dbACP: A Comprehensive Database of Anti-Cancer Peptides

203 result(s) have been found!

Accession Name Sequence Source/Organism Mechanism Assay Type Cell Line Cancer Type Activity
dbacp00308 (ATAP) Amphipathic tail-anchoring peptide of Bfl-1 KFEPKSGWMTFLEVTGKICEMLSLLKQYC Anti apoptotic (MCL-1, BFL1) Apoptosis inducing Not specified HeLa Not found Not found
dbacp00760 9S1R RRRRRWCMNW Nullomer derived anticancer peptides (NulloPs) Cell membrane disintegration; Apoptosis MTT/MTS assay HUT-102 Lymphoma cancer IC50 : 43 µM
dbacp00761 9S1R RRRRRWCMNW Nullomer derived anticancer peptides (NulloPs) Cell membrane disintegration; Apoptosis MTT/MTS assay HUT-102 Lymphoma cancer IC50 : 45 µM
dbacp00762 9S1R RRRRRWCMNW Nullomer derived anticancer peptides (NulloPs) Cell membrane disintegration; Apoptosis MTT/MTS assay HUT-102 Lymphoma cancer IC50 : 36 µM
dbacp00763 9S1R RRRRRWCMNW Nullomer derived anticancer peptides (NulloPs) Cell membrane disintegration; Apoptosis MTT/MTS assay J774A.1 Tumor IC50 : 26 µM
dbacp00764 9S1R RRRRRWCMNW Nullomer derived anticancer peptides (NulloPs) Cell membrane disintegration; Apoptosis MTT/MTS assay J774A.1 Tumor IC50 : 17 µM
dbacp00979 Adenoregulin GLWSKIKEVGKEAAKAAAKAAGKAALGAVSEAV South American frog, Giant leaf frog Cell membrane disintegration LDH leakage assay PC-3 Prostate cancer GI50 : 1.24 ± 0.23 µM
dbacp00980 Adenoregulin GLWSKIKEVGKEAAKAAAKAAGKAALGAVSEAV South American frog, Giant leaf frog Cell membrane disintegration LDH leakage assay LNCaP Prostate cancer GI50 : 0.31 ± 0.15 µM
dbacp00981 Adenoregulin GLWSKIKEVGKEAAKAAAKAAGKAALGAVSEAV South American frog, Giant leaf frog Cell membrane disintegration LDH leakage assay DU-145 Liver cancer GI50 : 0.91 ± 0.04 µM
dbacp00982 Adenoregulin GLWSKIKEVGKEAAKAAAKAAGKAALGAVSEAV South American frog, Giant leaf frog Cell membrane disintegration LDH leakage assay MDA-MB-231 Breast cancer GI50 : 8.06 ± 0.50 µM
dbacp00983 Adenoregulin GLWSKIKEVGKEAAKAAAKAAGKAALGAVSEAV South American frog, Giant leaf frog Cell membrane disintegration LDH leakage assay Raji Lymphoma cancer GI50 : 2.57 ± 0.75 µM
dbacp01157 Anthopleura anjunae anti-tumor peptide YVPGP Sea anemone anti-tumor peptide Apoptosis inducing MTT Cell Proliferation and Cytotoxicity assay DU-145 Prostate cancer IC50 : 9.605 μM
dbacp01193 ATAP-iRGD peptide-Parental KFEPKSGWMTFLEVTGKIAEMLSLLKQYCRGDKGPDC Anti apoptotic (MCL-1, BFL1) Inducing apoptosis MTT assay DU-145 Prostate cancer IC50 : 1.6 μM
dbacp01194 ATAP-iRGD-M1 AFEPKSGWMTFLEVTGKIAEMLSLLKQYCRGDKGPDC Anti apoptotic (MCL-1, BFL1) Inducing apoptosis MTT assay DU-145 Prostate cancer IC50 : 36 μM
dbacp01195 ATAP-iRGD-M2 LFEPKSGWMTFLEVTGKIAEMLSLLKQYCRGDKGPDC Anti apoptotic (MCL-1, BFL1) Inducing apoptosis MTT assay DU-145 Prostate cancer IC50 : 68 μM
dbacp01196 ATAP-iRGD-M3 KFEPLSGWMTFLEVTGKIAEMLSLLKQYCRGDKGPDC Anti apoptotic (MCL-1, BFL1) Inducing apoptosis MTT assay DU-145 Prostate cancer IC50 : 25 μM
dbacp01197 ATAP-iRGD-M5 KFEPKSGWETFLEVTGKIAEMLSLLKQYCRGDKGPDC Anti apoptotic (MCL-1, BFL1) Inducing apoptosis MTT assay DU-145 Prostate cancer IC50 : 6 μM
dbacp01198 ATAP-iRGD-M6 KKFEPKSGWMTFLEVTGKIAEMLSLLKQYCRGDKGPDC Anti apoptotic (MCL-1, BFL1) Inducing apoptosis MTT assay DU-145 Prostate cancer IC50 : 3.1 μM
dbacp01199 ATAP-iRGD-M7 KFEPKSGWMTFLEVTGKIAEMLSLLKQYCRGDKGPDC Anti apoptotic (MCL-1, BFL1) Inducing apoptosis MTT assay DU-145 Prostate cancer IC50 : 2.1 μM
dbacp01200 ATAP-iRGD-M8 KKFEPKSGWMTFLEVTGKIAEMLSLLKQYCRGDKGPDC Anti apoptotic (MCL-1, BFL1) Inducing apoptosis MTT assay DU-145 Prostate cancer IC50 : 2.1 μM
dbacp01445 Baceridin WAIVLL Plant-associated rod-shaped, Gram-positive bacteria Apoptosis inducing MTT assay HCT116 Not specified Not found
dbacp01446 Baceridin WAIVLL Plant-associated rod-shaped, Gram-positive bacteria Apoptosis inducing MTT assay RKO Not specified Not found
dbacp01447 Baceridin WAIVLL Plant-associated rod-shaped, Gram-positive bacteria Apoptosis inducing MTT assay HeLa Not specified Not found
dbacp02164 C7A KILRGVAKKILRTFLRRISKDILTGKK NK-2 variants Physical membrane disruption MTT/MTS assay E42/02 Skin cancer IC50 : 10.6 ± 0.4 µM
dbacp02165 C7A KILRGVAKKILRTFLRRISKDILTGKK NK-2 variants Physical membrane disruption MTT/MTS assay E42/02 Skin cancer IC50 : 13.0 ± 1.0 µM
dbacp02166 C7A KILRGVAKKILRTFLRRISKDILTGKK NK-2 variants Physical membrane disruption MTT/MTS assay E42/02 Skin cancer IC50 : 12.1 ± 1.6 µM
dbacp02167 C7A KILRGVAKKILRTFLRRISKDILTGKK NK-2 variants Physical membrane disruption MTT/MTS assay E42/02 Skin cancer IC50 : 3.7 ± 4.3 µM
