dbACP: A Comprehensive Database of Anti-Cancer Peptides

559 result(s) have been found!

Accession Name Sequence Source/Organism Mechanism Assay Type Cell Line Cancer Type Activity
dbacp00028 Enkephalins7 analogue-8 YA* Synthetic Peptide Apoptosis inducing MTT/MTS assay HEp-2 Larynx cancer 14.2% inhibition at 10-6 M
dbacp00029 Enkephalins7 analogue-8 YA* Synthetic Peptide Apoptosis inducing MTT/MTS assay HEp-2 Larynx cancer 19.7% inhibition at 10-5 M
dbacp00030 Enkephalins7 analogue-8 YA* Synthetic Peptide Apoptosis inducing MTT/MTS assay HEp-2 Larynx cancer 24.9% inhibition at 10-4 M
dbacp00031 Enkephalins7 analogue-8 YA* Synthetic Peptide Apoptosis inducing MTT/MTS assay HEp-2 Larynx cancer 30.4% inhibition at 10-3 M
dbacp00032 Enkephalins7 analogue-8 YA* Synthetic Peptide Apoptosis inducing MTT/MTS assay HeLa Cervical cancer 10% inhibition at 10-5 M
dbacp00033 Enkephalins7 analogue-8 YA* Synthetic Peptide Apoptosis inducing MTT/MTS assay HeLa Cervical cancer 8.2% inhibition at 10-4 M
dbacp00034 Enkephalins7 analogue-8 YA* Synthetic Peptide Apoptosis inducing MTT/MTS assay HeLa Cervical cancer 36.1% inhibition at 10-3 M
dbacp00035 Enkephalins7 analogue-8 YA* Synthetic Peptide Apoptosis inducing MTT/MTS assay HBL Skin cancer 6.5% inhibition at 10-6 M
dbacp00036 Enkephalins7 analogue-8 YA* Synthetic Peptide Apoptosis inducing MTT/MTS assay HBL Skin cancer 14% inhibition at 10-5 M
dbacp00037 Enkephalins7 analogue-8 YA* Synthetic Peptide Apoptosis inducing MTT/MTS assay HBL Skin cancer 7.5% inhibition at 10-4 M
dbacp00038 Enkephalins7 analogue-8 YA* Synthetic Peptide Apoptosis inducing MTT/MTS assay HBL Skin cancer 14% inhibition at 10-3 M
dbacp00039 Enkephalins7 analogue-8 YA* Synthetic Peptide Apoptosis inducing MTT/MTS assay HT-29 Colon cancer 9.8% inhibition at 10-6 M
dbacp00040 Enkephalins7 analogue-8 YA* Synthetic Peptide Apoptosis inducing MTT/MTS assay HT-29 Colon cancer 1.6% inhibition at 10-5 M
dbacp00041 Enkephalins7 analogue-8 YA* Synthetic Peptide Apoptosis inducing MTT/MTS assay HT-29 Colon cancer 5.4% inhibition at 10-4 M
dbacp00042 Enkephalins7 analogue-8 YA* Synthetic Peptide Apoptosis inducing MTT/MTS assay HT-29 Colon cancer 26.5% inhibition at 10-3 M
dbacp00043 Enkephalins7 analogue-8 YA* Synthetic Peptide Apoptosis inducing MTT/MTS assay SW-620 Colon cancer 12.9% inhibition at 10-6 M
dbacp00044 Enkephalins7 analogue-8 YA* Synthetic Peptide Apoptosis inducing MTT/MTS assay SW-620 Colon cancer 16.5% inhibition at 10-5 M
dbacp00045 Enkephalins7 analogue-8 YA* Synthetic Peptide Apoptosis inducing MTT/MTS assay SW-620 Colon cancer 28.1% inhibition at 10-4 M
dbacp00046 Enkephalins7 analogue-8 YA* Synthetic Peptide Apoptosis inducing MTT/MTS assay SW-620 Colon cancer 58.2% inhibition at 10-3 M
dbacp00047 Enkephalins7 analogue-8 YA* Synthetic Peptide Apoptosis inducing MTT/MTS assay CaCo-2 Colon cancer 3.5% inhibition at 10-6 M
dbacp00048 Enkephalins7 analogue-8 YA* Synthetic Peptide Apoptosis inducing MTT/MTS assay CaCo-2 Colon cancer 22.7% inhibition at 10-5 M
dbacp00049 Enkephalins7 analogue-8 YA* Synthetic Peptide Apoptosis inducing MTT/MTS assay CaCo-2 Colon cancer 18.9% inhibition at 10-4 M
dbacp00050 Enkephalins7 analogue-8 YA* Synthetic Peptide Apoptosis inducing MTT/MTS assay CaCo-2 Colon cancer 26.4% inhibition at 10-3 M
dbacp00051 Enkephalins7 analogue-8 YA* Synthetic Peptide Apoptosis inducing MTT/MTS assay MCF-7 Breast cancer 2.4% inhibition at 10-5 M
dbacp00052 Enkephalins7 analogue-8 YA* Synthetic Peptide Apoptosis inducing MTT/MTS assay MCF-7 Breast cancer 7.5% inhibition at 10-4 M
dbacp00053 Enkephalins7 analogue-9 YSA* Synthetic Peptide Apoptosis inducing MTT/MTS assay HEp-2 Larynx cancer 6.2% inhibition at 10-6 M
dbacp00054 Enkephalins7 analogue-9 YSA* Synthetic Peptide Apoptosis inducing MTT/MTS assay HEp-2 Larynx cancer 6.4% inhibition at 10-5 M
dbacp00055 Enkephalins7 analogue-9 YSA* Synthetic Peptide Apoptosis inducing MTT/MTS assay HEp-2 Larynx cancer 8.2% inhibition at 10-4 M
dbacp00056 Enkephalins7 analogue-9 YSA* Synthetic Peptide Apoptosis inducing MTT/MTS assay HEp-2 Larynx cancer 21.2% inhibition at 10-3 M
dbacp00057 Enkephalins7 analogue-9 YSA* Synthetic Peptide Apoptosis inducing MTT/MTS assay HeLa Cervical cancer 7.5% inhibition at 10-6 M
dbacp00058 Enkephalins7 analogue-9 YSA* Synthetic Peptide Apoptosis inducing MTT/MTS assay HeLa Cervical cancer 6.1% inhibition at 10-5 M
dbacp00059 Enkephalins7 analogue-9 YSA* Synthetic Peptide Apoptosis inducing MTT/MTS assay HeLa Cervical cancer 3.1% inhibition at 10-4 M
dbacp00060 Enkephalins7 analogue-9 YSA* Synthetic Peptide Apoptosis inducing MTT/MTS assay HeLa Cervical cancer 14.8% inhibition at 10-3 M
dbacp00061 Enkephalins7 analogue-9 YSA* Synthetic Peptide Apoptosis inducing MTT/MTS assay HBL Skin cancer 3.9% inhibition at 10-5 M
dbacp00062 Enkephalins7 analogue-9 YSA* Synthetic Peptide Apoptosis inducing MTT/MTS assay HBL Skin cancer 7.3% inhibition at 10-3 M
dbacp00063 Enkephalins7 analogue-9 YSA* Synthetic Peptide Apoptosis inducing MTT/MTS assay HT-29 Colon cancer 4.9% inhibition at 10-6 M
dbacp00064 Enkephalins7 analogue-9 YSA* Synthetic Peptide Apoptosis inducing MTT/MTS assay HT-29 Colon cancer 8.9% inhibition at 10-5 M
dbacp00065 Enkephalins7 analogue-9 YSA* Synthetic Peptide Apoptosis inducing MTT/MTS assay HT-29 Colon cancer 3.4% inhibition at 10-4 M
dbacp00066 Enkephalins7 analogue-9 YSA* Synthetic Peptide Apoptosis inducing MTT/MTS assay HT-29 Colon cancer 20.8% inhibition at 10-3 M
dbacp00067 Enkephalins7 analogue-9 YSA* Synthetic Peptide Apoptosis inducing MTT/MTS assay SW-620 Colon cancer 10.5% inhibition at 10-6 M
dbacp00068 Enkephalins7 analogue-9 YSA* Synthetic Peptide Apoptosis inducing MTT/MTS assay SW-620 Colon cancer 21.9% inhibition at 10-5 M
dbacp00069 Enkephalins7 analogue-9 YSA* Synthetic Peptide Apoptosis inducing MTT/MTS assay SW-620 Colon cancer 11.8% inhibition at 10-4 M
dbacp00070 Enkephalins7 analogue-9 YSA* Synthetic Peptide Apoptosis inducing MTT/MTS assay SW-620 Colon cancer 17.9% inhibition at 10-3 M
dbacp00071 Enkephalins7 analogue-9 YSA* Synthetic Peptide Apoptosis inducing MTT/MTS assay CaCo-2 Colon cancer 3.7% inhibition at 10-6 M
dbacp00072 Enkephalins7 analogue-9 YSA* Synthetic Peptide Apoptosis inducing MTT/MTS assay CaCo-2 Colon cancer 16.5% inhibition at 10-5 M
dbacp00073 Enkephalins7 analogue-9 YSA* Synthetic Peptide Apoptosis inducing MTT/MTS assay CaCo-2 Colon cancer 8.4% inhibition at 10-4 M
dbacp00074 Enkephalins7 analogue-9 YSA* Synthetic Peptide Apoptosis inducing MTT/MTS assay CaCo-2 Colon cancer 14.5% inhibition at 10-3 M
dbacp00075 Enkephalins7 analogue-9 YSA* Synthetic Peptide Apoptosis inducing MTT/MTS assay MCF-7 Breast cancer 1.1% inhibition at 10-5 M
dbacp00076 Enkephalins7 analogue-9 YSA* Synthetic Peptide Apoptosis inducing MTT/MTS assay MCF-7 Breast cancer 1.2% inhibition at 10-4 M
dbacp00077 Enkephalins7 analogue-9 YSA* Synthetic Peptide Apoptosis inducing MTT/MTS assay MCF-7 Breast cancer 17.8% inhibition at 10-3 M
dbacp00078 Enkephalins7 analogue-10 YSA* Synthetic Peptide Apoptosis inducing MTT/MTS assay HEp-2 Larynx cancer 8.5% inhibition at 10-6 M
dbacp00079 Enkephalins7 analogue-10 YSA* Synthetic Peptide Apoptosis inducing MTT/MTS assay HEp-2 Larynx cancer 4.9% inhibition at 10-5 M
dbacp00080 Enkephalins7 analogue-10 YSA* Synthetic Peptide Apoptosis inducing MTT/MTS assay HEp-2 Larynx cancer 1.9% inhibition at 10-4 M
dbacp00081 Enkephalins7 analogue-10 YSA* Synthetic Peptide Apoptosis inducing MTT/MTS assay HEp-2 Larynx cancer 16.2% inhibition at 10-3 M
dbacp00082 Enkephalins7 analogue-10 YSA* Synthetic Peptide Apoptosis inducing MTT/MTS assay HeLa Cervical cancer 7.2% inhibition at 10-6 M
dbacp00083 Enkephalins7 analogue-10 YSA* Synthetic Peptide Apoptosis inducing MTT/MTS assay HeLa Cervical cancer 17.1% inhibition at 10-5 M
dbacp00084 Enkephalins7 analogue-10 YSA* Synthetic Peptide Apoptosis inducing MTT/MTS assay HeLa Cervical cancer 11.0% inhibition at 10-4 M
dbacp00085 Enkephalins7 analogue-10 YSA* Synthetic Peptide Apoptosis inducing MTT/MTS assay HeLa Cervical cancer 20.5% inhibition at 10-3 M
dbacp00086 Enkephalins7 analogue-10 YSA* Synthetic Peptide Apoptosis inducing MTT/MTS assay HBL Skin cancer 3.0% inhibition at 10-6 M
dbacp00087 Enkephalins7 analogue-10 YSA* Synthetic Peptide Apoptosis inducing MTT/MTS assay HBL Skin cancer 4.7% inhibition at 10-5 M
dbacp00088 Enkephalins7 analogue-10 YSA* Synthetic Peptide Apoptosis inducing MTT/MTS assay HBL Skin cancer 2.7% inhibition at 10-4 M
dbacp00089 Enkephalins7 analogue-10 YSA* Synthetic Peptide Apoptosis inducing MTT/MTS assay HBL Skin cancer 7.3% inhibition at 10-3 M
dbacp00090 Enkephalins7 analogue-10 YSA* Synthetic Peptide Apoptosis inducing MTT/MTS assay HT-29 Colon cancer 0.7% inhibition at 10-6 M
dbacp00091 Enkephalins7 analogue-10 YSA* Synthetic Peptide Apoptosis inducing MTT/MTS assay HT-29 Colon cancer 8.3% inhibition at 10-5 M
dbacp00092 Enkephalins7 analogue-10 YSA* Synthetic Peptide Apoptosis inducing MTT/MTS assay HT-29 Colon cancer 10.5% inhibition at 10-4 M
dbacp00093 Enkephalins7 analogue-10 YSA* Synthetic Peptide Apoptosis inducing MTT/MTS assay HT-29 Colon cancer 21.8% inhibition at 10-3 M
dbacp00094 Enkephalins7 analogue-10 YSA* Synthetic Peptide Apoptosis inducing MTT/MTS assay SW-620 Colon cancer 10.7% inhibition at 10-6 M
dbacp00095 Enkephalins7 analogue-10 YSA* Synthetic Peptide Apoptosis inducing MTT/MTS assay SW-620 Colon cancer 10.0% inhibition at 10-5 M
dbacp00096 Enkephalins7 analogue-10 YSA* Synthetic Peptide Apoptosis inducing MTT/MTS assay MCF-7 Breast cancer 7.7% inhibition at 10-4 M
dbacp00097 Enkephalins7 analogue-10 YSA* Synthetic Peptide Apoptosis inducing MTT/MTS assay MCF-7 Breast cancer 18.7% inhibition at 10-3 M
dbacp00125 Enkephalins7 analogue-15 YSA*G Synthetic Peptide Apoptosis inducing MTT/MTS assay HEp-2 Larynx cancer 2.7% inhibition at 10-6 M
dbacp00126 Enkephalins7 analogue-15 YSA*G Synthetic Peptide Apoptosis inducing MTT/MTS assay HEp-2 Larynx cancer 2.0% inhibition at 10-5 M
dbacp00127 Enkephalins7 analogue-15 YSA*G Synthetic Peptide Apoptosis inducing MTT/MTS assay HEp-2 Larynx cancer 18.8% inhibition at 10-4 M
