGALIQKAIALIKAKAA-NH2 | True tarantula | Promote apoptosis; Inhibits the proliferation and migration of lung cancer cells both in vitro and in vivo | CCK-8 assay, Flow cytometry, Colony formation assay, Transwell invasion and migration assay | A549 | Lung cancer | IC50 : approx. 8 µM |
| dbacp04340 | LVTX-9 | ASIGALIQKAIALIKAKAA-NH2 | True tarantula | Promote apoptosis; Inhibits the proliferation and migration of lung cancer cells both in vitro and in vivo | CCK-8 assay, Flow cytometry, Colony formation assay, Transwell invasion and migration assay | H460 | Lung cancer | IC50 : approx. 8 µM |
| dbacp04341 | Lycosin-1 | Ac-KGWFKAMKSIAKFIAKEKLKEHL-amide | Tarantula wolf spider | Inhibit the migration of prostate cancer cell; Induce apoptosis | MTT assay | DU-145 | Prostate cancer | MIC : 10 μM |
| dbacp04342 | Lycosin-1 | Ac-KGWFKAMKSIAKFIAKEKLKEHL-amide | Tarantula wolf spider | Inhibit the migration of prostate cancer cell; Induce apoptosis | MTT assay | PC-3 | Prostate cancer | MIC : 20 μM |
| dbacp04541 | Malanin chain A | DYPKLTFTTS | Plant sources | Inducing apoptosis | MTT assay | HeLa | Cervical cancer | IC50 : 0.15 ± 0.08 nM |
| dbacp04542 | Malanin chain A | DYPKLTFTTS | Plant sources | Inducing apoptosis | MTT assay | PC-12 | Breast cancer | IC50 : 7.71 ± 0.24 nM |
| dbacp04543 | Malanin chain A | DYPKLTFTTS | Plant sources | Inducing apoptosis | MTT assay | MCF-7 | Leukemia | IC50 : 11.20 ± 0.02 nM |
| dbacp04544 | Malanin chain A | DYPKLTFTTS | Plant sources | Inducing apoptosis | MTT assay | K562 | Not found | IC50 : 15.80 ± 0.09 nM |
| dbacp04545 | Malanin chain A | DYPKLTFTTS | Plant sources | Inducing apoptosis | MTT assay | Vero | Not found | IC50 : 2.79 ± 0.05 nM |
| dbacp04546 | Malanin chain A | DYPKLTFTTS | Plant sources | Inducing apoptosis | MTT assay | MDCK | Not found | IC50 : 3.92 ± 0.01 nM |
| dbacp04547 | Malanin chain B | DETCTDEEFN | Plant sources | Inducing apoptosis | MTT assay | HeLa | Cervical cancer | IC50 : 0.15 ± 0.08 nM |
| dbacp04548 | Malanin chain B | DETCTDEEFN | Plant sources | Inducing apoptosis | MTT assay | PC-12 | Breast cancer | IC50 : 7.71 ± 0.24 nM |
| dbacp04549 | Malanin chain B | DETCTDEEFN | Plant sources | Inducing apoptosis | MTT assay | MCF-7 | Leukemia | IC50 : 11.20 ± 0.02 nM |
| dbacp04550 | Malanin chain B | DETCTDEEFN | Plant sources | Inducing apoptosis | MTT assay | K562 | Not found | IC50 : 15.80 ± 0.09 nM |
| dbacp04551 | Malanin chain B | DETCTDEEFN | Plant sources | Inducing apoptosis | MTT assay | Vero | Not found | IC50 : 2.79 ± 0.05 nM |
| dbacp04552 | Malanin chain B | DETCTDEEFN | Plant sources | Inducing apoptosis | MTT assay | MDCK | Not found | IC50 : 3.92 ± 0.01 nM |
| dbacp04629 | MCL-1, BH3 (208-228) | KALETLRRVGDGVQRNHETAF | Anti apoptotic (MCL-1, BFL1) | Inducing apoptosis | Not specified | Not found | Blood cancer | Not found |