dbacp02185 C7A-D21k KILRGVAKKIMRTFLRRISKKILTGKK NK-2 variants Physical membrane disruption MTT/MTS assay E42/02 Skin cancer IC50 : 8.4 ± 0.2 µM
dbacp02186 C7A-D21k KILRGVAKKIMRTFLRRISKKILTGKK NK-2 variants Physical membrane disruption MTT/MTS assay E42/02 Skin cancer IC50 : 12.3 ± 2.0 µM
dbacp02187 C7A-D21k KILRGVAKKIMRTFLRRISKKILTGKK NK-2 variants Physical membrane disruption MTT/MTS assay E42/02 Skin cancer IC50 : 8.3 ± 0.5 µM
dbacp02188 C7A-D21k KILRGVAKKIMRTFLRRISKKILTGKK NK-2 variants Physical membrane disruption MTT/MTS assay E42/02 Skin cancer IC50 : 12.3 ± 1.0 µM
dbacp02202 C7A-Δ KILRGVAKKIMRTFLRRILTGKK NK-2 variants Physical membrane disruption MTT/MTS assay E42/02 Skin cancer IC50 : 7.5 ± 0.4 µM
dbacp02203 C7A-Δ KILRGVAKKIMRTFLRRILTGKK NK-2 variants Physical membrane disruption MTT/MTS assay E42/02 Skin cancer IC50 : 13.8 ± 2.0 µM
dbacp02204 C7A-Δ KILRGVAKKIMRTFLRRILTGKK NK-2 variants Physical membrane disruption MTT/MTS assay E42/02 Skin cancer IC50 : 9.3 ± 1.5 µM
dbacp02205 C7A-Δ KILRGVAKKIMRTFLRRILTGKK NK-2 variants Physical membrane disruption MTT/MTS assay E42/02 Skin cancer IC50 : 13.1 ± 0.9 µM
dbacp02293 Carcinoembryonic antigen glypican-3 GPC3(144-152) FVGEFFTDV Carcinoembryonic antigen glypican-3 GPC3(144-152) Immune response to tumor cell recognition Cytotoxicity assay HepG2 Not specified Not found
dbacp02294 Carcinoembryonic antigen glypican-3 GPC3(144-152) FVGEFFTDV Carcinoembryonic antigen glypican-3 GPC3(144-152) Immune response to tumor cell recognition Cytotoxicity assay G-401 Wilm's tumor Not found
dbacp02295 Carcinoembryonic antigen glypican-3 GPC3(144-152) FVGEFFTDV Carcinoembryonic antigen glypican-3 GPC3(144-152) Immune response to tumor cell recognition Cytotoxicity assay SK-N-DZ Wilm's tumor Not found
dbacp02296 Carcinoembryonic antigen glypican-3 GPC3(144-152) FVGEFFTDV Carcinoembryonic antigen glypican-3 GPC3(144-152) Immune response to tumor cell recognition Cytotoxicity assay HuH-6 Wilm's tumor Not found
dbacp02297 Carcinoembryonic antigen glypican-3 GPC3(298-306) EYILSLEEL Carcinoembryonic antigen glypican-3 GPC3(298-306) Immune response to tumor cell recognition Cytotoxicity assay MDA-MB-231 Not specified Not found
dbacp02298 Carcinoembryonic antigen glypican-3 GPC3(298-306) EYILSLEEL Carcinoembryonic antigen glypican-3 GPC3(298-306) Immune response to tumor cell recognition Cytotoxicity assay MCF-7 Not specified Not found
dbacp02338 Cecropin A KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK Isolated from the giant silk moth, cecropia moth Membrane damage; Apoptotic cell death; Necrosis MTT/MTS assay SCC12 Skin cancer IC50 : 1 µM
dbacp02339 Cecropin A KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK Isolated from the giant silk moth, cecropia moth Membrane damage; Apoptotic cell death; Necrosis MTT/MTS assay SCC25 Skin cancer IC50 : 2.2 µM
dbacp02340 Cecropin A KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK Isolated from the giant silk moth, cecropia moth Membrane damage; Apoptotic cell death; Necrosis Cell viability assay SCC25 Skin cancer 0.6 ± 0.6% cell growth inhibition at 10 µM
dbacp02341 Cecropin A KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK Isolated from the giant silk moth, cecropia moth Membrane damage; Apoptotic cell death; Necrosis Cell viability assay SCC25 Skin cancer 107.0 ± 5.0% cell growth inhibition at 1 µM
dbacp02343 Cecropin A KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK Giant silk moth, cecropia moth Cell membrane disintegration Not specified Not found Not found Not found
dbacp02472 Chickpea peptide ADLPGLK Plant sources Inducing apoptosis SRB assay A-549 Human endometrial cancer IC50 : 126.4 ± 1.98 µM
dbacp02473 Chickpea peptide ADLPGLK Plant sources Inducing apoptosis SRB assay HepG-2 Human endometrial cancer IC50 : 113.7 ± 0.99 µM
dbacp02474 Chickpea peptide ADLPGLK Plant sources Inducing apoptosis SRB assay Ishikawa Human endometrial cancer IC50 : 101.5 ± 1.83 µM
dbacp02475 Chickpea peptide ADLPGLK Plant sources Inducing apoptosis SRB assay MCF-7 Human endometrial cancer IC50 : 110.3 ± 2.97µM
dbacp02476 Chickpea peptide ADLPGLK Plant sources Inducing apoptosis SRB assay MDA-MB-231 Human endometrial cancer IIC50 : 107.2 ± 1.62µM
dbacp02477 Chickpea peptide ADLPGLK Plant sources Inducing apoptosis SRB assay PA-1 Human endometrial cancer IC50 : 133.4 ± 0.70µM