dbacp00128 Enkephalins7 analogue-15 YSA*G Synthetic Peptide Apoptosis inducing MTT/MTS assay HEp-2 Larynx cancer 26.7% inhibition at 10-3 M
dbacp00129 Enkephalins7 analogue-15 YSA*G Synthetic Peptide Apoptosis inducing MTT/MTS assay HeLa Cervical cancer 9.8% inhibition at 10-6 M
dbacp00130 Enkephalins7 analogue-15 YSA*G Synthetic Peptide Apoptosis inducing MTT/MTS assay HeLa Cervical cancer 7.3% inhibition at 10-5 M
dbacp00131 Enkephalins7 analogue-15 YSA*G Synthetic Peptide Apoptosis inducing MTT/MTS assay HeLa Cervical cancer 9.9% inhibition at 10-4 M
dbacp00132 Enkephalins7 analogue-15 YSA*G Synthetic Peptide Apoptosis inducing MTT/MTS assay HeLa Cervical cancer 28.2% inhibition at 10-3 M
dbacp00133 Enkephalins7 analogue-15 YSA*G Synthetic Peptide Apoptosis inducing MTT/MTS assay HBL Skin cancer 1.6% inhibition at 10-6 M
dbacp00134 Enkephalins7 analogue-15 YSA*G Synthetic Peptide Apoptosis inducing MTT/MTS assay HBL Skin cancer 2.9% inhibition at 10-5 M
dbacp00135 Enkephalins7 analogue-15 YSA*G Synthetic Peptide Apoptosis inducing MTT/MTS assay HBL Skin cancer 5.9% inhibition at 10-4 M
dbacp00136 Enkephalins7 analogue-15 YSA*G Synthetic Peptide Apoptosis inducing MTT/MTS assay HBL Skin cancer 17.9% inhibition at 10-3 M
dbacp00137 Enkephalins7 analogue-15 YSA*G Synthetic Peptide Apoptosis inducing MTT/MTS assay HT-29 Colon cancer 5.4% inhibition at 10-6 M
dbacp00138 Enkephalins7 analogue-15 YSA*G Synthetic Peptide Apoptosis inducing MTT/MTS assay HT-29 Colon cancer 7.4% inhibition at 10-5 M
dbacp00139 Enkephalins7 analogue-15 YSA*G Synthetic Peptide Apoptosis inducing MTT/MTS assay HT-29 Colon cancer 9.5% inhibition at 10-4 M
dbacp00140 Enkephalins7 analogue-15 YSA*G Synthetic Peptide Apoptosis inducing MTT/MTS assay HT-29 Colon cancer 15.7% inhibition at 10-3 M
dbacp00141 Enkephalins7 analogue-15 YSA*G Synthetic Peptide Apoptosis inducing MTT/MTS assay SW-620 Colon cancer 13.6% inhibition at 10-6 M
dbacp00142 Enkephalins7 analogue-15 YSA*G Synthetic Peptide Apoptosis inducing MTT/MTS assay SW-620 Colon cancer 20.4% inhibition at 10-5 M
dbacp00143 Enkephalins7 analogue-15 YSA*G Synthetic Peptide Apoptosis inducing MTT/MTS assay SW-620 Colon cancer 14.4% inhibition at 10-4 M
dbacp00144 Enkephalins7 analogue-15 YSA*G Synthetic Peptide Apoptosis inducing MTT/MTS assay SW-620 Colon cancer 23.4% inhibition at 10-3 M
dbacp00145 Enkephalins7 analogue-15 YSA*G Synthetic Peptide Apoptosis inducing MTT/MTS assay CaCo-2 Colon cancer 2.2% inhibition at 10-6 M
dbacp00146 Enkephalins7 analogue-15 YSA*G Synthetic Peptide Apoptosis inducing MTT/MTS assay CaCo-2 Colon cancer 4.2% inhibition at 10-5 M
dbacp00147 Enkephalins7 analogue-15 YSA*G Synthetic Peptide Apoptosis inducing MTT/MTS assay CaCo-2 Colon cancer 6.4% inhibition at 10-4 M
dbacp00148 Enkephalins7 analogue-15 YSA*G Synthetic Peptide Apoptosis inducing MTT/MTS assay CaCo-2 Colon cancer 6.2% inhibition at 10-3 M
dbacp00149 Enkephalins7 analogue-15 YSA*G Synthetic Peptide Apoptosis inducing MTT/MTS assay MCF-7 Breast cancer 21.2% inhibition at 10-3 M
dbacp00159 Enkephalins7 analogue-16 YRA*G Synthetic Peptide Apoptosis inducing MTT/MTS assay HEp-2 Larynx cancer 4.6% inhibition at 10-6 M
dbacp00160 Enkephalins7 analogue-16 YRA*G Synthetic Peptide Apoptosis inducing MTT/MTS assay HEp-2 Larynx cancer 4.9% inhibition at 10-5 M
dbacp00161 Enkephalins7 analogue-16 YRA*G Synthetic Peptide Apoptosis inducing MTT/MTS assay HEp-2 Larynx cancer 12.6% inhibition at 10-4 M
dbacp00162 Enkephalins7 analogue-16 YRA*G Synthetic Peptide Apoptosis inducing MTT/MTS assay HEp-2 Larynx cancer 26.4% inhibition at 10-3 M
dbacp00163 Enkephalins7 analogue-16 YRA*G Synthetic Peptide Apoptosis inducing MTT/MTS assay HeLa Cervical cancer 11.0% inhibition at 10-6 M
dbacp00164 Enkephalins7 analogue-16 YRA*G Synthetic Peptide Apoptosis inducing MTT/MTS assay HeLa Cervical cancer 11.7% inhibition at 10-5 M
dbacp00165 Enkephalins7 analogue-16 YRA*G Synthetic Peptide Apoptosis inducing MTT/MTS assay HeLa Cervical cancer 11.6% inhibition at 10-4 M
dbacp00166 Enkephalins7 analogue-16 YRA*G Synthetic Peptide Apoptosis inducing MTT/MTS assay HeLa Cervical cancer 28.2% inhibition at 10-3 M
dbacp00167 Enkephalins7 analogue-16 YRA*G Synthetic Peptide Apoptosis inducing MTT/MTS assay HBL Skin cancer 1.2% inhibition at 10-5 M
dbacp00168 Enkephalins7 analogue-16 YRA*G Synthetic Peptide Apoptosis inducing MTT/MTS assay HBL Skin cancer 3.3% inhibition at 10-4 M
dbacp00169 Enkephalins7 analogue-16 YRA*G Synthetic Peptide Apoptosis inducing MTT/MTS assay HBL Skin cancer 19.4% inhibition at 10-3 M
dbacp00170 Enkephalins7 analogue-16 YRA*G Synthetic Peptide Apoptosis inducing MTT/MTS assay HT-29 Colon cancer 7.6% inhibition at 10-6 M
dbacp00171 Enkephalins7 analogue-16 YRA*G Synthetic Peptide Apoptosis inducing MTT/MTS assay HT-29 Colon cancer 3.8% inhibition at 10-5 M
dbacp00172 Enkephalins7 analogue-16 YRA*G Synthetic Peptide Apoptosis inducing MTT/MTS assay HT-29 Colon cancer 12.4% inhibition at 10-4 M
dbacp00173 Enkephalins7 analogue-16 YRA*G Synthetic Peptide Apoptosis inducing MTT/MTS assay HT-29 Colon cancer 22.4% inhibition at 10-3 M
dbacp00174 Enkephalins7 analogue-16 YRA*G Synthetic Peptide Apoptosis inducing MTT/MTS assay SW-620 Colon cancer 17.0% inhibition at 10-6 M
dbacp00175 Enkephalins7 analogue-16 YRA*G Synthetic Peptide Apoptosis inducing MTT/MTS assay SW-620 Colon cancer 13.5% inhibition at 10-5 M
dbacp00176 Enkephalins7 analogue-16 YRA*G Synthetic Peptide Apoptosis inducing MTT/MTS assay SW-620 Colon cancer 13.5% inhibition at 10-4 M
dbacp00177 Enkephalins7 analogue-16 YRA*G Synthetic Peptide Apoptosis inducing MTT/MTS assay SW-620 Colon cancer 25.3% inhibition at 10-3 M
dbacp00178 Enkephalins7 analogue-16 YRA*G Synthetic Peptide Apoptosis inducing MTT/MTS assay CaCo-2 Colon cancer 8.1% inhibition at 10-6 M
dbacp00179 Enkephalins7 analogue-16 YRA*G Synthetic Peptide Apoptosis inducing MTT/MTS assay CaCo-2 Colon cancer 6.9% inhibition at 10-5 M
dbacp00180 Enkephalins7 analogue-16 YRA*G Synthetic Peptide Apoptosis inducing MTT/MTS assay CaCo-2 Colon cancer 8.1% inhibition at 10-4 M
dbacp00181 Enkephalins7 analogue-16 YRA*G Synthetic Peptide Apoptosis inducing MTT/MTS assay CaCo-2 Colon cancer 8.6% inhibition at 10-3 M
dbacp00182 Enkephalins7 analogue-16 YRA*G Synthetic Peptide Apoptosis inducing MTT/MTS assay MCF-7 Breast cancer 15.6% inhibition at 10-3 M
dbacp00192 Enkephalins7 analogue-17 YA*GFM Synthetic Peptide Apoptosis inducing MTT/MTS assay HEp-2 Larynx cancer 1.0% inhibition at 10-6 M
dbacp00193 Enkephalins7 analogue-17 YA*GFM Synthetic Peptide Apoptosis inducing MTT/MTS assay HEp-2 Larynx cancer 10.1% inhibition at 10-5 M
dbacp00194 Enkephalins7 analogue-17 YA*GFM Synthetic Peptide Apoptosis inducing MTT/MTS assay HEp-2 Larynx cancer 16.8% inhibition at 10-4 M
dbacp00195 Enkephalins7 analogue-17 YA*GFM Synthetic Peptide Apoptosis inducing MTT/MTS assay HEp-2 Larynx cancer 36.1% inhibition at 10-3 M
dbacp00196 Enkephalins7 analogue-17 YA*GFM Synthetic Peptide Apoptosis inducing MTT/MTS assay HeLa Cervical cancer 4.9% inhibition at 10-6 M
dbacp00197 Enkephalins7 analogue-17 YA*GFM Synthetic Peptide Apoptosis inducing MTT/MTS assay HeLa Cervical cancer 10.2% inhibition at 10-5 M
dbacp00198 Enkephalins7 analogue-17 YA*GFM Synthetic Peptide Apoptosis inducing MTT/MTS assay HeLa Cervical cancer 13.3% inhibition at 10-4 M
dbacp00199 Enkephalins7 analogue-17 YA*GFM Synthetic Peptide Apoptosis inducing MTT/MTS assay HeLa Cervical cancer 28.0% inhibition at 10-3 M
dbacp00200 Enkephalins7 analogue-17 YA*GFM Synthetic Peptide Apoptosis inducing MTT/MTS assay HBL Skin cancer 0.8% inhibition at 10-6 M
dbacp00201 Enkephalins7 analogue-17 YA*GFM Synthetic Peptide Apoptosis inducing MTT/MTS assay HBL Skin cancer 1.4% inhibition at 10-5 M
dbacp00202 Enkephalins7 analogue-17 YA*GFM Synthetic Peptide Apoptosis inducing MTT/MTS assay HBL Skin cancer 2.4% inhibition at 10-4 M
dbacp00203 Enkephalins7 analogue-17 YA*GFM Synthetic Peptide Apoptosis inducing MTT/MTS assay HBL Skin cancer 18.3% inhibition at 10-3 M
dbacp00204 Enkephalins7 analogue-17 YA*GFM Synthetic Peptide Apoptosis inducing MTT/MTS assay HT-29 Colon cancer 3.3% inhibition at 10-6 M
dbacp00205 Enkephalins7 analogue-17 YA*GFM Synthetic Peptide Apoptosis inducing MTT/MTS assay HT-29 Colon cancer 11.0% inhibition at 10-5M
dbacp00206 Enkephalins7 analogue-17 YA*GFM Synthetic Peptide Apoptosis inducing MTT/MTS assay HT-29 Colon cancer 7.9% inhibition at 10-4 M
dbacp00207 Enkephalins7 analogue-17 YA*GFM Synthetic Peptide Apoptosis inducing MTT/MTS assay HT-29 Colon cancer 23.7% inhibition at 10-3 M
dbacp00208 Enkephalins7 analogue-17 YA*GFM Synthetic Peptide Apoptosis inducing MTT/MTS assay SW-620 Colon cancer 12.2% inhibition at 10-6 M
dbacp00209 Enkephalins7 analogue-17 YA*GFM Synthetic Peptide Apoptosis inducing MTT/MTS assay SW-620 Colon cancer 15.5% inhibition at 10-5 M
dbacp00210 Enkephalins7 analogue-17 YA*GFM Synthetic Peptide Apoptosis inducing MTT/MTS assay SW-620 Colon cancer 24.7% inhibition at 10-4 M
dbacp00211 Enkephalins7 analogue-17 YA*GFM Synthetic Peptide Apoptosis inducing MTT/MTS assay SW-620 Colon cancer 29.0% inhibition at 10-3 M
dbacp00212 Enkephalins7 analogue-17 YA*GFM Synthetic Peptide Apoptosis inducing MTT/MTS assay CaCo-2 Colon cancer 3.0% inhibition at 10-6 M
dbacp00213 Enkephalins7 analogue-17 YA*GFM Synthetic Peptide Apoptosis inducing MTT/MTS assay CaCo-2 Colon cancer 8.4% inhibition at 10-5 M
dbacp00214 Enkephalins7 analogue-17 YA*GFM Synthetic Peptide Apoptosis inducing MTT/MTS assay CaCo-2 Colon cancer 18.5% inhibition at 10-4 M
dbacp00215 Enkephalins7 analogue-17 YA*GFM Synthetic Peptide Apoptosis inducing MTT/MTS assay CaCo-2 Colon cancer 10.6% inhibition at 10-3 M
dbacp00216 Enkephalins7 analogue-17 YA*GFM Synthetic Peptide Apoptosis inducing MTT/MTS assay MCF-7 Breast cancer 22.8% inhibition at 10-3 M
dbacp00226 Enkephalins7 analogue-18 YA*GFM Synthetic Peptide Apoptosis inducing MTT/MTS assay HEp-2 Larynx cancer 13.7% inhibition at 10-6 M