| dbacp04630 | MCL-1, BH3 (208-228) | KALETLRRVGDGVQRNHETAF | Anti apoptotic (MCL-1, BFL1) | Inducing apoptosis | Not specified | Not found | Leukemia | Not found |
| dbacp04631 | MCL-1, BH3 (208-228) | KALETLRRVGDGVQRNHETAF | Anti apoptotic (MCL-1, BFL1) | Inducing apoptosis | Not specified | Not found | Skin cancer | Not found |
| dbacp04632 | MCL-1, BH3 (208-228) | KALETLRRVGDGVQRNHETAF | Anti apoptotic (MCL-1, BFL1) | Inducing apoptosis | Not specified | Not found | Breast cancer | Not found |
| dbacp04693 | MIPP | SLSLSVAR | Plant sources | Inducing apoptosis | SRB assay | HeLa | Human endometrial cancer | Not found |
| dbacp05055 | P2 | RALGWSCL | Plant sources | Inducing apoptosis | MTS assay | NB4 | Not specified | IC50 : 600 μg/mL |
| dbacp05056 | P2 | RALGWSCL | Plant sources | Inducing apoptosis | MTS assay | MOLT4 | Not specified | IC50 : 700 μg/mL |
| dbacp05057 | P2 | RALGWSCL | Plant sources | Inducing apoptosis | MTS assay | Raji | Not specified | IC50 : 700 μg/Ml |
| dbacp05127 | PaDef | ATCETPSKHFNGLCIRSSNCASVCHGEHFTDGRCQGVRRRCMCLKPC | Plant sources | Inducing apoptosis | MTT assay | Jurkat | Leukemia | Not found |
| dbacp05215 | PcTx-1 | EDCIPKWKGCVNRHGDCCEGLECWKRRRSFEVCVPKTPKTOHa | Trinidad chevron tarantula | Membrane permeabilization | Transwell Migration assay, Scratch wound migration assay | D54-MG | Glioma | Not found |
| dbacp05400 | Peptide from Lentinus Squarrosulus | RYGFTEVAGNFQQHNFGRG | Plant sources | Inducing apoptosis | MTT assay | H460 | Breast cancer | Not found |
| dbacp05401 | Peptide from Lentinus Squarrosulus | RYGFTEVAGNFQQHNFGRG | Plant sources | Inducing apoptosis | MTT assay | DPCs | Breast cancer | Not found |
| dbacp05402 | Peptide from Lentinus Squarrosulus | RYGFTEVAGNFQQHNFGRG | Plant sources | Inducing apoptosis | MTT assay | HK-2 | Breast cancer | Not found |
| dbacp05502 | PHP | ITCPQVTQSLAPCVPYLISG | Plant sources | Inducing apoptosis | MTT assay | Eca-109 | Not found | IC50 : 0.7 µM |
| dbacp05503 | PHP | ITCPQVTQSLAPCVPYLISG | Plant sources | Inducing apoptosis | MTT assay | HeLa | Not found | IC50 : 2.74 µM |
| dbacp05504 | PHP | ITCPQVTQSLAPCVPYLISG | Plant sources | Inducing apoptosis | MTT assay | MGC-7 | Not found | IC50 : 3.13 µM |
| dbacp05505 | PHP | ITCPQVTQSLAPCVPYLISG | Plant sources | Inducing apoptosis | MTT assay | B16 | Not found | IC50 : 1.47 µM |
| dbacp05555 | Picturin 1BN | GIFKDTLKKVVAAVLTTVADNIHPK | Norepinephrine-stimulated skin secretion, the Giant Gladiator Treefrog, the Rusty Treefrog, Trinidad, South America | Cell membrane penetration | Not specified | A549 | Lung carcinoma | LC50 : 7 - 14 µM |
| dbacp05556 | Picturin 1BN | GIFKDTLKKVVAAVLTTVADNIHPK | Norepinephrine-stimulated skin secretion, the Giant Gladiator Treefrog, the Rusty Treefrog, Trinidad, South America | Cell membrane penetration | Not specified | MDA-MB-231 | Breast adenocarcinoma | LC50 : 7 - 14 µM |