dbacp02655 Dermaseptin-B2 GLWSKIKEVGKEAAKAAAKAAGKAALGAVSEAV Giant leaf frog Immunomodulatory properties Cytotoxicity assays, Cell Titer-Glo Luminescent Cell viability assay A549 Lung adenocarcinoma LC50 : < 12 μM
dbacp02656 Dermaseptin-B2 GLWSKIKEVGKEAAKAAAKAAGKAALGAVSEAV Giant leaf frog Immunomodulatory properties Cytotoxicity assays, Cell Titer-Glo Luminescent Cell viability assay MDA-MB-231 Breast adenocarcinoma LC50 : < 12 μM
dbacp02657 Dermaseptin-B2 GLWSKIKEVGKEAAKAAAKAAGKAALGAVSEAV Giant leaf frog Immunomodulatory properties Cytotoxicity assays, Cell Titer-Glo Luminescent Cell viability assay HT-29 Colorectal adenocarcinoma LC50 : < 12 μM
dbacp02658 Dermaseptin-B2 GLWSKIKEVGKEAAKAAAKAAGKAALGAVSEAV Skin, Giant leaf frog, South America Selective lysis of cellular membrane Enzyme immunoassay, Antifungal bioassay Not found Not specified Not found
dbacp02659 Dermaseptin-B3 ALWKnMLKGIGKLAGQAALGAVKTLVGAE Giant leaf frog Membrane lysis In vitro proliferation assay, Soft agar assay PC-3 Human epithelial prostate adenocarcinoma EC50 : 2 μM
dbacp02660 Dermaseptin-B3 ALWKnMLKGIGKLAGQAALGAVKTLVGA South American frog, Giant leaf frog Apoptosis inducing Thymidine Incorporation assay MCF-7 Breast cancer Not found
dbacp02661 Dermaseptin-B4 ALWKDILKNVGKAAGKAVLNTVTDMVNQ Giant leaf frog Apoptosis inducing Thymidine Incorporation assay MCF-7 Breast cancer Not found
dbacp02742 Dermaseptins B2 GLWSKIKEVGKEAAKAAAKAAGKAALGAVSEAV-NH2 Giant leaf frog Interact with the lipids of the plasma membrane In vitro proliferation assay, Lactate dehydrogenase (LDH)-release assay PC3 Human breast cancer GI50 : 2.17 ± 0.48 μM
dbacp02743 Dermaseptins B2 GLWSKIKEVGKEAAKAAAKAAGKAALGAVSEAV-NH3 Giant leaf frog Interact with the lipids of the plasma membrane In vitro proliferation assay, Lactate dehydrogenase (LDH)-release assay U87MG Human lung cancer GI50 : >10 μM
dbacp02955 Figainin 2BN FLGVALKLGKVLGKALLPLASSLLHSQ Norepinephrine-stimulated skin secretion, the Giant Gladiator Treefrog, the Rusty Treefrog, Trinidad, South America Cell membrane penetration Not specified A549 Lung carcinoma LC50 : 7-14 µM
dbacp02956 Figainin 2BN FLGVALKLGKVLGKALLPLASSLLHSQ Norepinephrine-stimulated skin secretion, the Giant Gladiator Treefrog, the Rusty Treefrog, Trinidad, South America Cell membrane penetration Not specified MDA-MB-231 Breast adenocarcinoma LC50 : 7-14 µM
dbacp02957 Figainin 2BN FLGVALKLGKVLGKALLPLASSLLHSQ Norepinephrine-stimulated skin secretion, the Giant Gladiator Treefrog, the Rusty Treefrog, Trinidad, South America Cell membrane penetration Not specified HT-29 Colon adenocarcinoma LC50 : 7-14 µM
dbacp03122 Gomesin ECRRLCYKQRCVTYCRGR Hemocytes, Tarantula spider sp. Cell membrane disintegration Not specified Not found Breast cancer Not found
dbacp03123 Gomesin QCRRLCYKQRCVTYCRGR Hemocytes, Tarantula spider sp. Cell membrane disintegration Not specified Not found Breast cancer Not found
dbacp03124 Gomesin GCRRLCYKQRCVTYCRGR Tarantula spider sp. Membrane permeabilization Lactate dehydrogenase (LDH) assay U-87 MG Glioblastoma MIC : 10 mM
dbacp03125 Gomesin ZCRRLCYKQRCVTYCRGR Tarantula spider sp. Target and destroy tumor cell membranes Fluorescence-based assay using a Fluorescence Imaging Plate Reader MM96L Epithelial cancer CC50 : 3.7 ± 0.2 μM
dbacp03126 Gomesin ZCRRLCYKQRCVTYCRGR Tarantula spider sp. Target and destroy tumor cell membranes Fluorescence-based assay using a Fluorescence Imaging Plate Reader K-562 Chronic myeloid leukemia CC50 : 3.8 ± 0.3 μM
dbacp03127 Gomesin ZCRRLCYKQRCVTYCRGR Tarantula spider sp. Target and destroy tumor cell membranes Fluorescence-based assay using a Fluorescence Imaging Plate Reader CRL-1739 Gastric cancer CC50 : 67.0 ± 5.0 μM
dbacp03128 Gomesin ZCRRLCYKQRCVTYCRGR Tarantula spider sp. Target and destroy tumor cell membranes Fluorescence-based assay using a Fluorescence Imaging Plate Reader HeLa Cervical cancer CC50 : 54.1 ± 5.0 μM
dbacp03129 Gomesin ZCRRLCYKQRCVTYCRGR Tarantula spider sp. Target and destroy tumor cell membranes Cell viability assay K-562 Epithelial cancer CC50 : 3.8 ± 0.3 μM
dbacp03130 Gomesin ZCRRLCYKQRCVTYCRGR Tarantula spider sp. Target and destroy tumor cell membranes Cell viability assay K-562 Chronic myeloid leukemia CC50 : 3.8 ± 0.3 μM
dbacp03131 Gomesin ZCRRLCYKQRCVTYCRGR Tarantula spider sp. Target and destroy tumor cell membranes Cell viability assay K-562 Gastric cancer CC50 : 3.8 ± 0.3 μM
dbacp03132 Gomesin ZCRRLCYKQRCVTYCRGR Tarantula spider sp. Target and destroy tumor cell membranes Cell viability assay K-562 Breast cancer CC50 : 3.8 ± 0.3 μM