dbacp00227 Enkephalins7 analogue-18 YA*GFM Synthetic Peptide Apoptosis inducing MTT/MTS assay HEp-2 Larynx cancer 25.8% inhibition at 10-5 M
dbacp00228 Enkephalins7 analogue-18 YA*GFM Synthetic Peptide Apoptosis inducing MTT/MTS assay HEp-2 Larynx cancer 34.7% inhibition at 10-4 M
dbacp00229 Enkephalins7 analogue-18 YA*GFM Synthetic Peptide Apoptosis inducing MTT/MTS assay HEp-2 Larynx cancer 44.5% inhibition at 10-3 M
dbacp00230 Enkephalins7 analogue-18 YA*GFM Synthetic Peptide Apoptosis inducing MTT/MTS assay HeLa Cervical cancer 8.5% inhibition at 10-6 M
dbacp00231 Enkephalins7 analogue-18 YA*GFM Synthetic Peptide Apoptosis inducing MTT/MTS assay HeLa Cervical cancer 9.5% inhibition at 10-5 M
dbacp00232 Enkephalins7 analogue-18 YA*GFM Synthetic Peptide Apoptosis inducing MTT/MTS assay HeLa Cervical cancer 15.4% inhibition at 10-4 M
dbacp00233 Enkephalins7 analogue-18 YA*GFM Synthetic Peptide Apoptosis inducing MTT/MTS assay HeLa Cervical cancer 24.1% inhibition at 10-3 M
dbacp00234 Enkephalins7 analogue-18 YA*GFM Synthetic Peptide Apoptosis inducing MTT/MTS assay HBL Skin cancer 2.4% inhibition at 10-6 M
dbacp00235 Enkephalins7 analogue-18 YA*GFM Synthetic Peptide Apoptosis inducing MTT/MTS assay HBL Skin cancer 4.5% inhibition at 10-5 M
dbacp00236 Enkephalins7 analogue-18 YA*GFM Synthetic Peptide Apoptosis inducing MTT/MTS assay HBL Skin cancer 11.4% inhibition at 10-4 M
dbacp00237 Enkephalins7 analogue-18 YA*GFM Synthetic Peptide Apoptosis inducing MTT/MTS assay HBL Skin cancer 23.2% inhibition at 10-3 M
dbacp00238 Enkephalins7 analogue-18 YA*GFM Synthetic Peptide Apoptosis inducing MTT/MTS assay HT-29 Colon cancer 16.2% inhibition at 10-6 M
dbacp00239 Enkephalins7 analogue-18 YA*GFM Synthetic Peptide Apoptosis inducing MTT/MTS assay HT-29 Colon cancer 6.6% inhibition at 10-5 M
dbacp00240 Enkephalins7 analogue-18 YA*GFM Synthetic Peptide Apoptosis inducing MTT/MTS assay HT-29 Colon cancer 5.1% inhibition at 10-4 M
dbacp00241 Enkephalins7 analogue-18 YA*GFM Synthetic Peptide Apoptosis inducing MTT/MTS assay HT-29 Colon cancer 14.5% inhibition at 10-3 M
dbacp00242 Enkephalins7 analogue-18 YA*GFM Synthetic Peptide Apoptosis inducing MTT/MTS assay SW-620 Colon cancer 26.4% inhibition at 10-6 M
dbacp00243 Enkephalins7 analogue-18 YA*GFM Synthetic Peptide Apoptosis inducing MTT/MTS assay SW-620 Colon cancer 13.1% inhibition at 10-5 M
dbacp00244 Enkephalins7 analogue-18 YA*GFM Synthetic Peptide Apoptosis inducing MTT/MTS assay SW-620 Colon cancer 14.6% inhibition at 10-4 M
dbacp00245 Enkephalins7 analogue-18 YA*GFM Synthetic Peptide Apoptosis inducing MTT/MTS assay SW-620 Colon cancer 38.4% inhibition at 10-3 M
dbacp00246 Enkephalins7 analogue-18 YA*GFM Synthetic Peptide Apoptosis inducing MTT/MTS assay CaCo-2 Colon cancer 17.7% inhibition at 10-6 M
dbacp00247 Enkephalins7 analogue-18 YA*GFM Synthetic Peptide Apoptosis inducing MTT/MTS assay CaCo-2 Colon cancer 10.9% inhibition at 10-5 M
dbacp00248 Enkephalins7 analogue-18 YA*GFM Synthetic Peptide Apoptosis inducing MTT/MTS assay CaCo-2 Colon cancer 12.1% inhibition at 10-4 M
dbacp00249 Enkephalins7 analogue-18 YA*GFM Synthetic Peptide Apoptosis inducing MTT/MTS assay CaCo-2 Colon cancer 8.1% inhibition at 10-3 M
dbacp00250 Enkephalins7 analogue-18 YA*GFM Synthetic Peptide Apoptosis inducing MTT/MTS assay MCF-7 Breast cancer 9.6% inhibition at 10-4 M
dbacp00251 Enkephalins7 analogue-18 YA*GFM Synthetic Peptide Apoptosis inducing MTT/MTS assay MCF-7 Breast cancer 29.9% inhibition at 10-3 M
dbacp00279 Enkephalins7 analogue-23 YGGFMA* Synthetic Peptide Apoptosis inducing MTT/MTS assay HEp-2 Larynx cancer 3.9% inhibition at 10-5 M
dbacp00280 Enkephalins7 analogue-23 YGGFMA* Synthetic Peptide Apoptosis inducing MTT/MTS assay HEp-2 Larynx cancer 45% inhibition at 10-3 M
dbacp00281 Enkephalins7 analogue-23 YGGFMA* Synthetic Peptide Apoptosis inducing MTT/MTS assay HeLa Cervical cancer 9.3% inhibition at 10-3 M
dbacp00282 Enkephalins7 analogue-23 YGGFMA* Synthetic Peptide Apoptosis inducing MTT/MTS assay HBL Skin cancer 4.1% inhibition at 10-6 M
dbacp00283 Enkephalins7 analogue-23 YGGFMA* Synthetic Peptide Apoptosis inducing MTT/MTS assay HBL Skin cancer 70.7% inhibition at 10-5 M
dbacp00284 Enkephalins7 analogue-23 YGGFMA* Synthetic Peptide Apoptosis inducing MTT/MTS assay HBL Skin cancer 34.4% inhibition at 10-3 M
dbacp00285 Enkephalins7 analogue-23 YGGFMA* Synthetic Peptide Apoptosis inducing MTT/MTS assay HT-29 Colon cancer 9.2% inhibition at 10-3 M
dbacp00286 Enkephalins7 analogue-23 YGGFMA* Synthetic Peptide Apoptosis inducing MTT/MTS assay CaCo-2 Colon cancer 11.08% inhibition at 10-5 M
dbacp00287 Enkephalins7 analogue-23 YGGFMA* Synthetic Peptide Apoptosis inducing MTT/MTS assay CaCo-2 Colon cancer 47.0% inhibition at 10-3 M
dbacp00288 Enkephalins7 analogue-23 YGGFMA* Synthetic Peptide Apoptosis inducing MTT/MTS assay MCF-7 Breast cancer 2.2% inhibition at 10-6 M
dbacp00289 Enkephalins7 analogue-23 YGGFMA* Synthetic Peptide Apoptosis inducing MTT/MTS assay MCF-7 Breast cancer 7.1% inhibition at 10-5 M
dbacp00290 Enkephalins7 analogue-23 YGGFMA* Synthetic Peptide Apoptosis inducing MTT/MTS assay MCF-7 Breast cancer 6.9% inhibition at 10-4 M
dbacp00291 Enkephalins7 analogue-23 YGGFMA* Synthetic Peptide Apoptosis inducing MTT/MTS assay MCF-7 Breast cancer 25.9% inhibition at 10-3 M
dbacp00301 (cpm)-1285 KNLWAAQRYGRELRRMSDEFEGSFKGL BH3-only, Sensizers (BAD, HRK, Noxa) Apoptosis inducing Not specified HL-60 Various cancers Not found
dbacp00302 (cpm)-1285 KNLWAAQRYGRELRRMSDEFEGSFKGL BH3-only, Sensizers (BAD, HRK, Noxa) Apoptosis inducing Not specified PBL Various cancers Not found
dbacp00303 Temporin-SHf FFFLSRIF* Sahara frog Apoptosis inducing MTT assay A549 Not specified IC50 : 24.03 ± 0.945 µM
dbacp00304 Temporin-SHf FFFLSRIF* Sahara frog Apoptosis inducing MTT assay MCF-7 Not specified IC50 : 32.76 ± 1.528 µM
dbacp00305 Temporin-SHf FFFLSRIF* Sahara frog Apoptosis inducing MTT assay HepG2 Not specified IC50 : 32.64 ± 1.350 µM
dbacp00306 Temporin-SHf FFFLSRIF* Sahara frog Apoptosis inducing MTT assay PC3 Not specified IC50 : 36.67 ± 0.729 µM
dbacp00308 (ATAP) Amphipathic tail-anchoring peptide of Bfl-1 KFEPKSGWMTFLEVTGKICEMLSLLKQYC Anti apoptotic (MCL-1, BFL1) Apoptosis inducing Not specified HeLa Not found Not found
dbacp00309 (Bl- LAAO) L-amino acid oxidases (L-AAO) ADDRNPLEECFRETDYEEFLEIAKNGLSTT Venom base Apoptosis inducing MTT assay MKN-45 Stomach cancer Not found
dbacp00310 (Bl- LAAO) L-amino acid oxidases (L-AAO) ADDRNPLEECFRETDYEEFLEIAKNGLSTT Venom base Apoptosis inducing MTT assay HUTU Adenocarcinoma Not found
dbacp00311 (Bl- LAAO) L-amino acid oxidases (L-AAO) ADDRNPLEECFRETDYEEFLEIAKNGLSTT Venom base Apoptosis inducing MTT assay RKO Colorectal cancer Not found
dbacp00318 (RGD-4C)-GG-D(KLAKLAK)2 ACDCRGDCFCGGKLAKLAKKLAKLAK Synthetic Peptide Apoptosis inducing Internalization assay,Mitochondrial swelling assay,Cell-free apoptosis assay,Caspase activation assay KS1767 Not specified LC50 : 10 μM
dbacp00725 6,7-dimethyl-8-ribityllumazine synthase 2 MNQSCPNKTSFKIAFIQARWHADIVDEARKSFVAELAAKTGGSVEVEIFDVPGAYEIPLHAKTLARTGRYAAIVGAAFVIDGGIYRHDFVATAVINGMMQVQLETEVPVLSVVLTPHHFHESKEHHDFFHAHFKVKGVEAAHAALQIVSERSRIAALV Not found Apoptosis inducing Apoptosis assay B16 Melanoma Not found
dbacp00771 A12 RPEIWMGQGLRRLGDEINAYYAR BH3-only, Direct activators, BIM analogues Apoptosis inducing Not specified Mcl-1/Myc 2640 Not found Not found
dbacp00772 A12 RPEIWMGQGLRRLGDEINAYYAR BH3-only, Direct activators, BIM analogues Apoptosis inducing Not specified Bcl-2/Myc 2924 Not found Not found
dbacp00813 A5 KAQIRAMECNIL Cyclin B (285-296) Apoptosis inducing MTT/MTS assay HCT-116 Colon cancer Not found
dbacp00814 AAD (or Aa-Pri1) MDSNKDERAYAQWVIIILHNVGSSPFKIANLGLSWGKLYADGNKDKEVYPSDYNGKTVGPDEKIQINSCGRENASSGTEGSFDIVDPNDGNKTIRHFYWECPWGSKRNTWTPSGSNTKWMVEWSGQNLDSGALGTITVDVLRKGN Purified from chestnut mushroom Apoptosis inducing MTT/MTS assay HepG-2 Liver cancer At 2.5 µM concentration,decrease in cell vibility: 35%
dbacp00815 AAD (or Aa-Pri1) MDSNKDERAYAQWVIIILHNVGSSPFKIANLGLSWGKLYADGNKDKEVYPSDYNGKTVGPDEKIQINSCGRENASSGTEGSFDIVDPNDGNKTIRHFYWECPWGSKRNTWTPSGSNTKWMVEWSGQNLDSGALGTITVDVLRKGN Purified from chestnut mushroom Apoptosis inducing MTT/MTS assay HeLa Cervical cancer At 2.5 µM concentration,decrease in cell vibility: 70%
dbacp00816 AAD (or Aa-Pri1) MDSNKDERAYAQWVIIILHNVGSSPFKIANLGLSWGKLYADGNKDKEVYPSDYNGKTVGPDEKIQINSCGRENASSGTEGSFDIVDPNDGNKTIRHFYWECPWGSKRNTWTPSGSNTKWMVEWSGQNLDSGALGTITVDVLRKGN Purified from chestnut mushroom Apoptosis inducing MTT/MTS assay SH-SY5Y Brain tumor At 2.5 µM concentration,decrease in cell vibility: 70%
dbacp00833 AAP-H YVPGP Marine invertebrates Apoptosis inducing MTT assay DU-145 Prostate cancer IC50 : 9.605 mM
dbacp00834 AAP-H YVPGP Marine invertebrates Apoptosis inducing MTT assay DU-146 Prostate cancer IC50 : 7.910 mM
dbacp00835 AAP-H YVPGP Marine invertebrates Apoptosis inducing MTT assay DU-147 Prostate cancer IC50 : 2.298 mM
dbacp00951 ABP-dHC-Cecropin A RWKIFKKIERVGQNVRDGIIKAGPAIQVLGTAKALGK Synthetic construct Apoptosis inducing MTT assay K562 cells Leukemia IC50 : 349.5 μM
dbacp00952 ABP-dHC-Cecropin A RWKIFKKIERVGQNVRDGIIKAGPAIQVLGTAKALGK Synthetic construct Apoptosis inducing MTT assay U937 cells Leukemia IC50 : 303.2 μM
dbacp00953 ABP-dHC-Cecropin A RWKIFKKIERVGQNVRDGIIKAGPAIQVLGTAKALGK Synthetic construct Apoptosis inducing MTT assay THP-1 cells Leukemia IC50 : 228.5 μM
dbacp00954 ABP-dHC-Cecropin A-K RWKIFKKIERVGQNVRDGIIKAGKAIQVLGTAKALGK Synthetic construct Apoptosis inducing MTT assay K562 cells Leukemia IC50 : 349.5 μM
dbacp00955 ABP-dHC-Cecropin A-K RWKIFKKIERVGQNVRDGIIKAGKAIQVLGTAKALGK Synthetic construct Apoptosis inducing MTT assay U937 cells Leukemia IC50 : 303.2 μM
dbacp00956 ABP-dHC-Cecropin A-K RWKIFKKIERVGQNVRDGIIKAGKAIQVLGTAKALGK Synthetic construct Apoptosis inducing MTT assay THP-1 cells Leukemia IC50 : 228.5 μM
dbacp00962 ACL LAO L-amino acid oxidase(LAO) ADSRNPLEEEFRETNYEEF Venom base Apoptosis inducing HL-60 cell culture assay HL-60 Not specified Not found
dbacp01144 Ansalvamide A NA Marine fungus, Wilt of banana Apoptosis inducing Not specified COLO 205 Colorectal cancer IC50 : 3.5 µg/mL