| dbacp05557 | Picturin 1BN | GIFKDTLKKVVAAVLTTVADNIHPK | Norepinephrine-stimulated skin secretion, the Giant Gladiator Treefrog, the Rusty Treefrog, Trinidad, South America | Cell membrane penetration | Not specified | HT-29 | Colon adenocarcinoma | LC50 : 7 - 14 µM |
| dbacp05558 | Picturin 2BN | GLMDMLKKVGKVALTVAKSALLP | Norepinephrine-stimulated skin secretion, the Giant Gladiator Treefrog, the Rusty Treefrog, Trinidad, South America | Cell membrane penetration | Not specified | A549 | Lung carcinoma | LC50 : 7 - 14 µM |
| dbacp05559 | Picturin 2BN | GLMDMLKKVGKVALTVAKSALLP | Norepinephrine-stimulated skin secretion, the Giant Gladiator Treefrog, the Rusty Treefrog, Trinidad, South America | Cell membrane penetration | Not specified | MDA-MB-231 | Breast adenocarcinoma | LC50 : 7 - 14 µM |
| dbacp05560 | Picturin 2BN | GLMDMLKKVGKVALTVAKSALLP | Norepinephrine-stimulated skin secretion, the Giant Gladiator Treefrog, the Rusty Treefrog, Trinidad, South America | Cell membrane penetration | Not specified | HT-29 | Colon adenocarcinoma | LC50 : 7 - 14 µM |
| dbacp05561 | Pis1 | FIHHIIGWISHGVRAIHRAIH | Atlantic cod | Disruption of membrane | Not specified | Not found | Not found | Not found |
| dbacp05562 | Pis2 | FLHHIVGLIHHGLSLFGDRAD | Atlantic cod | Disruption of membrane | Not specified | Not found | Not found | Not found |
| dbacp05564 | Piscidin 1 | FFHHIFRGIVHVGKTIHRLVTG | Mainly mast cells, gill, skin, intestine, spleen, and anterior kidney, hybrid striped bass (Striped bass x White bass) | Cell membrane disintegration | Not specified | Not found | Breast cancer | Not found |
| dbacp05587 | PNC-28 | ETFSDLWKLL | Ant | Membrane disruption | MTT/MTS assay | MiaPaCa.2 | Pancreatic cancer | Cytotoxicity : 80µg/ml |
| dbacp05596 | Polyphemusin II | RRWCFRVCYKGFCYRKCR-NH2 | Atlantic horseshoe crab | Induce necrotic cell death | Cell viability assay | K562 | Human erythroleukemia | EC50 : 22 μM |
| dbacp05597 | Polyphemusin III | RRGCFRVCYRGFCFQRCR | Atlantic horseshoe crab | Induce permeabilization of the cytoplasmic membrane | Trypan blue exclusion assay and Lactate dehydrogenase(LDH)-release assay | HL-60 | Human cervical cancer | IC50 : < 10 μM |
| dbacp05863 | RA-V | cyclopeptideRA-V-,cyclo(YAAYAY) | Plant sources | Inducing apoptosis | MTT assay | MCF-7 | Breast cancer | Not found |
| dbacp05864 | RA-V | cyclopeptideRA-V-,cyclo(YAAYAY) | Plant sources | Inducing apoptosis | MTT assay | MDA-MB-231 | Breast cancer | Not found |
| dbacp05865 | RA-V | cyclopeptideRA-V-,cyclo(YAAYAY) | Plant sources | Inducing apoptosis | MTT assay | 4T1 | Breast cancer | Not found |
| dbacp06021 | SALF | Ac-ECKFTVKPYLKRFQVYYKGRMWCPNH2 | Giant tiger prawn | Regulate apoptosis related death receptor/NF-κB signaling pathway | MTT assay | HeLa | Human lung cancer | MIC : 100 µg/ml |
| dbacp06133 | SNX-482 | GVDKAGCRYMFGGCSVNDDCCPRLGCHSLFSYCAWDLTFSDOHa | Giant baboon spider | Immunomodulatory properties | Not specified | Not found | Not found | Not found |