dbacp03133 Gomesin ZCRRLCYKQRCVTYCRGR Tarantula spider sp. Target and destroy tumor cell membranes Cell viability assay K-562 Cervical cancer CC50 : 3.8 ± 0.3 μM
dbacp03134 Gomesin ZCRRLCYKQRCVTYCRGR Tarantula spider sp. Target and destroy tumor cell membranes Cell viability assay CRL-1739 Epithelial cancer CC50 : 67.0 ± 5.0 μM
dbacp03135 Gomesin ZCRRLCYKQRCVTYCRGR Tarantula spider sp. Target and destroy tumor cell membranes Cell viability assay CRL-1739 Chronic myeloid leukemia CC50 : 67.0 ± 5.0 μM
dbacp03136 Gomesin ZCRRLCYKQRCVTYCRGR Tarantula spider sp. Target and destroy tumor cell membranes Cell viability assay CRL-1739 Gastric cancer CC50 : 67.0 ± 5.0 μM
dbacp03137 Gomesin ZCRRLCYKQRCVTYCRGR Tarantula spider sp. Target and destroy tumor cell membranes Cell viability assay CRL-1739 Breast cancer CC50 : 67.0 ± 5.0 μM
dbacp03138 Gomesin ZCRRLCYKQRCVTYCRGR Tarantula spider sp. Target and destroy tumor cell membranes Cell viability assay CRL-1739 Cervical cancer CC50 : 67.0 ± 5.0 μM
dbacp03139 Gomesin ZCRRLCYKQRCVTYCRGR Tarantula spider sp. Target and destroy tumor cell membranes Cell viability assay MM96L Epithelial cancer CC50 : 3.7 ± 0.2 μM
dbacp03140 Gomesin ZCRRLCYKQRCVTYCRGR Tarantula spider sp. Target and destroy tumor cell membranes Cell viability assay MM96L Chronic myeloid leukemia CC50 : 3.7 ± 0.2 μM
dbacp03141 Gomesin ZCRRLCYKQRCVTYCRGR Tarantula spider sp. Target and destroy tumor cell membranes Cell viability assay MM96L Gastric cancer CC50 : 3.7 ± 0.2 μM
dbacp03142 Gomesin ZCRRLCYKQRCVTYCRGR Tarantula spider sp. Target and destroy tumor cell membranes Cell viability assay MM96L Breast cancer CC50 : 3.7 ± 0.2 μM
dbacp03143 Gomesin ZCRRLCYKQRCVTYCRGR Tarantula spider sp. Target and destroy tumor cell membranes Cell viability assay MM96L Cervical cancer CC50 : 3.7 ± 0.2 μM
dbacp03144 Gomesin ZCRRLCYKQRCVTYCRGR Tarantula spider sp. Target and destroy tumor cell membranes Cell viability assay HFF-1 Epithelial cancer CC50 : 49.9 ±16.6 μM
dbacp03145 Gomesin ZCRRLCYKQRCVTYCRGR Tarantula spider sp. Target and destroy tumor cell membranes Cell viability assay HFF-1 Chronic myeloid leukemia CC50 : 49.9 ±16.6 μM
dbacp03146 Gomesin ZCRRLCYKQRCVTYCRGR Tarantula spider sp. Target and destroy tumor cell membranes Cell viability assay HFF-1 Gastric cancer CC50 : 49.9 ±16.6 μM
dbacp03147 Gomesin ZCRRLCYKQRCVTYCRGR Tarantula spider sp. Target and destroy tumor cell membranes Cell viability assay HFF-1 Breast cancer CC50 : 49.9 ±16.6 μM
dbacp03148 Gomesin ZCRRLCYKQRCVTYCRGR Tarantula spider sp. Target and destroy tumor cell membranes Cell viability assay HFF-1 Cervical cancer CC50 : 49.9 ±16.6 μM
dbacp03149 Gomesin ZCRRLCYKQRCVTYCRGR Tarantula spider sp. Target and destroy tumor cell membranes Cell viability assay HeLa Epithelial cancer CC50 : 54.1 ± 5.0 μM
dbacp03150 Gomesin ZCRRLCYKQRCVTYCRGR Tarantula spider sp. Target and destroy tumor cell membranes Cell viability assay HeLa Chronic myeloid leukemia CC50 : 54.1 ± 5.0 μM
dbacp03151 Gomesin ZCRRLCYKQRCVTYCRGR Tarantula spider sp. Target and destroy tumor cell membranes Cell viability assay HeLa Gastric cancer CC50 : 54.1 ± 5.0 μM
dbacp03152 Gomesin ZCRRLCYKQRCVTYCRGR Tarantula spider sp. Target and destroy tumor cell membranes Cell viability assay HeLa Breast cancer CC50 : 54.1 ± 5.0 μM
dbacp03153 Gomesin ZCRRLCYKQRCVTYCRGR Tarantula spider sp. Target and destroy tumor cell membranes Cell viability assay HeLa Cervical cancer CC50 : 54.1 ± 5.0 μM
dbacp03387 Interferon gamma (IFN-gamma) MNYTSYILAFQLCVILCSSGYYCQAMFFKEIENLKEYFNASNPDVADGGPLFLDILKNWREESDKTIIQSQIVSFYLKLFENFKDNQIIQRSMDTIKEDMLFKFFNSSTSKRSDFLKLIQIPVNDMQVQRKAINELIKVMNDLSPRSNLRKRKRSQNLFRGRRASK Giant panda Regulation of immune response Whole-blood IFN-gamma assay,Real-time reverse transcription–polymerase chain reaction (RT-PCR) assay HEK293 Renal cancer No activity
dbacp03413 Interferon gamma (IFN-gamma) MKYTSYFLAFQLCVILGSSGSYCQAPFFKEIQNLKEYFNASNPDVAGGGPLFLEILENWKDESDKKIIQSQIVSFYFKLFENLKGNQIIQRSMDIIKQDMFQKFLNGSSEKLDDFKKLIQIPVDDLQIQRKAISELIRVMKDLSPRSNLRKRRRSQNLFRGQRASK Atlantic bottle-nosed dolphin Immunomodulatory activity Not specified Not found Not found Not found
dbacp03443 Interferon gamma (IFN-gamma) MKYTSYFLAFQLCVILGSSGSYCQAPFFKEIQNLKEYFNASNPDVAGGGPLFLEILENWKDESDKKIIQSQIVSFYFKLFENLKGNQIIQRSMDIIKQDMFQKFLNGSSEKLDDFKKLIQIPVDDLQIQRKAISELIRVMKDLSPRSNLRKRRRSQNLFRGQRASK Atlantic bottle-nosed dolphin Immunomodulatory activity Not specified Not found Not found Not found