dbacp01145 Ansalvamide A NA Marine fungus, Wilt of banana Apoptosis inducing Not specified SKMEL-2 Melanoma cells IC50 : 5.9 µg/mL
dbacp01146 Ansalvamide A NA Marine fungus, Wilt of banana Apoptosis inducing Not specified HCT-116 Colon cancer IC50 : 9.8 µg/mL
dbacp01147 Ant-Bad RQIKIWFQNRRMKWKKNLWAAQRYGRELRRMSDEFVD BH3-only, Sensizers (BAD, HRK, Noxa) Apoptosis inducing Not specified 1483 Head and neck squamous cell carcinomas (HNSCC) IC50 : 24.8 µM
dbacp01148 Ant-Bad RQIKIWFQNRRMKWKKNLWAAQRYGRELRRMSDEFVD BH3-only, Sensizers (BAD, HRK, Noxa) Apoptosis inducing Not specified UM-22A Head and neck squamous cell carcinomas (HNSCC) IC50 : 18.3 µM
dbacp01149 Ant-Bad RQIKIWFQNRRMKWKKNLWAAQRYGRELRRMSDEFVD BH3-only, Sensizers (BAD, HRK, Noxa) Apoptosis inducing Not specified UM-22B Head and neck squamous cell carcinomas (HNSCC) IC50 : 40.2 µM
dbacp01150 Ant-Bak RQIKIWFQNRRMKWKKMGQVGRQLAIIGDDINRRY Effectors (BAK, BAX) Apoptosis inducing Not specified 1483 Head and neck squamous cell carcinomas (HNSCC) IC50 : 32.9 µM
dbacp01151 Ant-Bak RQIKIWFQNRRMKWKKMGQVGRQLAIIGDDINRRY Effectors (BAK, BAX) Apoptosis inducing Not specified UM-22A Head and neck squamous cell carcinomas (HNSCC) IC50 : 82 µM
dbacp01152 Ant-Bak RQIKIWFQNRRMKWKKMGQVGRQLAIIGDDINRRY Effectors (BAK, BAX) Apoptosis inducing Not specified UM-22B Head and neck squamous cell carcinomas (HNSCC) IC50 : > 100 µM
dbacp01153 Ant-Bax RQIKIWFQNRRMKWKKSTKKLSECLKRIGDELDSnM Effectors (BAK, BAX) Apoptosis inducing Not specified 1483 Head and neck squamous cell carcinomas (HNSCC) IC50 : 18.2 µM
dbacp01154 Ant-Bax RQIKIWFQNRRMKWKKSTKKLSECLKRIGDELDSnM Effectors (BAK, BAX) Apoptosis inducing Not specified UM-22A Head and neck squamous cell carcinomas (HNSCC) IC50 : 45.5 µM
dbacp01155 Ant-Bax RQIKIWFQNRRMKWKKSTKKLSECLKRIGDELDSnM Effectors (BAK, BAX) Apoptosis inducing Not specified UM-22B Head and neck squamous cell carcinomas (HNSCC) IC50 : > 100 µM
dbacp01156 Ant-p53pep GSRAHSSHLKSKKGQSTSRHKKWKMRRNQFWVKVQRG Not found Apoptosis inducing Annexin V-FITC Binding assay MDA-MB-468 Breast cancer IC50 : 30 µM
dbacp01157 Anthopleura anjunae anti-tumor peptide YVPGP Sea anemone anti-tumor peptide Apoptosis inducing MTT Cell Proliferation and Cytotoxicity assay DU-145 Prostate cancer IC50 : 9.605 μM
dbacp01158 Anticancer bioactive peptide NA Goat spleen Apoptosis inducing Cell proliferation assay HCT116 Human Colorectal cancer IC50 : 35 μg/mL
dbacp01172 Antp-LP4 RQIKIWFQNRRMKWKKSWTWEKKLETAVNLAWTAGNSNKWTWK VDAC1(voltage-dependent anion channel1) Apoptosis inducing Not specified CLL Leukemia IC50 : 0.7 ± 0.1 µM
dbacp01173 Antp-LP4 RQIKIWFQNRRMKWKKSWTWEKKLETAVNLAWTAGNSNKWTWK VDAC1(voltage-dependent anion channel1) Apoptosis inducing Not specified MEC-1 Leukemia IC50 : 2.5 ± 0.1 µM
dbacp01441 BAA-2 NA Bovine lactoferrin (Lf-B) Apoptosis inducing MTT/MTS assay Ramos Lymphoma cancer IC50 : 3.8 µg/ml
dbacp01442 Baceridin cyclo(L-Trp-D-Ala-D-allo-Ile-L-Val-D-Leu-L-Leu-) Synthetic construct Apoptosis inducing MTT assay HCT116 Not specified Not found
dbacp01443 Baceridin cyclo(L-Trp-D-Ala-D-allo-Ile-L-Val-D-Leu-L-Leu-) Synthetic construct Apoptosis inducing MTT assay RKO Not specified Not found
dbacp01444 Baceridin cyclo(L-Trp-D-Ala-D-allo-Ile-L-Val-D-Leu-L-Leu-) Synthetic construct Apoptosis inducing MTT assay HeLa Not specified Not found
dbacp01445 Baceridin WAIVLL Plant-associated rod-shaped, Gram-positive bacteria Apoptosis inducing MTT assay HCT116 Not specified Not found
dbacp01446 Baceridin WAIVLL Plant-associated rod-shaped, Gram-positive bacteria Apoptosis inducing MTT assay RKO Not specified Not found
dbacp01447 Baceridin WAIVLL Plant-associated rod-shaped, Gram-positive bacteria Apoptosis inducing MTT assay HeLa Not specified Not found
dbacp01448 Bad LWAAQRYGRELRRMSDEFEGSFKGL BH3-only, Sensizers (BAD, HRK, Noxa) Apoptosis inducing Not specified Not found Not specified Not found
dbacp01449 Bad LWAAQRYGRELRRMSDEFVDSFKK BH3-only, Sensizers (BAD, HRK, Noxa) Apoptosis inducing Not specified Not found Not found Not found
dbacp01450 Bad a NLWAARYGRELRRMSDKFVD BH3-only, Sensizers (BAD, HRK, Noxa) Apoptosis inducing Not specified Not found Not found Not found
dbacp02304 Cartilage protein hydrolysate peptide FIMGPY Skate Cell proliferation inhibition; Apoptosis inducing MTT assay HeLa Cervical cancer IC50 : 4.81 mg/mL
dbacp02305 Caseinphosphopeptides PPPEE Bovine milk Regulation of immune response; Apoptosis inducing MTT/MTS assay AZ-97 Colon cancer Inhibition at 24-28g/l
dbacp02378 Cercopin D GNFFKDLEKMGQRVRDAVISAAPAVDTLAKAKALGQ Domestic silk moth Apoptosis inducing Not specified Not found Not found Not found
dbacp02379 Ceropin MNFNKLFVFVALVLAVCIGQSEAGWLKKIGKKIERVGQHTRDATIQTIGVAQQAANVAATLKG House fly Apoptosis inducing Trypan blue assay BEL-7402 Liver cancer 91.8% cell viability at 12.5 µM
dbacp02380 Ceropin MNFNKLFVFVALVLAVCIGQSEAGWLKKIGKKIERVGQHTRDATIQTIGVAQQAANVAATLKG House fly Apoptosis inducing Trypan blue assay BEL-7402 Liver cancer 84.1% cell viability at 25 µM
dbacp02381 Ceropin MNFNKLFVFVALVLAVCIGQSEAGWLKKIGKKIERVGQHTRDATIQTIGVAQQAANVAATLKG House fly Apoptosis inducing Trypan blue assay BEL-7402 Liver cancer 76.3% cell viability at 50 µM
dbacp02382 Ceropin MNFNKLFVFVALVLAVCIGQSEAGWLKKIGKKIERVGQHTRDATIQTIGVAQQAANVAATLKG House fly Apoptosis inducing Trypan blue assay BEL-7402 Liver cancer 71.5 % cell viability at 75 µM
dbacp02383 Ceropin MNFNKLFVFVALVLAVCIGQSEAGWLKKIGKKIERVGQHTRDATIQTIGVAQQAANVAATLKG House fly Apoptosis inducing Trypan blue assay BEL-7402 Liver cancer 54.2 % cell viability at 100 µM
dbacp02384 Ceropin MNFNKLFVFVALVLAVCIGQSEAGWLKKIGKKIERVGQHTRDATIQTIGVAQQAANVAATLKG House fly Apoptosis inducing Trypan blue assay BEL-7402 Liver cancer 87.3 % cell viability at 25 µM
dbacp02385 Ceropin MNFNKLFVFVALVLAVCIGQSEAGWLKKIGKKIERVGQHTRDATIQTIGVAQQAANVAATLKG House fly Apoptosis inducing Trypan blue assay BEL-7402 Liver cancer 75.6 % cell viability at 50 µM
dbacp02386 Ceropin MNFNKLFVFVALVLAVCIGQSEAGWLKKIGKKIERVGQHTRDATIQTIGVAQQAANVAATLKG House fly Apoptosis inducing Trypan blue assay BEL-7402 Liver cancer 62.8 % cell viability at 75 µM
dbacp02387 Ceropin MNFNKLFVFVALVLAVCIGQSEAGWLKKIGKKIERVGQHTRDATIQTIGVAQQAANVAATLKG House fly Apoptosis inducing Trypan blue assay BEL-7402 Liver cancer 54.3 % cell viability at 100 µM
dbacp02388 Ceropin MNFNKLFVFVALVLAVCIGQSEAGWLKKIGKKIERVGQHTRDATIQTIGVAQQAANVAATLKG House fly Apoptosis inducing Trypan blue assay BEL-7402 Liver cancer 48.6 % cell viability at 100 µM
dbacp02389 Ceropin MNFNKLFVFVALVLAVCIGQSEAGWLKKIGKKIERVGQHTRDATIQTIGVAQQAANVAATLKG House fly Apoptosis inducing Trypan blue assay BEL-7402 Liver cancer 72.1 % cell viability at 12.5 µM
dbacp02390 Ceropin MNFNKLFVFVALVLAVCIGQSEAGWLKKIGKKIERVGQHTRDATIQTIGVAQQAANVAATLKG House fly Apoptosis inducing Trypan blue assay BEL-7402 Liver cancer 63.3 % cell viability at 25 µM
dbacp02391 Ceropin MNFNKLFVFVALVLAVCIGQSEAGWLKKIGKKIERVGQHTRDATIQTIGVAQQAANVAATLKG House fly Apoptosis inducing Trypan blue assay BEL-7402 Liver cancer 49.7 % cell viability at 50 µM
dbacp02392 Ceropin MNFNKLFVFVALVLAVCIGQSEAGWLKKIGKKIERVGQHTRDATIQTIGVAQQAANVAATLKG House fly Apoptosis inducing Trypan blue assay BEL-7402 Liver cancer 41.1 % cell viability at 75 µM
dbacp02393 Ceropin MNFNKLFVFVALVLAVCIGQSEAGWLKKIGKKIERVGQHTRDATIQTIGVAQQAANVAATLKG House fly Apoptosis inducing Trypan blue assay BEL-7402 Liver cancer 35.2 % cell viability at 100 µM
dbacp02458 Chartergellus-CP1 peptide IIGTILGLLKSLNH2 Social wasp Apoptosis inducing MTT assay A375 Human melanoma IC50 : 40.5 µg/mL
dbacp02459 Chartergellus-CP1 peptide IIGTILGLLKSLNH2 Social wasp Apoptosis inducing; Intracellular ROS formation MTT assay MNT-1 Human melanoma IC50 : 51.6 µg/mL
dbacp02561 Cr-ACP1 AWKLFDDGV Seeds, sago palm Apoptosis inducing Not specified Not found Not found Not found
dbacp02631 DC1 GAFLKCGESCVYLPCLTTVVGCSCQNSVCYRD Snake-needle grass Apoptosis inducing Colorimetric Cell viability assay,Migration assay ,Wound healing assay and Human prostate cancer xenograft assay DC3 Prostate cancer Not found
dbacp02632 DC1 GAFLKCGESCVYLPCLTTVVGCSCQNSVCYRD Snake-needle grass Apoptosis inducing Colorimetric Cell viability assay,Migration assay ,Wound healing assay and Human prostate cancer xenograft assay LNCap Prostate cancer Not found
dbacp02633 DC2 GAVPCGETCVYLPCITPDIGCSCQNKVCYRD Snake-needle grass Apoptosis inducing Colorimetric Cell viability assay,Migration assay ,Wound healing assay and Human prostate cancer xenograft assay DC3 Prostate cancer Not found
dbacp02634 DC2 GAVPCGETCVYLPCITPDIGCSCQNKVCYRD Snake-needle grass Apoptosis inducing Colorimetric Cell viability assay,Migration assay ,Wound healing assay and Human prostate cancer xenograft assay LNCap Prostate cancer Not found
dbacp02635 DC3 GTSCGETCVLLPCLSSVLGCTCQNKRCYKD Snake-needle grass Apoptosis inducing Colorimetric Cell viability assay,Migration assay ,Wound healing assay and Human prostate cancer xenograft assay DC3 Prostate cancer Not found
dbacp02636 DC3 GTSCGETCVLLPCLSSVLGCTCQNKRCYKD Snake-needle grass Apoptosis inducing Colorimetric Cell viability assay,Migration assay ,Wound healing assay and Human prostate cancer xenograft assay LNCap Prostate cancer Not found
dbacp02660 Dermaseptin-B3 ALWKnMLKGIGKLAGQAALGAVKTLVGA South American frog, Giant leaf frog Apoptosis inducing Thymidine Incorporation assay MCF-7 Breast cancer Not found
dbacp02661 Dermaseptin-B4 ALWKDILKNVGKAAGKAVLNTVTDMVNQ Giant leaf frog Apoptosis inducing Thymidine Incorporation assay MCF-7 Breast cancer Not found
dbacp02801 Dolastatin 10 2-[[2-(dimethylamino)-3-methylbutanoyl]amino]-N-[3-methoxy-1-[2-[1-methoxy-2-methyl-3-oxo-3-[[2-phenyl-1-(1,3-thiazol-2-yl)ethyl]amino]propyl]pyrrolidin-1-yl]-5-methyl-1-oxoheptan-4-yl]-N,3-dimethylbutaNAmide Wedge sea hare Apoptosis inducing TUNEL assay DU-145 Prostate cancer IC50 : 0.5 nM
dbacp02802 Dolastatin 10 2-[[2-(dimethylamino)-3-methylbutanoyl]amino]-N-[3-methoxy-1-[2-[1-methoxy-2-methyl-3-oxo-3-[[2-phenyl-1-(1,3-thiazol-2-yl)ethyl]amino]propyl]pyrrolidin-1-yl]-5-methyl-1-oxoheptan-4-yl]-N,3-dimethylbutaNAmide Wedge sea hare Apoptosis inducing Cell viability assay DB Lymphoma cancer IC50 : 0.0013 - 0.013 nM