| dbacp06532 | VS-9 | VKLRSLLCS | Plant sources | Inducing apoptosis | MTT assay | MOLT4 | Leukemia | Not found |
| dbacp06533 | VS-9 | VKLRSLLCS | Plant sources | Inducing apoptosis | MTT assay | K562 | Leukemia | Not found |
| dbacp06793 | CPSA-CPSC-L-ACAN | Not Available | Recombinant Fusion Peptide | Apoptosis inducing | MTT assay | HeLa | Cervical Cancer | IC50 = 63.15 μg/ml |
| dbacp07102 | rScyreprocin | MKEDSNILDKTAKMTKQNKALLFTAGGAAAFMAGYYYYHCNYRNPAPKKSGSTTSQDKTDAQAVQSIPSPSGNKGKESKDPKVKHHHHHH | Recombinant product of Scyreprocin | Membrane disruption triggers ROS-mediated apoptosis | MTS assay | H-460 | Lung Cancer | IC50 = 6.27 µM |
| dbacp07103 | rScyreprocin | MKEDSNILDKTAKMTKQNKALLFTAGGAAAFMAGYYYYHCNYRNPAPKKSGSTTSQDKTDAQAVQSIPSPSGNKGKESKDPKVKHHHHHH | Recombinant product of Scyreprocin | Membrane disruption triggers ROS-mediated apoptosis | MTS assay | HepG-2 | Liver Cancer | IC50 = 441.01 µM |
| dbacp07104 | rScyreprocin | MKEDSNILDKTAKMTKQNKALLFTAGGAAAFMAGYYYYHCNYRNPAPKKSGSTTSQDKTDAQAVQSIPSPSGNKGKESKDPKVKHHHHHH | Recombinant product of Scyreprocin | Membrane disruption triggers ROS-mediated apoptosis | MTS assay | T-24 | Urinary Bladder Cancer | IC50 = 1.94 x 105 µM |
| dbacp07105 | rScyreprocin | MKEDSNILDKTAKMTKQNKALLFTAGGAAAFMAGYYYYHCNYRNPAPKKSGSTTSQDKTDAQAVQSIPSPSGNKGKESKDPKVKHHHHHH | Recombinant product of Scyreprocin | Membrane disruption triggers ROS-mediated apoptosis | MTS assay | DU-145 | Prostate cancer | IC50 = 1158.30 µM |
| dbacp07106 | rScyreprocin | MKEDSNILDKTAKMTKQNKALLFTAGGAAAFMAGYYYYHCNYRNPAPKKSGSTTSQDKTDAQAVQSIPSPSGNKGKESKDPKVKHHHHHH | Recombinant product of Scyreprocin | Membrane disruption triggers ROS-mediated apoptosis | MTS assay | HeLa | Cervical cancer | IC50 = 3.34 x 104 µM |
| dbacp07650 | AP1-Z5a | FLFKLIPKAIKGLIKAFK | Mutant of APR-Z1 | Charge–hydrophobicity balance drives apoptosis | MTT assay | MCF-7 | Breast Cancer | Graph Figure 2A |
| dbacp07651 | AP1-Z5a | FLFKLIPKAIKGLIKAFK | Mutant of APR-Z1 | Charge–hydrophobicity balance drives apoptosis | MTT assay | A-375 | Skin Cancer | Graph Figure 2B |
| dbacp07652 | AP1-Z5a | FLFKLIPKAIKGLIKAFK | Mutant of APR-Z1 | Charge–hydrophobicity balance drives apoptosis | MTT assay | U-87 | Brain Tumor | Graph Figure 2C |
| dbacp07653 | AP1-Z5b | FLFKLIKHAIKGLIKAFK | Mutant of APR-Z1 | Charge–hydrophobicity balance drives apoptosis | MTT assay | MCF-7 | Breast Cancer | IC50 = 1.037 μM |
| dbacp07654 | AP1-Z5b | FLFKLIKHAIKGLIKAFK | Mutant of APR-Z1 | Charge–hydrophobicity balance drives apoptosis | MTT assay | A-375 | Skin Cancer | IC50 = 2.607 μM |
| dbacp07655 | AP1-Z5b | FLFKLIKHAIKGLIKAFK | Mutant of APR-Z1 | Charge–hydrophobicity balance drives apoptosis | MTT assay | U-87 | Brain Tumor | IC50 = 3.115 μM |
| dbacp07656 | AP1-Z3a | FLFSLIKHAIKGLISAFK | Mutant of APR-Z1 | Charge–hydrophobicity balance drives apoptosis | MTT assay | MCF-7 | Breast Cancer | Graph Figure 2A |