dbacp03446 Interferon gamma (IFN-gamma) MNFTSYILAFQLCIILGSSSCCCQATFLKEIQNLKEYLNATDSDVADGGPLFIDILKNWKEDSDKKIIQSQIVSFYLEIFDNLKDNQVIQESVKTLEEDLFVKFFNSSSSKRDDFLKVMQTPVNDRNVQRKAISELSKVMNDLSHRSNGAKRKRRQYSFRGRRAST Indian elephant Immunoregulation Not specified Not found Not found Not found
dbacp03720 LCP-3 WLHV Plant sources Inducing apoptosis Not specified Caco-2 Not specified Not found
dbacp04103 linear (RW)4-Dox RWRWRWRW Doxorubicin (Dox) is a well-known anthracycline which has been conjugated to a CPP Inhibition of the cell proliferation MTT/MTS assay CCRF-CEM Leukemia cancer 46-69% anti-proliferative activity at 1 µM
dbacp04104 linear (RW)4-Dox RWRWRWRW Doxorubicin (Dox) is a well-known anthracycline which has been conjugated to a CPP Inhibition of the cell proliferation MTT/MTS assay SK-OV-3 Ovarian cancer 28-34% anti-proliferative activity at 1 µM
dbacp04105 linear (RW)4-Dox RWRWRWRW Doxorubicin (Dox) is a well-known anthracycline which has been conjugated to a CPP Inhibition of the cell proliferation MTT/MTS assay HCT-116 Colon cancer 21-61% anti-proliferative activity at 1 µM
dbacp04106 linear (RW)4-Dox RWRWRWRW Doxorubicin (Dox) is a well-known anthracycline which has been conjugated to a CPP Inhibition of the cell proliferation MTT/MTS assay MDA-MB-468 Breast cancer 60-74% anti-proliferative activity at 1 µM
dbacp04309 Lunasin SKWQHQQDSCRKQLQGVNLTPCEKHIMEKIQGRDDDDDDDDDD Plant sources Inducing apoptosis MTT assay HCT116-derived spheres Colorectal cancer IC50 : 161.0 ± 2.4 μM
dbacp04310 Lunasin SKWQHQQDSCRKQLQGVNLTPCEKHIMEKIQGRDDDDDDDDDD Plant sources Inducing apoptosis MTT assay HCT-116 parentl Colorectal cancer IC50 : 107.5 ± 1.9 μM
dbacp04337 LVTX-8 IWLTALKFLGKNLGKHLAKQQLSKL-NH2 True tarantula Promote apoptosis; Inhibits the proliferation and migration of lung cancer cells both in vitro and in vivo CCK-8 assay, Flow cytometry, Colony formation assay, Transwell invasion and migration assay A549 Lung cancer IC50 : approx. 8 µM
dbacp04338 LVTX-8 IWLTALKFLGKNLGKHLAKQQLSKL-NH2 True tarantula Promote apoptosis; Inhibits the proliferation and migration of lung cancer cells both in vitro and in vivo CCK-8 assay, Flow cytometry, Colony formation assay, Transwell invasion and migration assay H461 Lung cancer IC50 : approx. 8 µM
dbacp04339 LVTX-9 ASIGALIQKAIALIKAKAA-NH2 True tarantula Promote apoptosis; Inhibits the proliferation and migration of lung cancer cells both in vitro and in vivo CCK-8 assay, Flow cytometry, Colony formation assay, Transwell invasion and migration assay A549 Lung cancer IC50 : approx. 8 µM
dbacp04340 LVTX-9 ASIGALIQKAIALIKAKAA-NH2 True tarantula Promote apoptosis; Inhibits the proliferation and migration of lung cancer cells both in vitro and in vivo CCK-8 assay, Flow cytometry, Colony formation assay, Transwell invasion and migration assay H460 Lung cancer IC50 : approx. 8 µM
dbacp04341 Lycosin-1 Ac-KGWFKAMKSIAKFIAKEKLKEHL-amide Tarantula wolf spider Inhibit the migration of prostate cancer cell; Induce apoptosis MTT assay DU-145 Prostate cancer MIC : 10 μM
dbacp04342 Lycosin-1 Ac-KGWFKAMKSIAKFIAKEKLKEHL-amide Tarantula wolf spider Inhibit the migration of prostate cancer cell; Induce apoptosis MTT assay PC-3 Prostate cancer MIC : 20 μM
dbacp04541 Malanin chain A DYPKLTFTTS Plant sources Inducing apoptosis MTT assay HeLa Cervical cancer IC50 : 0.15 ± 0.08 nM
dbacp04542 Malanin chain A DYPKLTFTTS Plant sources Inducing apoptosis MTT assay PC-12 Breast cancer IC50 : 7.71 ± 0.24 nM
dbacp04543 Malanin chain A DYPKLTFTTS Plant sources Inducing apoptosis MTT assay MCF-7 Leukemia IC50 : 11.20 ± 0.02 nM
dbacp04544 Malanin chain A DYPKLTFTTS Plant sources Inducing apoptosis MTT assay K562 Not found IC50 : 15.80 ± 0.09 nM
dbacp04545 Malanin chain A DYPKLTFTTS Plant sources Inducing apoptosis MTT assay Vero Not found IC50 : 2.79 ± 0.05 nM
dbacp04546 Malanin chain A DYPKLTFTTS Plant sources Inducing apoptosis MTT assay MDCK Not found IC50 : 3.92 ± 0.01 nM
dbacp04547 Malanin chain B DETCTDEEFN Plant sources Inducing apoptosis MTT assay HeLa Cervical cancer IC50 : 0.15 ± 0.08 nM
dbacp04548 Malanin chain B DETCTDEEFN Plant sources Inducing apoptosis MTT assay PC-12 Breast cancer IC50 : 7.71 ± 0.24 nM
dbacp04549 Malanin chain B DETCTDEEFN Plant sources Inducing apoptosis MTT assay MCF-7 Leukemia IC50 : 11.20 ± 0.02 nM
dbacp04550 Malanin chain B DETCTDEEFN Plant sources Inducing apoptosis MTT assay K562 Not found IC50 : 15.80 ± 0.09 nM