dbacp02803 Dolastatin 10 2-[[2-(dimethylamino)-3-methylbutanoyl]amino]-N-[3-methoxy-1-[2-[1-methoxy-2-methyl-3-oxo-3-[[2-phenyl-1-(1,3-thiazol-2-yl)ethyl]amino]propyl]pyrrolidin-1-yl]-5-methyl-1-oxoheptan-4-yl]-N,3-dimethylbutaNAmide Wedge sea hare Apoptosis inducing Cell viability assay HT Lymphoma cancer IC50 : 0.0013 - 0.013 nM
dbacp02804 Dolastatin 10 2-[[2-(dimethylamino)-3-methylbutanoyl]amino]-N-[3-methoxy-1-[2-[1-methoxy-2-methyl-3-oxo-3-[[2-phenyl-1-(1,3-thiazol-2-yl)ethyl]amino]propyl]pyrrolidin-1-yl]-5-methyl-1-oxoheptan-4-yl]-N,3-dimethylbutaNAmide Wedge sea hare Apoptosis inducing Cell viability assay RL Lymphoma cancer IC50 : 0.0013 - 0.013 nM
dbacp02805 Dolastatin 10 2-[[2-(dimethylamino)-3-methylbutanoyl]amino]-N-[3-methoxy-1-[2-[1-methoxy-2-methyl-3-oxo-3-[[2-phenyl-1-(1,3-thiazol-2-yl)ethyl]amino]propyl]pyrrolidin-1-yl]-5-methyl-1-oxoheptan-4-yl]-N,3-dimethylbutaNAmide Wedge sea hare Apoptosis inducing Cell viability assay SR Leukemia cancer IC50 : 0.0013 - 0.013 nM
dbacp02806 Dolastatin 15 VV-nMe-VPP-2hydroxyisovaleryl-2-oxo-4-methoxy-5-benzyl-3-pyrroline Wedge sea hare Apoptosis inducing Cell viability assay DB Lymphoma cancer IC50 : 0.0013 - 0.013 nM
dbacp02807 Dolastatin 15 VV-nMe-VPP-2hydroxyisovaleryl-2-oxo-4-methoxy-5-benzyl-3-pyrroline Wedge sea hare Apoptosis inducing Cell viability assay HT Lymphoma cancer IC50 : 0.0013 - 0.013 nM
dbacp02808 Dolastatin 15 VV-nMe-VPP-2hydroxyisovaleryl-2-oxo-4-methoxy-5-benzyl-3-pyrroline Wedge sea hare Apoptosis inducing Cell viability assay RL Lymphoma cancer IC50 : 0.0013 - 0.013 nM
dbacp02809 Dolastatin 15 VV-nMe-VPP-2hydroxyisovaleryl-2-oxo-4-methoxy-5-benzyl-3-pyrroline Wedge sea hare Apoptosis inducing Cell viability assay SR Leukemia cancer IC50 : 0.0013 - 0.013 nM
dbacp02815 DRS B3 ALWKnMLKGIGKLAGQAALGAVKTLVGA Dermaseptins B Apoptosis inducing Thymidine incorporation assay MCF-7 Breast cancer Cytotoxicity :12 µM
dbacp02816 DRS B4 ALWKDILKNVGKAAGKAVLNTVTDMVNQ Dermaseptins B Apoptosis inducing Thymidine incorporation assay MCF-7 Breast cancer Cytotoxicity :15 µM
dbacp02817 DRS S1 ALWKTMLKKLGTMALHAGKAALGAAADTISQGTQ Dermaseptins B Apoptosis inducing Thymidine incorporation assay MCF-7 Breast cancer Not found
dbacp02818 DRS-DU-1 ALWKSLLKNVGKAAGKAALNAVTDMVNQ Purple and orange leaf frog Apoptosis inducing Not specified Not found Not found Not found
dbacp02829 Elastin derived peptide VGVAPG Elastin derived Apoptosis inducing Cell viability assay MCF-7 Breast cancer Not found
dbacp02830 Elastin derived peptide VGVAPG Elastin derived Apoptosis inducing Cell viability assay A549 Lung cancer Not found
dbacp03289 HCAP18(109-135) FRKSKEKIGKEFKRIVQRIKDFLRNLV HCAP18 synthetic peptide Apoptosis inducing Not specified SAS-H1 Oral cancer Not found
dbacp03305 HIV-TAT48-57 GRKKRRQRRR Not found Apoptosis inducing LDH leakage assay HeLa Cervical cancer 7% apoptosis at 10 µM
dbacp03306 HIV-TAT48-57 GRKKRRQRRR Not found Apoptosis inducing LDH leakage assay HeLa Cervical cancer 15% apoptosis at 20 µM
dbacp03307 HIV-TAT48-57 GRKKRRQRRR Not found Apoptosis inducing LDH leakage assay HeLa Cervical cancer 35% apoptosis at 30 µM
dbacp03308 HIV-TAT48-57 GRKKRRQRRR Not found Apoptosis inducing LDH leakage assay HeLa Cervical cancer 65% apoptosis at 50 µM
dbacp03367 Ichthyophthirius multifiliis (strain G5) B4 LKKLFKKILKYL White spot disease (strain G5) B4 Apoptosis inducing; Penetration of the cell membrane MTT assay MCF-7 Breast cancer MIC : 5 μM
dbacp03368 Ichthyophthirius multifiliis (strain G5) B4 LKKLFKKILKYL White spot disease (strain G5) B4 Apoptosis inducing; Penetration of the cell membrane MTT assay K562 Breast cancer MIC : 5 μM
dbacp03369 Ichthyophthirius multifiliis (strain G5) B8 LKKLFKKILKY White spot disease (strain G5) B8 Apoptosis inducing; Penetration of the cell membrane MTT assay MCF-7 Breast cancer MIC : 7 μM
dbacp03370 Ichthyophthirius multifiliis (strain G5) B8 LKKLFKKILKY White spot disease (strain G5) B8 Apoptosis inducing; Penetration of the cell membrane MTT assay K562 Breast cancer MIC : 7 μM
dbacp03371 Ichthyophthirius multifiliis BP100 KKLFKKILKYL White spot disease BP100 Apoptosis inducing; Penetration of the cell membrane MTT assay MCF-7 Breast cancer MIC : 25 μM
dbacp03372 Ichthyophthirius multifiliis BP100 KKLFKKILKYL White spot disease BP100 Apoptosis inducing; Penetration of the cell membrane MTT assay K562 Breast cancer MIC : 25 μM
dbacp03526 KT2 NGVQPKYKWWKWWKKWW-NH2 Siamese freshwater crocodile leukocyte Apoptosis inducing Sulforhodamine B colorimetric assay CaSki Cervical cancer IC50 : 17.3 – 30.8 μM
dbacp03527 KT2 NGVQPKYKWWKWWKKWW-NH2 Siamese freshwater crocodile leukocyte Apoptosis inducing Sulforhodamine B colorimetric assay CaSki Cervical cancer IC50 : 17.3 – 30.8 μM
dbacp04312 Lunasin SKWQHQQDSCRKQLQGVNLTPCEKHIMEKIQGRGDDDDDDDDD Soyabean Apoptosis inducing; Anti-proliferative MTT/MTS HT-29 Not specified IC50 : 61.7 µM
dbacp04313 Lunasin SKWQHQQDSCRKQLQGVNLTPCEKHIMEKIQGRGDDDDDDDDD Soyabean Apoptosis inducing; Anti-proliferative MTT/MTS HCT-116 Not specified IC50 : 31.6 µM
dbacp04314 Lunasin SKWQHQQDSCRKQLQGVNLTPCEKHIMEKIQGRGDDDDDDDDD Soyabean Apoptosis inducing; Anti-proliferative MTT/MTS MCF-7 Not specified IC50 : 431.9 µM
dbacp04698 MP06 LAVISWKCQEWNSLWKKRKRKT Green algae Apoptosis inducing CCK-8 assay MRC5 Lung cancer IC50 : 10 μM
dbacp04713 mt_E17L/L22 W/P27A LTFSDWWKLLAE MDM3 Apoptosis inducing MTT/MTS assay MCF-7 Breast cancer IC50 : 15.1 µM
dbacp04714 mt_L22 W/P27A ETFSDWWKLLAE MDM2 Apoptosis inducing MTT/MTS assay MCF-7 Breast cancer IC50 : 16.3 µM
dbacp04715 mt_S20A/L22 W/P27A ETFADWWKLLAE MDM5 Apoptosis inducing MTT/MTS assay MCF-7 Breast cancer IC50 : 8.7 µM
dbacp04716 mt_T18S/L22 W/P27A ESFSDWWKLLAE MDM4 Apoptosis inducing MTT/MTS assay MCF-7 Breast cancer IC50 : 27 µM
dbacp04884 Non-digestible fraction peptide GLTSK Common bean Cell proliferation inhibition; Apoptosis inducing MTS assay HCT116 Colorectal cancer IC50 : 0.51 mg/ml
dbacp04885 Non-digestible fraction peptide LSGNK Common bean Cell proliferation inhibition; Apoptosis inducing MTS assay HCT116 Colorectal cancer IC50 : 0.51 mg/ml
dbacp04886 Non-digestible fraction peptide GEGSGA Common bean Cell proliferation inhibition; Apoptosis inducing MTS assay HCT116 Colorectal cancer IC50 : 0.51 mg/ml
dbacp04887 Non-digestible fraction peptide MPACGSS Common bean Cell proliferation inhibition; Apoptosis inducing MTS assay HCT116 Colorectal cancer IC50 : 0.51 mg/ml
dbacp04888 Non-digestible fraction peptide MTEEY Common bean Cell proliferation inhibition; Apoptosis inducing MTS assay HCT116 Colorectal cancer IC50 : 0.51 mg/ml
dbacp05031 P04 IGEHTPSALAIMENANVLAR Aldolase A derived Apoptosis inducing MTT assay PDAC Pancreatic ductal adenocarcinoma MIC : 25 µg/mL
dbacp05032 P1 KWKLFKKIGIGAVLKVLKKG Ceropin A-African clawed frog Apoptosis inducing MTT/MTS assay NCI-H69 Lung cancer IC50 :3.4 µM
dbacp05033 P1 KWKLFKKIGIGAVLKVLKKG Ceropin A-African clawed frog Apoptosis inducing MTT/MTS assay NCI-H128 Lung cancer IC50 :3.5 µM
dbacp05034 P1 KWKLFKKIGIGAVLKVLKKG Ceropin A-African clawed frog Apoptosis inducing MTT/MTS assay NCI-H146 Lung cancer IC50 :4.5 µM
dbacp05037 P160 VPWMEPAYQRFL Not found Apoptosis inducing MTT cytotoxicity assay MCF-7 Breast cancer IC50 : 14.2 ± 1.5 μM
dbacp05052 P2 KWKLFKKIGIGKFLHSATTF Ceropin A-African clawed frog Apoptosis inducing MTT/MTS assay NCI-H69 Lung cancer IC50 : 36.2 µM
dbacp05053 P2 KWKLFKKIGIGKFLHSATTF Ceropin A-African clawed frog Apoptosis inducing MTT/MTS assay NCI-H128 Lung cancer IC50 : 37.9 µM
dbacp05054 P2 KWKLFKKIGIGKFLHSATTF Ceropin A-African clawed frog Apoptosis inducing MTT/MTS assay NCI-H146 Lung cancer IC50 : 47.7 µM
dbacp05058 P3 KWKLFKKIGIGAFLHSAKKF Ceropin A-African clawed frog Apoptosis inducing MTT/MTS assay NCI-H69 Lung cancer IC50 : 9.3 µM
dbacp05059 P3 KWKLFKKIGIGAFLHSAKKF Ceropin A-African clawed frog Apoptosis inducing MTT/MTS assay NCI-H128 Lung cancer IC50 : 9.3 µM
dbacp05060 P3 KWKLFKKIGIGAFLHSAKKF Ceropin A-African clawed frog Apoptosis inducing MTT/MTS assay NCI-H146 Lung cancer IC50 : 10.9 µM
dbacp05072 P4 KWKLFKKIGIGKFLHLAKKF Ceropin A-African clawed frog Apoptosis inducing MTT/MTS assay NCI-H69 Lung cancer IC50 : 1.9 µM
dbacp05073 P4 KWKLFKKIGIGKFLHLAKKF Ceropin A-African clawed frog Apoptosis inducing MTT/MTS assay NCI-H128 Lung cancer IC50 : 1.3 µM
dbacp05074 P4 KWKLFKKIGIGKFLHLAKKF Ceropin A-African clawed frog Apoptosis inducing MTT/MTS assay NCI-H146 Lung cancer IC50 : 2.8 µM
dbacp05075 P5 KWKLFKKIGIGAFLHLAKKF Ceropin A-African clawed frog Apoptosis inducing MTT/MTS assay NCI-H69 Lung cancer IC50 : 2.9 µM
dbacp05076 P5 KWKLFKKIGIGAFLHLAKKF Ceropin A-African clawed frog Apoptosis inducing MTT/MTS assay NCI-H128 Lung cancer IC50 : 2.9 µM
dbacp05077 P5 KWKLFKKIGIGAFLHLAKKF Ceropin A-African clawed frog Apoptosis inducing MTT/MTS assay NCI-H146 Lung cancer IC50 : 3.2 µM
dbacp05086 P6 KWKLFKKIGIGKFKLAKKF Ceropin A-African clawed frog Apoptosis inducing MTT/MTS assay NCI-H69 Lung cancer IC50 : 1.7 µM
dbacp05087 P6 KWKLFKKIGIGKFKLAKKF Ceropin A-African clawed frog Apoptosis inducing MTT/MTS assay NCI-H128 Lung cancer IC50 : 2 µM
dbacp05088 P6 KWKLFKKIGIGKFKLAKKF Ceropin A-African clawed frog Apoptosis inducing MTT/MTS assay NCI-H146 Lung cancer IC50 : 3.1 µM
dbacp05094 P7 PLLQATLGGGS Not found Apoptosis inducing WST-1 assay B16-F10 Skin cancer IC50 : 1 µM
dbacp05095 P7 KWKLFAKIGIGKFLHLAKKF Ceropin A-African clawed frog Apoptosis inducing MTT/MTS assay NCI-H69 Lung cancer IC50 : 3.1 µM
dbacp05096 P7 KWKLFAKIGIGKFLHLAKKF Ceropin A-African clawed frog Apoptosis inducing MTT/MTS assay NCI-H128 Lung cancer IC50 : 2.4 µM
dbacp05097 P7 KWKLFAKIGIGKFLHLAKKF Ceropin A-African clawed frog Apoptosis inducing MTT/MTS assay NCI-H146 Lung cancer IC50 : 2.4 µM
dbacp05100 P8 KWKKFLKIGIGKFLHLAKKF Ceropin A-African clawed frog Apoptosis inducing MTT/MTS assay NCI-H128 Lung cancer IC50 : 2.3 µM
dbacp05101 P8 KWKKFLKIGIGKFLHLAKKF Ceropin A-African clawed frog Apoptosis inducing MTT/MTS assay NCI-H146 Lung cancer IC50 : 1.8 µM
dbacp05246 Pep27 MRKEFHNVLSSGQLLADKRPARDYNRK Pneumococcus Apoptosis inducing MTT/MTS assay AML-2 Leukemia cancer Not found