| dbacp07657 | AP1-Z3a | FLFSLIKHAIKGLISAFK | Mutant of APR-Z1 | Charge–hydrophobicity balance drives apoptosis | MTT assay | A-375 | Skin Cancer | Graph Figure 2B |
| dbacp07658 | AP1-Z3a | FLFSLIKHAIKGLISAFK | Mutant of APR-Z1 | Charge–hydrophobicity balance drives apoptosis | MTT assay | U-87 | Brain Tumor | Graph Figure 2C |
| dbacp07659 | AP1-Z3b | FLFSLIKHAISKLISAFK | Mutant of APR-Z1 | Charge–hydrophobicity balance drives apoptosis | MTT assay | MCF-7 | Breast Cancer | Graph Figure 2A |
| dbacp07660 | AP1-Z3b | FLFSLIKHAISKLISAFK | Mutant of APR-Z1 | Charge–hydrophobicity balance drives apoptosis | MTT assay | A-375 | Skin Cancer | Graph Figure 2B |
| dbacp07661 | AP1-Z3b | FLFSLIKHAISKLISAFK | Mutant of APR-Z1 | Charge–hydrophobicity balance drives apoptosis | MTT assay | U-87 | Brain Tumor | Graph Figure 2C |
| dbacp07662 | AP1-Z7 | FLFKLIKKAIKKLIKAFK | Mutant of APR-Z1 | Charge–hydrophobicity balance drives apoptosis | MTT assay | MCF-7 | Breast Cancer | Graph Figure 2A |
| dbacp07663 | AP1-Z7 | FLFKLIKKAIKKLIKAFK | Mutant of APR-Z1 | Charge–hydrophobicity balance drives apoptosis | MTT assay | A-375 | Skin Cancer | Graph Figure 2B |
| dbacp07664 | AP1-Z7 | FLFKLIKKAIKKLIKAFK | Mutant of APR-Z1 | Charge–hydrophobicity balance drives apoptosis | MTT assay | U-87 | Brain Tumor | Graph Figure 2C |
| dbacp07665 | AP1-Z9 | FLFKLIKKKIKKLIKKFK | Mutant of APR-Z1 | Charge–hydrophobicity balance drives apoptosis | MTT assay | MCF-7 | Breast Cancer | Graph Figure 2A |
| dbacp07666 | AP1-Z9 | FLFKLIKKKIKKLIKKFK | Mutant of APR-Z1 | Charge–hydrophobicity balance drives apoptosis | MTT assay | A-375 | Skin Cancer | Graph Figure 2B |
| dbacp07667 | AP1-Z9 | FLFKLIKKKIKKLIKKFK | Mutant of APR-Z1 | Charge–hydrophobicity balance drives apoptosis | MTT assay | U-87 | Brain Tumor | Graph Figure 2C |
| dbacp07680 | Longicalycinin A | FYPFG | Dianthus superbus | Cyclization enhances apoptosis via lysosomes | MTT assay | HepG-2 | Liver Cancer | IC50 = 13.52 µg/ml |
| dbacp07681 | Longicalycinin A | FYPFG | Dianthus superbus | Cyclization enhances apoptosis via lysosomes | MTT assay | DLA cell line | Lung Cancer | CTC50 = 2.62 µM |
| dbacp07682 | Longicalycinin A | FYPFG | Dianthus superbus | Cyclization enhances apoptosis via lysosomes | MTT assay | EAC cell Line | Breast Cancer | CTC50 = 6.17 µM |
| dbacp07865 | R-Lycosin I derivative 8a | RGWFRAMRSIARFIARERLRGHL | Monosaccharide Analogue of Anticancer Peptide R-Lycosin-I | GLUT1-mediated uptake enhances cytotoxicity | CCK-8 assay | MDA-MB-231 | Breast Cancer | IC50 = 10.1 ± 0.2 µM |
| dbacp07866 | R-Lycosin I derivative 8a | RGWFRAMRSIARFIARERLRGHL | Monosaccharide Analogue of Anticancer Peptide R-Lycosin-I | GLUT1-mediated uptake enhances cytotoxicity | CCK-8 assay | A-549 | Lung Cancer | IC50 = 9.6 ± 0.3 µM |