dbacp04551 Malanin chain B DETCTDEEFN Plant sources Inducing apoptosis MTT assay Vero Not found IC50 : 2.79 ± 0.05 nM
dbacp04552 Malanin chain B DETCTDEEFN Plant sources Inducing apoptosis MTT assay MDCK Not found IC50 : 3.92 ± 0.01 nM
dbacp04629 MCL-1, BH3 (208-228) KALETLRRVGDGVQRNHETAF Anti apoptotic (MCL-1, BFL1) Inducing apoptosis Not specified Not found Blood cancer Not found
dbacp04630 MCL-1, BH3 (208-228) KALETLRRVGDGVQRNHETAF Anti apoptotic (MCL-1, BFL1) Inducing apoptosis Not specified Not found Leukemia Not found
dbacp04631 MCL-1, BH3 (208-228) KALETLRRVGDGVQRNHETAF Anti apoptotic (MCL-1, BFL1) Inducing apoptosis Not specified Not found Skin cancer Not found
dbacp04632 MCL-1, BH3 (208-228) KALETLRRVGDGVQRNHETAF Anti apoptotic (MCL-1, BFL1) Inducing apoptosis Not specified Not found Breast cancer Not found
dbacp04693 MIPP SLSLSVAR Plant sources Inducing apoptosis SRB assay HeLa Human endometrial cancer Not found
dbacp05055 P2 RALGWSCL Plant sources Inducing apoptosis MTS assay NB4 Not specified IC50 : 600 μg/mL
dbacp05056 P2 RALGWSCL Plant sources Inducing apoptosis MTS assay MOLT4 Not specified IC50 : 700 μg/mL
dbacp05057 P2 RALGWSCL Plant sources Inducing apoptosis MTS assay Raji Not specified IC50 : 700 μg/Ml
dbacp05127 PaDef ATCETPSKHFNGLCIRSSNCASVCHGEHFTDGRCQGVRRRCMCLKPC Plant sources Inducing apoptosis MTT assay Jurkat Leukemia Not found
dbacp05215 PcTx-1 EDCIPKWKGCVNRHGDCCEGLECWKRRRSFEVCVPKTPKTOHa Trinidad chevron tarantula Membrane permeabilization Transwell Migration assay, Scratch wound migration assay D54-MG Glioma Not found
dbacp05400 Peptide from Lentinus Squarrosulus RYGFTEVAGNFQQHNFGRG Plant sources Inducing apoptosis MTT assay H460 Breast cancer Not found
dbacp05401 Peptide from Lentinus Squarrosulus RYGFTEVAGNFQQHNFGRG Plant sources Inducing apoptosis MTT assay DPCs Breast cancer Not found
dbacp05402 Peptide from Lentinus Squarrosulus RYGFTEVAGNFQQHNFGRG Plant sources Inducing apoptosis MTT assay HK-2 Breast cancer Not found
dbacp05502 PHP ITCPQVTQSLAPCVPYLISG Plant sources Inducing apoptosis MTT assay Eca-109 Not found IC50 : 0.7 µM
dbacp05503 PHP ITCPQVTQSLAPCVPYLISG Plant sources Inducing apoptosis MTT assay HeLa Not found IC50 : 2.74 µM
dbacp05504 PHP ITCPQVTQSLAPCVPYLISG Plant sources Inducing apoptosis MTT assay MGC-7 Not found IC50 : 3.13 µM
dbacp05505 PHP ITCPQVTQSLAPCVPYLISG Plant sources Inducing apoptosis MTT assay B16 Not found IC50 : 1.47 µM
dbacp05555 Picturin 1BN GIFKDTLKKVVAAVLTTVADNIHPK Norepinephrine-stimulated skin secretion, the Giant Gladiator Treefrog, the Rusty Treefrog, Trinidad, South America Cell membrane penetration Not specified A549 Lung carcinoma LC50 : 7 - 14 µM
dbacp05556 Picturin 1BN GIFKDTLKKVVAAVLTTVADNIHPK Norepinephrine-stimulated skin secretion, the Giant Gladiator Treefrog, the Rusty Treefrog, Trinidad, South America Cell membrane penetration Not specified MDA-MB-231 Breast adenocarcinoma LC50 : 7 - 14 µM
dbacp05557 Picturin 1BN GIFKDTLKKVVAAVLTTVADNIHPK Norepinephrine-stimulated skin secretion, the Giant Gladiator Treefrog, the Rusty Treefrog, Trinidad, South America Cell membrane penetration Not specified HT-29 Colon adenocarcinoma LC50 : 7 - 14 µM
dbacp05558 Picturin 2BN GLMDMLKKVGKVALTVAKSALLP Norepinephrine-stimulated skin secretion, the Giant Gladiator Treefrog, the Rusty Treefrog, Trinidad, South America Cell membrane penetration Not specified A549 Lung carcinoma LC50 : 7 - 14 µM
dbacp05559 Picturin 2BN GLMDMLKKVGKVALTVAKSALLP Norepinephrine-stimulated skin secretion, the Giant Gladiator Treefrog, the Rusty Treefrog, Trinidad, South America Cell membrane penetration Not specified MDA-MB-231 Breast adenocarcinoma LC50 : 7 - 14 µM
dbacp05560 Picturin 2BN GLMDMLKKVGKVALTVAKSALLP Norepinephrine-stimulated skin secretion, the Giant Gladiator Treefrog, the Rusty Treefrog, Trinidad, South America Cell membrane penetration Not specified HT-29 Colon adenocarcinoma LC50 : 7 - 14 µM
dbacp05561 Pis1 FIHHIIGWISHGVRAIHRAIH Atlantic cod Disruption of membrane Not specified Not found Not found Not found
dbacp05562 Pis2 FLHHIVGLIHHGLSLFGDRAD Atlantic cod Disruption of membrane Not specified Not found Not found Not found
dbacp05564 Piscidin 1 FFHHIFRGIVHVGKTIHRLVTG Mainly mast cells, gill, skin, intestine, spleen, and anterior kidney, hybrid striped bass (Striped bass x White bass) Cell membrane disintegration Not specified Not found Breast cancer Not found
dbacp05587 PNC-28 ETFSDLWKLL Ant Membrane disruption MTT/MTS assay MiaPaCa.2 Pancreatic cancer Cytotoxicity : 80µg/ml