dbacp05247 Pep27 MRKEFHNVLSSGQLLADKRPARDYNRK Pneumococcus Apoptosis inducing MTT/MTS assay HL-60 Leukemia cancer IC50 : > 70 µM
dbacp05248 Pep27 MRKEFHNVLSSGQLLADKRPARDYNRK Pneumococcus Apoptosis inducing MTT/MTS assay Jurkat Blood cancer IC50 : > 70 µM
dbacp05249 Pep27 MRKEFHNVLSSGQLLADKRPARDYNRK Pneumococcus Apoptosis inducing MTT/MTS assay SNU-601 Gastric cancer IC50 : > 70 µM
dbacp05250 Pep27 MRKEFHNVLSSGQLLADKRPARDYNRK Pneumococcus Apoptosis inducing MTT/MTS assay MCF-7 Breast cancer IC50 : > 70 µM
dbacp05256 Pep27 MRKEFHNVLSSGQLLADKRPARDYNRK Pneumococcus Apoptosis inducing MTT/MTS assay MCF-7 Breast cancer IC50 : > 70 µM
dbacp05282 Pep27anal1 MWKWFHNVLSSWQLLADKRPARDYNRK Pneumococcus Apoptosis inducing MTT/MTS assay AML-2 Leukemia cancer IC50 : 50 µM
dbacp05283 Pep27anal1 MWKWFHNVLSSWQLLADKRPARDYNRK Pneumococcus Apoptosis inducing MTT/MTS assay HL-60 Leukemia cancer IC50 : 53 µM
dbacp05284 Pep27anal1 MWKWFHNVLSSWQLLADKRPARDYNRK Pneumococcus Apoptosis inducing MTT/MTS assay Jurkat Blood cancer IC50 : 47 µM
dbacp05285 Pep27anal1 MWKWFHNVLSSWQLLADKRPARDYNRK Pneumococcus Apoptosis inducing MTT/MTS assay SNU-601 Gastric cancer IC50 : 37 µM
dbacp05286 Pep27anal1 MWKWFHNVLSSWQLLADKRPARDYNRK Pneumococcus Apoptosis inducing MTT/MTS assay MCF-7 Breast cancer IC50 : 55 µM
dbacp05287 Pep27anal2 MWKWFHNVLSWWWLLADKRPARDYNRK Pneumococcus Apoptosis inducing MTT/MTS assay AML-2 Leukemia cancer IC50 : 29 µM
dbacp05288 Pep27anal2 MWKWFHNVLSWWWLLADKRPARDYNRK Pneumococcus Apoptosis inducing MTT/MTS assay HL-60 Leukemia cancer IC50 : 20 µM
dbacp05289 Pep27anal2 MWKWFHNVLSWWWLLADKRPARDYNRK Pneumococcus Apoptosis inducing MTT/MTS assay Jurkat Blood cancer IC50 : 23 µM
dbacp05290 Pep27anal2 MWKWFHNVLSWWWLLADKRPARDYNRK Pneumococcus Apoptosis inducing MTT/MTS assay SNU-601 Gastric cancer IC50 : 25 µM
dbacp05291 Pep27anal2 MWKWFHNVLSWWWLLADKRPARDYNRK Pneumococcus Apoptosis inducing MTT/MTS assay MCF-7 Breast cancer IC50 : < 10 µM
dbacp05292 Pep27anal3 MRKWFHNVLSSGQLLADKWPAWDYNRK Pneumococcus Apoptosis inducing MTT/MTS assay AML-2 Leukemia cancer IC50 : 67 µM
dbacp05293 Pep27anal3 MRKWFHNVLSSGQLLADKWPAWDYNRK Pneumococcus Apoptosis inducing MTT/MTS assay HL-60 Leukemia cancer IC50 : 52 µM
dbacp05294 Pep27anal3 MRKWFHNVLSSGQLLADKWPAWDYNRK Pneumococcus Apoptosis inducing MTT/MTS assay Jurkat Blood cancer IC50 : 50 µM
dbacp05295 Pep27anal3 MRKWFHNVLSSGQLLADKWPAWDYNRK Pneumococcus Apoptosis inducing MTT/MTS assay SNU-601 Gastric cancer IC50 : 50 µM
dbacp05296 Pep27anal3 MRKWFHNVLSSGQLLADKWPAWDYNRK Pneumococcus Apoptosis inducing MTT/MTS assay MCF-7 Breast cancer IC50 : 38 µM
dbacp05297 Pep27anal4 MWKEFHNVLSSGQLLADKRWARWYNRW Pneumococcus Apoptosis inducing MTT/MTS assay AML-2 Leukemia cancer IC50 : 50 µM
dbacp05298 Pep27anal4 MWKEFHNVLSSGQLLADKRWARWYNRW Pneumococcus Apoptosis inducing MTT/MTS assay HL-60 Leukemia cancer IC50 : 51 µM
dbacp05299 Pep27anal4 MWKEFHNVLSSGQLLADKRWARWYNRW Pneumococcus Apoptosis inducing MTT/MTS assay Jurkat Blood cancer IC50 : 46 µM
dbacp05300 Pep27anal4 MWKEFHNVLSSGQLLADKRWARWYNRW Pneumococcus Apoptosis inducing MTT/MTS assay SNU-601 Gastric cancer IC50 : 37 µM
dbacp05301 Pep27anal4 MWKEFHNVLSSGQLLADKRWARWYNRW Pneumococcus Apoptosis inducing MTT/MTS assay MCF-7 Breast cancer IC50 : 29 µM
dbacp05302 Pep27anal5 MWKWFHNVLSSGQLLADKWWAWWYNWW Pneumococcus Apoptosis inducing MTT/MTS assay AML-2 Leukemia cancer IC50 : >70 µM
dbacp05303 Pep27anal5 MWKWFHNVLSSGQLLADKWWAWWYNWW Pneumococcus Apoptosis inducing MTT/MTS assay HL-60 Leukemia cancer IC50 : >70 µM
dbacp05304 Pep27anal5 MWKWFHNVLSSGQLLADKWWAWWYNWW Pneumococcus Apoptosis inducing MTT/MTS assay Jurkat Blood cancer IC50 : >70 µM
dbacp05305 Pep27anal5 MWKWFHNVLSSGQLLADKWWAWWYNWW Pneumococcus Apoptosis inducing MTT/MTS assay SNU-601 Gastric cancer IC50 : >70 µM
dbacp05306 Pep27anal5 MWKWFHNVLSSGQLLADKWWAWWYNWW Pneumococcus Apoptosis inducing MTT/MTS assay MCF-7 Breast cancer IC50 : >70 µM
dbacp05462 Peptidoglycan recognition protein 1 MLFAWAPFPALLGLADSCCFVVPRSEWKALPSECSKGLKKPVRYVVISHTAGSFCSSPDSCEQQARNVQLYQMKQLGWCDVAYNFLIGEDGHVYEGRGWTIKGDHTGPIWNPMSIGITFMGDYSHRVPAKRALRAALNLLKCGVSEGFLRSNYEVKGHRDVQSTLSPGDQLYEIIQSWDHYRE Rat Apoptosis inducing Not specified L929 Not found Not found
dbacp05463 Peptidoglycan recognition protein 1 MSRRSMLLAWALPSLLRLGAAQETEDPACCSPIVPRNEWKALASECAQHLSLPLRYVVVSHTAGSSCNTPASCQQQARNVQHYHMKTLGWCDVGYNFLIGEDGLVYEGRGWNFTGAHSGHLWNPMSIGISFMGNYMDRVPTPQAIRAAQGLLACGVAQGALRSNYVLKGHRDVQRTLSPGNQLYHLIQNWPHYRSP Human Apoptosis inducing; Necrotic cell death Enzyme inhibition assay K562 Not specified Not found
dbacp05464 Peptidoglycan recognition protein 1 MSRRSMLLAWALPSLLRLGAAQETEDPACCSPIVPRNEWKALASECAQHLSLPLRYVVVSHTAGSSCNTPASCQQQARNVQHYHMKTLGWCDVGYNFLIGEDGLVYEGRGWNFTGAHSGHLWNPMSIGISFMGNYMDRVPTPQAIRAAQGLLACGVAQGALRSNYVLKGHRDVQRTLSPGNQLYHLIQNWPHYRSP Human Apoptosis inducing; Necrotic cell death Enzyme inhibition assay Molt4 Not specified Not found
dbacp05465 Peptidoglycan recognition protein 1 MSRRSMLLAWALPSLLRLGAAQETEDPACCSPIVPRNEWKALASECAQHLSLPLRYVVVSHTAGSSCNTPASCQQQARNVQHYHMKTLGWCDVGYNFLIGEDGLVYEGRGWNFTGAHSGHLWNPMSIGISFMGNYMDRVPTPQAIRAAQGLLACGVAQGALRSNYVLKGHRDVQRTLSPGNQLYHLIQNWPHYRSP Human Apoptosis inducing; Necrotic cell death Enzyme inhibition assay HeLa Not specified Not found
dbacp05466 Peptidoglycan recognition protein 1 MSRRSMLLAWALPSLLRLGAAQETEDPACCSPIVPRNEWKALASECAQHLSLPLRYVVVSHTAGSSCNTPASCQQQARNVQHYHMKTLGWCDVGYNFLIGEDGLVYEGRGWNFTGAHSGHLWNPMSIGISFMGNYMDRVPTPQAIRAAQGLLACGVAQGALRSNYVLKGHRDVQRTLSPGNQLYHLIQNWPHYRSP Human Apoptosis inducing; Necrotic cell death Enzyme inhibition assay L929 Not specified Not found
dbacp05565 piscidin-1 FFHHIFRGIVHVGKTIHRLVTG Striped bass fish Apoptosis inducing; Elevation of ROS MTT/MTS assay SCC4 Oral squamous cell carcinoma IC50 : 10.82 – 13.77 μM
dbacp05566 piscidin-1 FFHHIFRGIVHVGKTIHRLVTG Striped bass fish Inhibits angiogenesis; Apoptosis inducing; Elevation of ROS MTT/MTS assay OC2 Oral cancer IC50 : 16.94 – 19.20 μM
dbacp05576 Pleurocidin GWGSFFKKAAHVGKHVGKAALTHYL Winter flounder Apoptosis inducing; Anti-proliferative activity MTT assay J5 Hepatocellular carcinoma IC50 : 54.9 µM
dbacp05577 Pleurocidin GWGSFFKKAAHVGKHVGKAALTHYL Winter flounder Apoptosis inducing; Anti-proliferative activity MTT assay Hep3B Hepatocellular carcinoma IC50 : 340.9 µM
dbacp05578 Pleurocidin GWGSFFKKAAHVGKHVGKAALTHYL Winter flounder Apoptosis inducing; Anti-proliferative activity MTT assay A549 Non-small cell lung adenocarcinoma IC50 : 300.8 µM
dbacp05579 Pleurocidin GWGSFFKKAAHVGKHVGKAALTHYL Winter flounder Apoptosis inducing; Anti-proliferative activity MTT assay AGS Stomach adenocarcinoma IC50 : 186.5 µM
dbacp05580 Pleurocidin-a GWGSFFKKAAHVGKHVGKAALTHYL-NH2 Winter flounder Apoptosis inducing; Anti-proliferative activity MTT assay J5 Hepatocellular carcinoma IC50 :1 1 µM
dbacp05581 Pleurocidin-a GWGSFFKKAAHVGKHVGKAALTHYL-NH3 Winter flounder Apoptosis inducing; Anti-proliferative activity MTT assay Huh7 Hepatocellular carcinoma IC50 : 60 µM
dbacp05582 Pleurocidin-a GWGSFFKKAAHVGKHVGKAALTHYL-NH4 Winter flounder Apoptosis inducing; Anti-proliferative activity MTT assay Hep3B Hepatocellular carcinoma IC50 : 77.5 µM
dbacp05583 Pleurocidin-a GWGSFFKKAAHVGKHVGKAALTHYL-NH5 Winter flounder Apoptosis inducing; Anti-proliferative activity MTT assay A549 Non-small cell lung adenocarcinoma IC50 : 42.1 µM
dbacp05584 Pleurocidin-a GWGSFFKKAAHVGKHVGKAALTHYL-NH6 Winter flounder Apoptosis inducing; Anti-proliferative activity MTT assay AGS Stomach adenocarcinoma IC50 : 29.8 µM
dbacp05585 Pleurocidin-a GWGSFFKKAAHVGKHVGKAALTHYL-NH7 Winter flounder Apoptosis inducing; Anti-proliferative activity MTT assay WiDr Colon adenocarcinoma IC50 : 197.3 µM
dbacp05586 Pleurocidin-a GWGSFFKKAAHVGKHVGKAALTHYL-NH8 Winter flounder Apoptosis inducing; Anti-proliferative activity MTT assay NIH-3T3 Mouse fibroblast IC50 : 313 µM
dbacp05674 Protein S100-A8 MLTELEKALNSIIDVYHKYSLIKGNFHAVYRDDLKKLLETECPQYIRKKGADVWFKELDINTDGAVNFQEFLILVIKMGVAAHKKSHEESHKE Human Apoptosis inducing MTT/MTS assay MM46 Breast cancer IC50 : 10 µM
dbacp05873 Radical SAM domain protein MEAVLYVTRKCNLSCGHCIVDKEDNSDLPTDKVETLASDYPIDRTILSGGEPFLHDNFEELVALVPEPTVLSNGLVLSDEEYVGENSDMLEELNGIQLSVEGKEETTDARRGEGVWDRVMEAHQNLSEIGVESYLRSTYSREMMEEVGELMEFCDAEGISLVLFPEIGKPPLSPTENASFFDYAVEKGVVVATPDFHSYIGEGGECPAARTRISVDVNGEIYPCQFNWDYCLGEVGDEWGLIESRIERFDRTEPVPRTCSRCDFANKCRGCGVADTWSGCPIARGLSHSESPSRRPLKRVQETMNTLEDVGAPRGCHGC Uncultured archaeon Apoptosis inducing MTT assay MCF-7 Breast cancer MIC : 42% ± 8.1 μM
dbacp05874 Radical SAM domain protein MEAVLYVTRKCNLSCGHCIVDKEDNSDLPTDKVETLASDYPIDRTILSGGEPFLHDNFEELVALVPEPTVLSNGLVLSDEEYVGENSDMLEELNGIQLSVEGKEETTDARRGEGVWDRVMEAHQNLSEIGVESYLRSTYSREMMEEVGELMEFCDAEGISLVLFPEIGKPPLSPTENASFFDYAVEKGVVVATPDFHSYIGEGGECPAARTRISVDVNGEIYPCQFNWDYCLGEVGDEWGLIESRIERFDRTEPVPRTCSRCDFANKCRGCGVADTWSGCPIARGLSHSESPSRRPLKRVQETMNTLEDVGAPRGCHGC Uncultured archaeon Apoptosis inducing MTT assay U2OS Osteosarcoma No significant effect
dbacp05928 Red Sea microbiome peptide AAEKEFIKYPYPTPLQYQQLATRLKVEKKLVRRW Red Sea microbiome derived peptide Apoptosis inducing MTT/MTS assay U2OS Osteosarcoma Not found
dbacp05961 RGD-mda-7 MNFQQRLQSLWTLARPFCPPLLATASQMQMVVLPCLGFTLLLWSQVSGAQGQEFHFGPCQVKGVVPQKLWEAFWAVKDTMQAQDNITSARLLQQEVLQNVSDAESCYLVHTLLEFYLKTVFKNYHNRTVEVRTLKSFSTLANNFVLIVSQLQPSQENEMFSIRGDSAHRRFLLFRRAFKQLDVEAALTKALGEVDILLTWMQKFYKL Derived from wtmda-7/IL-24 by insertion or a glycine residue between Arg(164) and Asp(165). Apoptosis inducing MTT/MTS assay MCF-7 Breast cancer Cell viability(% of control):0.5 at concentration 4 µg/ml
dbacp05962 RGD-mda-7 MNFQQRLQSLWTLARPFCPPLLATASQMQMVVLPCLGFTLLLWSQVSGAQGQEFHFGPCQVKGVVPQKLWEAFWAVKDTMQAQDNITSARLLQQEVLQNVSDAESCYLVHTLLEFYLKTVFKNYHNRTVEVRTLKSFSTLANNFVLIVSQLQPSQENEMFSIRGDSAHRRFLLFRRAFKQLDVEAALTKALGEVDILLTWMQKFYKL Derived from wtmda-7/IL-24 by insertion or a glycine residue between Arg(164) and Asp(165). Apoptosis inducing MTT/MTS assay Ket-3 Tumor Cell viability(% of control): 0.5 at concentration 8 µg/ml