| dbacp07867 | R-Lycosin I derivative 8a | RGWFRAMRSIARFIARERLRGHL | Monosaccharide Analogue of Anticancer Peptide R-Lycosin-I | GLUT1-mediated uptake enhances cytotoxicity | CCK-8 assay | H-460 | Lung Cancer | IC50 = 8.5 ± 0.4 µM |
| dbacp07868 | R-Lycosin I derivative 8a | RGWFRAMRSIARFIARERLRGHL | Monosaccharide Analogue of Anticancer Peptide R-Lycosin-I | GLUT1-mediated uptake enhances cytotoxicity | CCK-8 assay | H-1437 | Lung Cancer | IC50 = 13.0 ± 0.2 µM |
| dbacp07869 | R-Lycosin I derivative 8a | RGWFRAMRSIARFIARERLRGHL | Monosaccharide Analogue of Anticancer Peptide R-Lycosin-I | GLUT1-mediated uptake enhances cytotoxicity | CCK-8 assay | HGC-27 | Gastric Cancer | IC50 = 12.6 ± 0.6 µM |
| dbacp07870 | R-Lycosin I derivative 8a | RGWFRAMRSIARFIARERLRGHL | Monosaccharide Analogue of Anticancer Peptide R-Lycosin-I | GLUT1-mediated uptake enhances cytotoxicity | CCK-8 assay | PC-3 | Prostate Cancer | IC50 = 6.9 ± 0.4 µM |
| dbacp07871 | R-Lycosin I derivative 8b | RGWFRAMRSIARFIARERLRGHL | Monosaccharide Analogue of Anticancer Peptide R-Lycosin-I | GLUT1-mediated uptake enhances cytotoxicity | CCK-8 assay | MDA-MB-231 | Breast Cancer | IC50 = 6.0 ± 0.2 µM |
| dbacp07872 | R-Lycosin I derivative 8b | RGWFRAMRSIARFIARERLRGHL | Monosaccharide Analogue of Anticancer Peptide R-Lycosin-I | GLUT1-mediated uptake enhances cytotoxicity | CCK-8 assay | A-549 | Lung Cancer | IC50 = 7.0 ± 0.3 µM |
| dbacp07873 | R-Lycosin I derivative 8b | RGWFRAMRSIARFIARERLRGHL | Monosaccharide Analogue of Anticancer Peptide R-Lycosin-I | GLUT1-mediated uptake enhances cytotoxicity | CCK-8 assay | H-460 | Lung Cancer | IC50 = 4.9 ± 0.9 µM |
| dbacp07874 | R-Lycosin I derivative 8b | RGWFRAMRSIARFIARERLRGHL | Monosaccharide Analogue of Anticancer Peptide R-Lycosin-I | GLUT1-mediated uptake enhances cytotoxicity | CCK-8 assay | H-1437 | Lung Cancer | IC50 = 5.3 ± 0.2 µM |
| dbacp07875 | R-Lycosin I derivative 8b | RGWFRAMRSIARFIARERLRGHL | Monosaccharide Analogue of Anticancer Peptide R-Lycosin-I | GLUT1-mediated uptake enhances cytotoxicity | CCK-8 assay | HGC-27 | Gastric Cancer | IC50 = 5.3 ± 0.2 µM |
| dbacp07876 | R-Lycosin I derivative 8b | RGWFRAMRSIARFIARERLRGHL | Monosaccharide Analogue of Anticancer Peptide R-Lycosin-I | GLUT1-mediated uptake enhances cytotoxicity | CCK-8 assay | PC-3 | Prostate Cancer | IC50 = 4.9 ± 0.2 µM |
| dbacp08078 | APETx4 | GTTCYCGKTIGIYWFGKYSCPTNRGYTGSCPYFLGICCYPVD | Anthopleura elegantissima | Not Available | CellTox Green Dye assay | SH-SY5Y | Brain Tumor | Green object count = 400 /mm2 at 20 μM |
| dbacp08079 | APETx4 | GTTCYCGKTIGIYWFGKYSCPTNRGYTGSCPYFLGICCYPVD | Anthopleura elegantissima | Not Available | CellTox Green Dye assay | LNCaP | Prostate Cancer | Green object count = 300 /mm2 at 20 μM |
| dbacp08080 | APETx4 | GTTCYCGKTIGIYWFGKYSCPTNRGYTGSCPYFLGICCYPVD | Anthopleura elegantissima | Not Available | CellTox Green Dye assay | MDA-MB-435S | Skin Cancer | Green object count < 100 /mm2 at 20 μM |