dbacp05596 Polyphemusin II RRWCFRVCYKGFCYRKCR-NH2 Atlantic horseshoe crab Induce necrotic cell death Cell viability assay K562 Human erythroleukemia EC50 : 22 μM
dbacp05597 Polyphemusin III RRGCFRVCYRGFCFQRCR Atlantic horseshoe crab Induce permeabilization of the cytoplasmic membrane Trypan blue exclusion assay and Lactate dehydrogenase(LDH)-release assay HL-60 Human cervical cancer IC50 : < 10 μM
dbacp05863 RA-V cyclopeptideRA-V-,cyclo(YAAYAY) Plant sources Inducing apoptosis MTT assay MCF-7 Breast cancer Not found
dbacp05864 RA-V cyclopeptideRA-V-,cyclo(YAAYAY) Plant sources Inducing apoptosis MTT assay MDA-MB-231 Breast cancer Not found
dbacp05865 RA-V cyclopeptideRA-V-,cyclo(YAAYAY) Plant sources Inducing apoptosis MTT assay 4T1 Breast cancer Not found
dbacp06021 SALF Ac-ECKFTVKPYLKRFQVYYKGRMWCPNH2 Giant tiger prawn Regulate apoptosis related death receptor/NF-κB signaling pathway MTT assay HeLa Human lung cancer MIC : 100 µg/ml
dbacp06133 SNX-482 GVDKAGCRYMFGGCSVNDDCCPRLGCHSLFSYCAWDLTFSDOHa Giant baboon spider Immunomodulatory properties Not specified Not found Not found Not found
dbacp06532 VS-9 VKLRSLLCS Plant sources Inducing apoptosis MTT assay MOLT4 Leukemia Not found
dbacp06533 VS-9 VKLRSLLCS Plant sources Inducing apoptosis MTT assay K562 Leukemia Not found
dbacp06793 CPSA-CPSC-L-ACAN Not Available Recombinant Fusion Peptide Apoptosis inducing MTT assay HeLa Cervical Cancer IC50 = 63.15 μg/ml
dbacp07102 rScyreprocin MKEDSNILDKTAKMTKQNKALLFTAGGAAAFMAGYYYYHCNYRNPAPKKSGSTTSQDKTDAQAVQSIPSPSGNKGKESKDPKVKHHHHHH Recombinant product of Scyreprocin Membrane disruption triggers ROS-mediated apoptosis MTS assay H-460 Lung Cancer IC50 = 6.27 µM
dbacp07103 rScyreprocin MKEDSNILDKTAKMTKQNKALLFTAGGAAAFMAGYYYYHCNYRNPAPKKSGSTTSQDKTDAQAVQSIPSPSGNKGKESKDPKVKHHHHHH Recombinant product of Scyreprocin Membrane disruption triggers ROS-mediated apoptosis MTS assay HepG-2 Liver Cancer IC50 = 441.01 µM
dbacp07104 rScyreprocin MKEDSNILDKTAKMTKQNKALLFTAGGAAAFMAGYYYYHCNYRNPAPKKSGSTTSQDKTDAQAVQSIPSPSGNKGKESKDPKVKHHHHHH Recombinant product of Scyreprocin Membrane disruption triggers ROS-mediated apoptosis MTS assay T-24 Urinary Bladder Cancer IC50 = 1.94 x 105 µM
dbacp07105 rScyreprocin MKEDSNILDKTAKMTKQNKALLFTAGGAAAFMAGYYYYHCNYRNPAPKKSGSTTSQDKTDAQAVQSIPSPSGNKGKESKDPKVKHHHHHH Recombinant product of Scyreprocin Membrane disruption triggers ROS-mediated apoptosis MTS assay DU-145 Prostate cancer IC50 = 1158.30 µM
dbacp07106 rScyreprocin MKEDSNILDKTAKMTKQNKALLFTAGGAAAFMAGYYYYHCNYRNPAPKKSGSTTSQDKTDAQAVQSIPSPSGNKGKESKDPKVKHHHHHH Recombinant product of Scyreprocin Membrane disruption triggers ROS-mediated apoptosis MTS assay HeLa Cervical cancer IC50 = 3.34 x 104 µM
dbacp07650 AP1-Z5a FLFKLIPKAIKGLIKAFK Mutant of APR-Z1 Charge–hydrophobicity balance drives apoptosis MTT assay MCF-7 Breast Cancer Graph Figure 2A
dbacp07651 AP1-Z5a FLFKLIPKAIKGLIKAFK Mutant of APR-Z1 Charge–hydrophobicity balance drives apoptosis MTT assay A-375 Skin Cancer Graph Figure 2B
dbacp07652 AP1-Z5a FLFKLIPKAIKGLIKAFK Mutant of APR-Z1 Charge–hydrophobicity balance drives apoptosis MTT assay U-87 Brain Tumor Graph Figure 2C
dbacp07653 AP1-Z5b FLFKLIKHAIKGLIKAFK Mutant of APR-Z1 Charge–hydrophobicity balance drives apoptosis MTT assay MCF-7 Breast Cancer IC50 = 1.037 μM
dbacp07654 AP1-Z5b FLFKLIKHAIKGLIKAFK Mutant of APR-Z1 Charge–hydrophobicity balance drives apoptosis MTT assay A-375 Skin Cancer IC50 = 2.607 μM
dbacp07655 AP1-Z5b FLFKLIKHAIKGLIKAFK Mutant of APR-Z1 Charge–hydrophobicity balance drives apoptosis MTT assay U-87 Brain Tumor IC50 = 3.115 μM
dbacp07656 AP1-Z3a FLFSLIKHAIKGLISAFK Mutant of APR-Z1 Charge–hydrophobicity balance drives apoptosis MTT assay MCF-7 Breast Cancer Graph Figure 2A
dbacp07657 AP1-Z3a FLFSLIKHAIKGLISAFK Mutant of APR-Z1 Charge–hydrophobicity balance drives apoptosis MTT assay A-375 Skin Cancer Graph Figure 2B
dbacp07658 AP1-Z3a FLFSLIKHAIKGLISAFK Mutant of APR-Z1 Charge–hydrophobicity balance drives apoptosis MTT assay U-87 Brain Tumor Graph Figure 2C
dbacp07659 AP1-Z3b FLFSLIKHAISKLISAFK Mutant of APR-Z1 Charge–hydrophobicity balance drives apoptosis MTT assay MCF-7 Breast Cancer Graph Figure 2A
dbacp07660 AP1-Z3b FLFSLIKHAISKLISAFK Mutant of APR-Z1 Charge–hydrophobicity balance drives apoptosis MTT assay A-375 Skin Cancer Graph Figure 2B
dbacp07661 AP1-Z3b FLFSLIKHAISKLISAFK Mutant of APR-Z1 Charge–hydrophobicity balance drives apoptosis MTT assay U-87 Brain Tumor Graph Figure 2C