dbacp05963 RGD-mda-7 MNFQQRLQSLWTLARPFCPPLLATASQMQMVVLPCLGFTLLLWSQVSGAQGQEFHFGPCQVKGVVPQKLWEAFWAVKDTMQAQDNITSARLLQQEVLQNVSDAESCYLVHTLLEFYLKTVFKNYHNRTVEVRTLKSFSTLANNFVLIVSQLQPSQENEMFSIRGDSAHRRFLLFRRAFKQLDVEAALTKALGEVDILLTWMQKFYKL Derived from wtmda-7/IL-24 by insertion or a glycine residue between Arg(164) and Asp(165). Apoptosis inducing MTT/MTS assay MCF-7 Breast cancer Apoptotic rate(%): >70% at concentration of 8 µg/ml
dbacp05964 RGD-mda-7 MNFQQRLQSLWTLARPFCPPLLATASQMQMVVLPCLGFTLLLWSQVSGAQGQEFHFGPCQVKGVVPQKLWEAFWAVKDTMQAQDNITSARLLQQEVLQNVSDAESCYLVHTLLEFYLKTVFKNYHNRTVEVRTLKSFSTLANNFVLIVSQLQPSQENEMFSIRDSAHRRFLLFRRAFKQL Derived from wtmda-7/IL-24 by insertion or a glycine residue between Arg(164) and Asp(165). Apoptosis inducing MTT/MTS assay Ket-3 Tumor Apoptotic rate(%): >50% at concentration of 8 µg/ml
dbacp05969 RGSALTHLP RGSALTHLP Siamese crocodile Leukocyte Apoptosis inducing Sulforhodamine B colorimetric assay HeLa Cervical cancer IC50 : 126.24 ± 3.5 μM
dbacp05970 RGSALTHLP RGSALTHLP Siamese crocodile Leukocyte Apoptosis inducing Sulforhodamine B colorimetric assay CaSki Cervical cancer IC50 : 168.33 ± 1.6 μM
dbacp05982 RT2 NGVQPKYRWWRWWRRWW-NH2 Siamese crocodile leukocyte Apoptosis inducing Sulforhodamine B colorimetric assay HeLa Cervical cancer IC50 : 28.7–53.4 μM
dbacp05983 RT2 NGVQPKYRWWRWWRRWW-NH2 Siamese crocodile leukocyte Apoptosis inducing Sulforhodamine B colorimetric assay HeLa Cervical cancer IC50 : 28.7–53.4 μM
dbacp06183 t Mastoparan-C(tMP-C, Tat (49-57)-Mastoparan-C) RKKRRQRRRLNLKALLAVAKKIL Synthetic construct Apoptosis inducing MTT assay H157 Non-small cell Lung cancer IC50 : 2.79 μM
dbacp06184 t Mastoparan-C(tMP-C, Tat (49-57)-Mastoparan-C) RKKRRQRRRLNLKALLAVAKKIL Synthetic construct Apoptosis inducing MTT assay MBD-MB-435S Melanocyte IC50 : 3.86 μM
dbacp06185 t Mastoparan-C(tMP-C, Tat (49-57)-Mastoparan-C) RKKRRQRRRLNLKALLAVAKKIL Synthetic construct Apoptosis inducing MTT assay PC-3 Human prostate carcinoma IC50 : 3.86 μM
dbacp06186 t Mastoparan-C(tMP-C, Tat (49-57)-Mastoparan-C) RKKRRQRRRLNLKALLAVAKKIL Synthetic construct Apoptosis inducing MTT assay U251-MG Human glioblastoma astrocytoma IC50 : 3.36 μM
dbacp06187 t Mastoparan-C(tMP-C, Tat (49-57)-Mastoparan-C) RKKRRQRRRLNLKALLAVAKKIL Synthetic construct Apoptosis inducing MTT assay MCF-7 Human breast cancer IC50 : 3.70 μM
dbacp06192 Tachyplesin I KWCFRVCYRGICYRRCR Hemocytes, Southeast Asia, Japanese horseshoe crab Apoptosis inducing Luciferase reporter assay, TUNEL assay T167 Squamous cell oral carcinoma Not found
dbacp06193 Tachyplesin I KWCFRVCYRGICYRRCR Hemocytes, Southeast Asia, Japanese horseshoe crab Apoptosis inducing Luciferase reporter assay, TUNEL assay T-409 Squamous cell oral carcinoma Not found
dbacp06195 Tat RKKRRQRRR HIV-Tat (49-57) Apoptosis inducing MTT/MTS assay HCT-116 Colon cancer ~10% cytotoxicity at 100 µM
dbacp06199 Tat-a5 KAQIRAMECNILGRKKRRQRRR HIV-Tat (49-57) Apoptosis inducing MTT/MTS assay HCT-116 Colon cancer ~80% cytotoxicity at 100 µM
dbacp06215 TAT-Ras-GAP317-326 GRKKRRQRRRGGWMWVTNLRTD Not found Apoptosis inducing LDH leakage assay HeLa Cervical cancer 15% apoptosis at 10 µM
dbacp06216 TAT-Ras-GAP317-326 GRKKRRQRRRGGWMWVTNLRTD Not found Apoptosis inducing LDH leakage assay HeLa Cervical cancer 47% apoptosis at 20 µM
dbacp06217 TAT-Ras-GAP317-326 GRKKRRQRRRGGWMWVTNLRTD Not found Apoptosis inducing LDH leakage assay HeLa Cervical cancer 72% apoptosis at 30 µM
dbacp06218 TAT-Ras-GAP317-326 GRKKRRQRRRGGWMWVTNLRTD Not found Apoptosis inducing LDH leakage assay HeLa Cervical cancer 79% apoptosis at 50 µM
dbacp06326 Transactivator of transcript-DV1-Bcl-2, AT-DV1-BH3 RRRQRRKKRGGGGLGASWHRPDK Transactivator of transcript-DV1-Bcl-2 TAT-DV1-BH3 Apoptosis inducing Cell viability assay, Transwell invasion assay MDA-MB-231 Breast cancer Not specified
dbacp06327 Transactivator of transcript-DV1-Bcl-2, AT-DV1-BH3 RRRQRRKKRGGGGLGASWHRPDK Transactivator of transcript-DV1-Bcl-2 TAT-DV1-BH4 Apoptosis inducing Cell viability assay, Transwell invasion assay MCF-7 Breast cancer Not specified
dbacp06328 Transactivator of transcript-DV1-Bcl-2, AT-DV1-BH3 RRRQRRKKRGGGGLGASWHRPDK Transactivator of transcript-DV1-Bcl-2 TAT-DV1-BH5 Apoptosis inducing Cell viability assay, Transwell invasion assay HEK-293 Kidney cancer Not specified
dbacp06500 Vigno 5 GLPLCGETCVGGTCNTPGCSCGWPVCVRN Viola ignobilis Apoptosis inducing MTT assay, AO/EB and DAPI staining assay HeLa cells Cervical cancer IC50 : 2.5 – 10 μM
dbacp06501 Vigno 5 GLPLCGETCVGGTCNTPGCSCGWPVCVRN Viola ignobilis Apoptosis inducing MTT assay, AO/EB and DAPI staining assay L929 Cervical cancer IC50 : 2.5 – 10 μM
dbacp06534 wtmda-7/IL-24 MNFQQRLQSLWTLARPFCPPLLATASQMQMVVLPCLGFTLLLWSQVSGAQGQEFHFGPCQVKGVVPQKLWEAFWAVKDTMQAQDNITSARLLQQEVLQNVSDAESCYLVHTLLEFYLKTVFKNYHNRTVEVRTLKSFSTLANNFVLIVSQLQPSQENEMFSIRDSAHRRFLLFRRAFKQL Not found Apoptosis inducing MTT/MTS assay MCF-7 Breast cancer Cell viability (% of control):0.5 at concentration 7 µg/ml
dbacp06535 wtmda-7/IL-24 MNFQQRLQSLWTLARPFCPPLLATASQMQMVVLPCLGFTLLLWSQVSGAQGQEFHFGPCQVKGVVPQKLWEAFWAVKDTMQAQDNITSARLLQQEVLQNVSDAESCYLVHTLLEFYLKTVFKNYHNRTVEVRTLKSFSTLANNFVLIVSQLQPSQENEMFSIRDSAHRRFLLFRRAFKQL Not found Apoptosis inducing MTT/MTS assay Ket-3 Tumor Cell viability (% of control): 0.5 at concentration 8 µg/ml
dbacp06536 wtmda-7/IL-24 MNFQQRLQSLWTLARPFCPPLLATASQMQMVVLPCLGFTLLLWSQVSGAQGQEFHFGPCQVKGVVPQKLWEAFWAVKDTMQAQDNITSARLLQQEVLQNVSDAESCYLVHTLLEFYLKTVFKNYHNRTVEVRTLKSFSTLANNFVLIVSQLQPSQENEMFSIRDSAHRRFLLFRRAFKQL Not found Apoptosis inducing MTT/MTS assay MCF-7 Breast cancer Apoptotic rate(%) : > 50% at concentration of 8 µg/ml
dbacp06537 wtmda-7/IL-24 MNFQQRLQSLWTLARPFCPPLLATASQMQMVVLPCLGFTLLLWSQVSGAQGQEFHFGPCQVKGVVPQKLWEAFWAVKDTMQAQDNITSARLLQQEVLQNVSDAESCYLVHTLLEFYLKTVFKNYHNRTVEVRTLKSFSTLANNFVLIVSQLQPSQENEMFSIRDSAHRRFLLFRRAFKQL Not found Apoptosis inducing MTT/MTS assay Ket-3 Tumor Apoptotic rate(%) : > 30% at concentration of 8 µg/ml
dbacp06605 αs1-casein f(90_95) RYLGYL Bovine milk Regulation of immune response; Apoptosis inducing MTT/MTS assay AZ-97 Colon cancer Inhibition at 12 - 15 g/l
dbacp06606 β-Casomorphins 5 f(60_64) YPFPG Bovine milk Regulation of immune response; Apoptosis inducing MTT/MTS assay AZ-97 Colon cancer Inhibition at 9 - 11 g/l
dbacp06656 LfcinB (21-25)Pal RWQWRWQWR LfcinB Apoptosis inducing MTT assay CaCo-2 Colorectal Cancer IC50 = 86 μM
dbacp06657 LfcinB (21-25)Pal RWQWRWQWR LfcinB Apoptosis inducing MTT assay HT-29 Colon Cancer IC50 = 100 μM
dbacp06658 LfcinB (21-25)Pal RWQWRWQWR LfcinB Apoptosis inducing MTT assay DU-145 Prostrate Cancer IC50 = 40 μM
dbacp06659 Ahx-[Pal] Ahx-RWQWRWQWR Synthetic Apoptosis inducing MTT assay HT-29 Colon Cancer IC50 = 119 μM
dbacp06660 Ahx-[Pal] Ahx-RWQWRWQWR Synthetic Apoptosis inducing MTT assay CaCo-2 Colorectal Cancer IC50 = 40 μM
dbacp06661 9[Orn] [Pal] RWQWRWQWO Synthetic Apoptosis inducing MTT assay HT-29 Colon Cancer IC50 = 109 μM
dbacp06662 9[Orn] [Pal] RWQWRWQWO Synthetic Apoptosis inducing MTT assay CaCo-2 Colorectal Cancer IC50 = 40 μM
dbacp06663 9[Orn] [Pal] RWQWRWQWO Synthetic Apoptosis inducing MTT assay DU-145 Prostrate Cancer IC50 = 62 μM
dbacp06664 CH3CO-Ahx-[Pal] CH3-CO-Ahx-RWQWRWQWR Synthetic Apoptosis inducing MTT assay CaCo-2 Colorectal Cancer IC50 = 31 μM
dbacp06665 1[dR][Pal] rWQWRWQWR Synthetic Apoptosis inducing MTT assay CaCo-2 Colorectal Cancer IC50 = 105 μM
dbacp06666 1[Orn] [Pal] OWQWRWQWR Synthetic Apoptosis inducing MTT assay CaCo-2 Colorectal Cancer IC50 = 91 μM
dbacp06667 5[Orn] [Pal] RWQWOWQWR Synthetic Apoptosis inducing MTT assay CaCo-2 Colorectal Cancer IC50 = 64 μM
dbacp06668 1[dR] 5[Orn] [Pal] rWQWOWQWR Synthetic Apoptosis inducing MTT assay CaCo-2 Colorectal Cancer IC50 = 109 μM
dbacp06704 P05 ADDGRPFPQVIK Aldolase A fragment Apoptosis inducing MTT assay MG-63 Bone Cancer Relative viability = 0.85 at 50 μg/ml
dbacp06705 P05 ADDGRPFPQVIK Aldolase A fragment Apoptosis inducing MTT assay U-2 OS Bone Cancer Relative viability = 0.98 at 50 μg/ml
dbacp06706 P02 AEEYEFLTPMEEAPK Rho GDP Dissociation Inhibitor Alpha fragment Apoptosis inducing MTT assay MG-63 Bone Cancer Relative viability = 0.88 at 50 μg/ml
dbacp06707 P02 AEEYEFLTPMEEAPK Rho GDP Dissociation Inhibitor Alpha fragment Apoptosis inducing MTT assay U-2 OS Bone Cancer Relative viability = 0.93 at 50 μg/ml
dbacp06708 P01 SETAPAAPAAPAPAEK Histone H1.4 (H1-4) Fragment Apoptosis inducing MTT assay MG-63 Bone Cancer Relative viability = 0.84 at 50 μg/ml
dbacp06709 P01 SETAPAAPAAPAPAEK Histone H1.4 (H1-4) Fragment Apoptosis inducing MTT assay U-2 OS Bone Cancer Relative viability = 1.13 at 50 μg/ml
dbacp06710 P03 HVFGESDELIGQK Triosephosphate Isomerase (TPI) fragment Apoptosis inducing MTT assay MG-63 Bone Cancer Relative viability = 1.04 at 50 μg/ml
dbacp06711 P03 HVFGESDELIGQK Triosephosphate Isomerase (TPI) fragment Apoptosis inducing MTT assay U-2 OS Bone Cancer Relative viability = 0.98 at 50 μg/ml
dbacp06712 P06 GAGTGGLGLAVEGPSEAK FLNA (Filamin A) fragment Apoptosis inducing MTT assay MG-63 Bone Cancer Relative viability = 0.92 at 50 μg/ml
dbacp06713 P06 GAGTGGLGLAVEGPSEAK FLNA (Filamin A) fragment Apoptosis inducing MTT assay U-2 OS Bone Cancer Relative viability = 1.17 at 50 μg/ml
dbacp06714 P07 VEPGLGADNSVVR FLNA (Filamin A) fragment Apoptosis inducing MTT assay MG-63 Bone Cancer Relative viability = 0.96 at 50 μg/ml
dbacp06715 P07 VEPGLGADNSVVR FLNA (Filamin A) fragment Apoptosis inducing MTT assay U-2 OS Bone Cancer Relative viability = 0.96 at 50 μg/ml
dbacp06716 P08 NSNLVGAAHEELQQSR Lamin A/C (LMNA) fragment Apoptosis inducing MTT assay MG-63 Bone Cancer Relative viability = 0.92 at 50 μg/ml
dbacp06717 P08 NSNLVGAAHEELQQSR Lamin A/C (LMNA) fragment Apoptosis inducing MTT assay U-2 OS Bone Cancer Relative viability = 1.06 at 50 μg/ml
dbacp06718 P09 AAGTLYTYPENWR Eukaryotic Translation Elongation Factor 1 Gamma (Eef1G) fragment Apoptosis inducing MTT assay MG-63 Bone Cancer Relative viability = 0.85 at 50 μg/ml
dbacp06719 P09 AAGTLYTYPENWR Eukaryotic Translation Elongation Factor 1 Gamma (Eef1G) fragment Apoptosis inducing MTT assay U-2 OS Bone Cancer Relative viability = 1.07 at 50 μg/ml
dbacp06720 P10 FAAATGATPIAGR 40S ribosomal protein fragment Apoptosis inducing MTT assay MG-63 Bone Cancer Relative viability = 1.08 at 50 μg/ml