dbacp07662 AP1-Z7 FLFKLIKKAIKKLIKAFK Mutant of APR-Z1 Charge–hydrophobicity balance drives apoptosis MTT assay MCF-7 Breast Cancer Graph Figure 2A
dbacp07663 AP1-Z7 FLFKLIKKAIKKLIKAFK Mutant of APR-Z1 Charge–hydrophobicity balance drives apoptosis MTT assay A-375 Skin Cancer Graph Figure 2B
dbacp07664 AP1-Z7 FLFKLIKKAIKKLIKAFK Mutant of APR-Z1 Charge–hydrophobicity balance drives apoptosis MTT assay U-87 Brain Tumor Graph Figure 2C
dbacp07665 AP1-Z9 FLFKLIKKKIKKLIKKFK Mutant of APR-Z1 Charge–hydrophobicity balance drives apoptosis MTT assay MCF-7 Breast Cancer Graph Figure 2A
dbacp07666 AP1-Z9 FLFKLIKKKIKKLIKKFK Mutant of APR-Z1 Charge–hydrophobicity balance drives apoptosis MTT assay A-375 Skin Cancer Graph Figure 2B
dbacp07667 AP1-Z9 FLFKLIKKKIKKLIKKFK Mutant of APR-Z1 Charge–hydrophobicity balance drives apoptosis MTT assay U-87 Brain Tumor Graph Figure 2C
dbacp07680 Longicalycinin A FYPFG Dianthus superbus Cyclization enhances apoptosis via lysosomes MTT assay HepG-2 Liver Cancer IC50 = 13.52 µg/ml
dbacp07681 Longicalycinin A FYPFG Dianthus superbus Cyclization enhances apoptosis via lysosomes MTT assay DLA cell line Lung Cancer CTC50 = 2.62 µM
dbacp07682 Longicalycinin A FYPFG Dianthus superbus Cyclization enhances apoptosis via lysosomes MTT assay EAC cell Line Breast Cancer CTC50 = 6.17 µM
dbacp07865 R-Lycosin I derivative 8a RGWFRAMRSIARFIARERLRGHL Monosaccharide Analogue of Anticancer Peptide R-Lycosin-I GLUT1-mediated uptake enhances cytotoxicity CCK-8 assay MDA-MB-231 Breast Cancer IC50 = 10.1 ± 0.2 µM
dbacp07866 R-Lycosin I derivative 8a RGWFRAMRSIARFIARERLRGHL Monosaccharide Analogue of Anticancer Peptide R-Lycosin-I GLUT1-mediated uptake enhances cytotoxicity CCK-8 assay A-549 Lung Cancer IC50 = 9.6 ± 0.3 µM
dbacp07867 R-Lycosin I derivative 8a RGWFRAMRSIARFIARERLRGHL Monosaccharide Analogue of Anticancer Peptide R-Lycosin-I GLUT1-mediated uptake enhances cytotoxicity CCK-8 assay H-460 Lung Cancer IC50 = 8.5 ± 0.4 µM
dbacp07868 R-Lycosin I derivative 8a RGWFRAMRSIARFIARERLRGHL Monosaccharide Analogue of Anticancer Peptide R-Lycosin-I GLUT1-mediated uptake enhances cytotoxicity CCK-8 assay H-1437 Lung Cancer IC50 = 13.0 ± 0.2 µM
dbacp07869 R-Lycosin I derivative 8a RGWFRAMRSIARFIARERLRGHL Monosaccharide Analogue of Anticancer Peptide R-Lycosin-I GLUT1-mediated uptake enhances cytotoxicity CCK-8 assay HGC-27 Gastric Cancer IC50 = 12.6 ± 0.6 µM
dbacp07870 R-Lycosin I derivative 8a RGWFRAMRSIARFIARERLRGHL Monosaccharide Analogue of Anticancer Peptide R-Lycosin-I GLUT1-mediated uptake enhances cytotoxicity CCK-8 assay PC-3 Prostate Cancer IC50 = 6.9 ± 0.4 µM
dbacp07871 R-Lycosin I derivative 8b RGWFRAMRSIARFIARERLRGHL Monosaccharide Analogue of Anticancer Peptide R-Lycosin-I GLUT1-mediated uptake enhances cytotoxicity CCK-8 assay MDA-MB-231 Breast Cancer IC50 = 6.0 ± 0.2 µM
dbacp07872 R-Lycosin I derivative 8b RGWFRAMRSIARFIARERLRGHL Monosaccharide Analogue of Anticancer Peptide R-Lycosin-I GLUT1-mediated uptake enhances cytotoxicity CCK-8 assay A-549 Lung Cancer IC50 = 7.0 ± 0.3 µM
dbacp07873 R-Lycosin I derivative 8b RGWFRAMRSIARFIARERLRGHL Monosaccharide Analogue of Anticancer Peptide R-Lycosin-I GLUT1-mediated uptake enhances cytotoxicity CCK-8 assay H-460 Lung Cancer IC50 = 4.9 ± 0.9 µM
dbacp07874 R-Lycosin I derivative 8b RGWFRAMRSIARFIARERLRGHL Monosaccharide Analogue of Anticancer Peptide R-Lycosin-I GLUT1-mediated uptake enhances cytotoxicity CCK-8 assay H-1437 Lung Cancer IC50 = 5.3 ± 0.2 µM
dbacp07875 R-Lycosin I derivative 8b RGWFRAMRSIARFIARERLRGHL Monosaccharide Analogue of Anticancer Peptide R-Lycosin-I GLUT1-mediated uptake enhances cytotoxicity CCK-8 assay HGC-27 Gastric Cancer IC50 = 5.3 ± 0.2 µM
dbacp07876 R-Lycosin I derivative 8b RGWFRAMRSIARFIARERLRGHL Monosaccharide Analogue of Anticancer Peptide R-Lycosin-I GLUT1-mediated uptake enhances cytotoxicity CCK-8 assay PC-3 Prostate Cancer IC50 = 4.9 ± 0.2 µM
dbacp08078 APETx4 GTTCYCGKTIGIYWFGKYSCPTNRGYTGSCPYFLGICCYPVD Anthopleura elegantissima Not Available CellTox Green Dye assay SH-SY5Y Brain Tumor Green object count = 400 /mm2 at 20 μM
dbacp08079 APETx4 GTTCYCGKTIGIYWFGKYSCPTNRGYTGSCPYFLGICCYPVD Anthopleura elegantissima Not Available CellTox Green Dye assay LNCaP Prostate Cancer Green object count = 300 /mm2 at 20 μM
dbacp08080 APETx4 GTTCYCGKTIGIYWFGKYSCPTNRGYTGSCPYFLGICCYPVD Anthopleura elegantissima Not Available CellTox Green Dye assay MDA-MB-435S Skin Cancer Green object count < 100 /mm2 at 20 μM