dbacp06721 P10 FAAATGATPIAGR 40S ribosomal protein fragment Apoptosis inducing MTT assay U-2 OS Bone Cancer Relative viability = 1.01 at 50 μg/ml
dbacp06735 NKL-WT KLKSKLMVVCNKIGLLKSLCRKFVKSH Trematomus bernacchii Apoptosis inducing luciferase-based ATPlite assay B16-F10 Skin Cancer ATP level = 0.753 ± 0.254 at 40 μM
dbacp06736 NKL-MUT KLKSKLMVVANKIGLLKSLARKFVKSH Trematomus bernacchii Apoptosis inducing luciferase-based ATPlite assay B16-F10 Skin Cancer ATP level = 0.023 ± 0.007 at 40 μM
dbacp06754 37-mer peptide TKEQKEQIAKATGLTTKQVRNWYVQLNASIKVCMCSC Synthetic Apoptosis inducing MTT assay SNU-449 Liver Cancer IC50 = 76.4 ± 0.6015 μM
dbacp06755 37-mer peptide TKEQKEQIAKATGLTTKQVRNWYVQLNASIKVCMCSC Synthetic Apoptosis inducing MTT assay HepG-2 Liver Cancer IC50 = 33.65 ± 1.09 μM
dbacp06756 37-mer peptide TKEQKEQIAKATGLTTKQVRNWYVQLNASIKVCMCSC Synthetic Apoptosis inducing MTT assay SK-OV-3 Ovarian cancer IC50 = 27.45 ± 1.5085 μM
dbacp06757 ATMP5 THPPTTTTTTTTTTTYTAAPATTT Synthetic Analog of ATMP1 Apoptosis inducing MTT assay MDA-MB-231 Breast Cancer IC50 = 64.04 ± 0.021 μg /ml
dbacp06758 ATMP1 THPPTTTTTTTTTTTYTAAPATTT Anabas testudineus Apoptosis inducing MTT assay MDA-MB-231 Breast Cancer IC50 = 8.25 ± 0.14 μg/ml
dbacp06759 p28 LSTAADMQGVVTDGMASGLDKDYLKPDD Pseudomonas aeruginosa Apoptosis inducing MTT assay HT-29 Colon Cancer IC50 ~ 200 μg/ml
dbacp06760 p28 LSTAADMQGVVTDGMASGLDKDYLKPDD Pseudomonas aeruginosa Apoptosis inducing MTT assay CT-26 Colorectal Cancer IC50 ~ 150 μg/ml
dbacp06761 RP7 ATRQPNH RAGE(receptor for advanced glycation end product) inhibitor Apoptosis inducing MTT assay MDA-MB-231 Breast Cancer IC50 = 24.5 µM
dbacp06762 RP7 ATRQPNH RAGE(receptor for advanced glycation end product) inhibitor Apoptosis inducing MTT assay BT-549 Breast Cancer IC50 = 29.9 µM
dbacp06793 CPSA-CPSC-L-ACAN Not Available Recombinant Fusion Peptide Apoptosis inducing MTT assay HeLa Cervical Cancer IC50 = 63.15 μg/ml
dbacp06794 CM11 WKLFKKILKVL Cecropin-Melittin Hybrid Peptide Apoptosis inducing MTT assay Jurkat Blood Cancer Survival rate = 47% at 32 μg/ml
dbacp06795 CM11 WKLFKKILKVL Cecropin-Melittin Hybrid Peptide Apoptosis inducing MTT assay Raji Blood Cancer Survival rate = 51% at 32 μg/ml
dbacp06796 LHRH-BinBC QHWSYGLRPGGRGPKDAVRAVKGSALLPCIIVHDPNLNNSDKMKFNTYYLLEYKEYWHQLWSQIIPAHQTVKIQERTGISEVVQNSMIEDLNMYIGADFGMYFYLRSSGFKEQITRGLNRPLSQTTTQLGERVEEMEYYNSNDLDVRYVKYALAREFTLKRVNGEIVKNWVAVDYRMAGIQSYPNAPITNPLTLT Synthetic Apoptosis inducing MTT assay MCF-7 Breast Cancer IC50 = 10.96 μM
dbacp06797 LHRH-BinBC QHWSYGLRPGGRGPKDAVRAVKGSALLPCIIVHDPNLNNSDKMKFNTYYLLEYKEYWHQLWSQIIPAHQTVKIQERTGISEVVQNSMIEDLNMYIGADFGMYFYLRSSGFKEQITRGLNRPLSQTTTQLGERVEEMEYYNSNDLDVRYVKYALAREFTLKRVNGEIVKNWVAVDYRMAGIQSYPNAPITNPLTLT Synthetic Apoptosis inducing LDH leakage assay MCF-7 Breast Cancer 40% LDH efflux at 16 µM
dbacp06851 WP1 RLLRLMRLRMLLRM Derived from RLL peptide Apoptosis inducing HDAC inhibition assay HeLa Cervical Cancer IC50 = 0.310±0.064 µM
dbacp06852 WP1 RLLRLMRLRMLLRM Derived from RLL peptide Apoptosis inducing Cell Viability assay Huh-7 Liver Cancer IC50 = 43.74 ± 5.4 μM
dbacp06853 WP1 RLLRLMRLRMLLRM Derived from RLL peptide Apoptosis inducing Cell Viability assay HepG-2 Liver Cancer IC50 = 52.23 ± 0.9 μM
dbacp06854 WP1 RLLRLMRLRMLLRM Derived from RLL peptide Apoptosis inducing Cell Viability assay HT-29 Colon Cancer IC50 = 54.6 ± 2.1 μM
dbacp06855 WP2 RLLRLLRLRRLLRL Derived from RLL peptide Apoptosis inducing HDAC inhibition assay HeLa Cervical Cancer IC50 = 0.446±0.095 µM
dbacp06856 WP2 RLLRLLRLRRLLRL Derived from RLL peptide Apoptosis inducing Cell Viability assay Huh-7 Liver Cancer IC50 = 28.12 ± 1.5 μM
dbacp06857 WP2 RLLRLLRLRRLLRL Derived from RLL peptide Apoptosis inducing Cell Viability assay HepG-2 Liver Cancer IC50 = 34.05 ± 0.53 μM
dbacp06858 WP2 RLLRLLRLRRLLRL Derived from RLL peptide Apoptosis inducing Cell Viability assay HT-29 Colon Cancer IC50 = 42.6 ± 4.0 μM
dbacp06864 AMP-WF3 FLKSLWRGVKAIFNGARQGYKEHKN Poecilia Mexicana fish Apoptosis inducing MTT assay Jurkat Blood Cancer IC50 = 50 µM
dbacp06868 LfcinB(21-25)Pal RWQWRWQWR LfcinB Apoptosis inducing MTT assay MDA-MB-468 Breast Cancer IC50 = 72 µM
dbacp06869 LfcinB(21-25)Pal RWQWRWQWR LfcinB Apoptosis inducing MTT assay MDA-MB-231 Breast Cancer IC50 = 103 µM
dbacp06870 LfcinB(21-25)Pal RWQWRWQWR LfcinB Apoptosis inducing MTT assay MCF-7 Breast Cancer IC50 = 81 µM
dbacp06871 RR-1-RR RRWQWRWQWRR Synthetic analogue of LfcinB(21-25)Pal Apoptosis inducing MTT assay MCF-7 Breast Cancer IC50 = 58 µM
dbacp06872 RR-1-RR RRWQWRWQWRR Synthetic analogue of LfcinB(21-25)Pal Apoptosis inducing MTT assay MDA-MB-231 Breast Cancer IC50 = 67 µM
dbacp06873 R-1-RR RWQWRWQWRR Synthetic analogue of LfcinB(21-25)Pal Apoptosis inducing MTT assay MCF-7 Breast Cancer IC50 = 122 µM
dbacp06874 R-1-RR RWQWRWQWRR Synthetic analogue of LfcinB(21-25)Pal Apoptosis inducing MTT assay MDA-MB-231 Breast Cancer IC50 = 95 µM
dbacp06875 RR-1-R RRWQWRWQWR Synthetic analogue of LfcinB(21-25)Pal Apoptosis inducing MTT assay MCF-7 Breast Cancer IC50 = 68 µM
dbacp06876 RR-1-R RRWQWRWQWR Synthetic analogue of LfcinB(21-25)Pal Apoptosis inducing MTT assay MDA-MB-231 Breast Cancer IC50 = 73 µM
dbacp06877 1 WQWRWQW Synthetic analogue of LfcinB(21-25)Pal Apoptosis inducing MTT assay MCF-7 Breast Cancer IC50 = 105 µM
dbacp06878 1 WQWRWQW Synthetic analogue of LfcinB(21-25)Pal Apoptosis inducing MTT assay MDA-MB-231 Breast Cancer IC50 > 170 µM
dbacp06879 R-1 RWQWRWQW Synthetic analogue of LfcinB(21-25)Pal Apoptosis inducing MTT assay MCF-7 Breast Cancer IC50 = 58 µM
dbacp06880 R-1 RWQWRWQW Synthetic analogue of LfcinB(21-25)Pal Apoptosis inducing MTT assay MDA-MB-231 Breast Cancer IC50 > 150 µM
dbacp06881 1-R WQWRWQWR Synthetic analogue of LfcinB(21-25)Pal Apoptosis inducing MTT assay MCF-7 Breast Cancer IC50 = 130 µM
dbacp06882 1-R WQWRWQWR Synthetic analogue of LfcinB(21-25)Pal Apoptosis inducing MTT assay MDA-MB-231 Breast Cancer IC50 > 150 µM
dbacp06883 trichoderin A MDA-P-Cha-Aib-Aib-IV-Aib-Aib-AMAE Trichoderma sp. fungus, strain 05FI48 Apoptosis inducing PrestoBlue assay BxPC-3 Pancreatic Cancer IC50 = 0.4 μM
dbacp06884 trichoderin A MDA-P-Cha-Aib-Aib-IV-Aib-Aib-AMAE Trichoderma sp. fungus, strain 05FI48 Apoptosis inducing CyQUANT Direct assay PANC-1 Pancreatic Cancer IC50 = 0.3 μM
dbacp06885 trichoderin A analogue 4 P-Cha-Aib-Aib-IV-Aib-Aib-AMAE Trichoderin A Apoptosis inducing PrestoBlue assay BxPC-3 Pancreatic Cancer IC50 = 0.4 μM
dbacp06886 trichoderin A analogue 12 P-Cha-Aib-Aib-IV-Aib-Aib-AMAE Trichoderin A Apoptosis inducing PrestoBlue assay BxPC-3 Pancreatic Cancer IC50 > 1 μM
dbacp06887 trichoderin A analogue 13 P-Cha-Aib-Aib-IV-Aib-Aib-AMAE Trichoderin A Apoptosis inducing PrestoBlue assay BxPC-3 Pancreatic Cancer IC50 > 1 μM
dbacp06888 trichoderin A analogue 14 P-Cha-Aib-Aib-IV-Aib-Aib-AMAE Trichoderin A Apoptosis inducing PrestoBlue assay BxPC-3 Pancreatic Cancer IC50 = 0.6 μM
dbacp06889 trichoderin A analogue 15 P-Cha-Aib-Aib-IV-Aib-Aib-AMAE Trichoderin A Apoptosis inducing PrestoBlue assay BxPC-3 Pancreatic Cancer IC50 = 0.5 μM
dbacp06890 trichoderin A analogue 16 P-Cha-Aib-Aib-IV-Aib-Aib-AMAE Trichoderin A Apoptosis inducing PrestoBlue assay BxPC-3 Pancreatic Cancer IC50 = 0.4 μM
dbacp06891 trichoderin A analogue 17 P-Cha-Aib-Aib-IV-Aib-Aib-AMAE Trichoderin A Apoptosis inducing PrestoBlue assay BxPC-3 Pancreatic Cancer IC50 = 0.4 μM
dbacp06892 trichoderin A analogue 18 P-Cha-Aib-Aib-IV-Aib-Aib-AMAE Trichoderin A Apoptosis inducing PrestoBlue assay BxPC-3 Pancreatic Cancer IC50 = 0.2 μM
dbacp06893 trichoderin A analogue 4 P-Cha-Aib-Aib-IV-Aib-Aib-AMAE Trichoderin A Apoptosis inducing CyQUANT Direct assay PANC-1 Pancreatic Cancer IC50 = 0.5 μM
dbacp06894 trichoderin A analogue 12 P-Cha-Aib-Aib-IV-Aib-Aib-AMAE Trichoderin A Apoptosis inducing CyQUANT Direct assay PANC-1 Pancreatic Cancer IC50 > 9 μM
dbacp06895 trichoderin A analogue 13 P-Cha-Aib-Aib-IV-Aib-Aib-AMAE Trichoderin A Apoptosis inducing CyQUANT Direct assay PANC-1 Pancreatic Cancer IC50 = 6.0 μM
dbacp06896 trichoderin A analogue 14 P-Cha-Aib-Aib-IV-Aib-Aib-AMAE Trichoderin A Apoptosis inducing CyQUANT Direct assay PANC-1 Pancreatic Cancer IC50 = 1.8 μM
dbacp06897 trichoderin A analogue 15 P-Cha-Aib-Aib-IV-Aib-Aib-AMAE Trichoderin A Apoptosis inducing CyQUANT Direct assay PANC-1 Pancreatic Cancer IC50 = 0.9 μM
dbacp06898 trichoderin A analogue 16 P-Cha-Aib-Aib-IV-Aib-Aib-AMAE Trichoderin A Apoptosis inducing CyQUANT Direct assay PANC-1 Pancreatic Cancer IC50 = 0.5 μM
dbacp06899 trichoderin A analogue 17 P-Cha-Aib-Aib-IV-Aib-Aib-AMAE Trichoderin A Apoptosis inducing CyQUANT Direct assay PANC-1 Pancreatic Cancer IC50 = 0.6 μM
dbacp06900 trichoderin A analogue 18 P-Cha-Aib-Aib-IV-Aib-Aib-AMAE Trichoderin A Apoptosis inducing CyQUANT Direct assay PANC-1 Pancreatic Cancer IC50 = 0.2 μM
dbacp06901 trichoderin A analogue 19 P-Cha-Aib-Aib-IV-Aib-Aib-AMAE Trichoderin A Apoptosis inducing CyQUANT Direct assay PANC-1 Pancreatic Cancer IC50 = 0.2 μM
dbacp06902 trichoderin A analogue 19 MDA-P-AHMOD-Aib-Aib-IV-Aib-Aib-AMAE Trichoderin A Apoptosis inducing PrestoBlue assay BxPC-3 Pancreatic Cancer IC50 = 0.1 μM
dbacp06904 LFcin17–30 FKCRRWQWRMKKLG Lectoferrin Peptide Apoptosis inducing MTT assay HepG-2 Liver Cancer cell viability ~ 50% at 1 µM
dbacp06905 LFcin17–30 FKCRRWQWRMKKLG Lectoferrin Peptide Apoptosis inducing MTT assay Jurkat Blood Cancer cell viability ~ 70% at 20 µM
dbacp06906 LFampin265–284 DLIWKLLSKAQEKFGKNKSR Lectoferrin Peptide Apoptosis inducing MTT assay HepG-2 Liver Cancer cell viability ~ 50% at 1 µM
dbacp06907 LFampin265–284 DLIWKLLSKAQEKFGKNKSR Lectoferrin Peptide Apoptosis inducing MTT assay Jurkat Blood Cancer cell viability ~ 47% at 10 µM
dbacp06908 LFchimera FKCRRWQWRMKKLG-K-RSKNKGFKEQAKSLLKWILD Synthetic - Lectoferrin chimera Apoptosis inducing MTT assay HepG-2 Liver Cancer cell viability ~ 44% at 10 µM
dbacp06909 LFchimera FKCRRWQWRMKKLG-K-RSKNKGFKEQAKSLLKWILD Synthetic - Lectoferrin chimera Apoptosis inducing MTT assay Jurkat Blood Cancer cell viability ~ 8% at 20 µM
dbacp06917 KM8 KLLKINLKALAALAKKIL Synthetic derivative of Mastoparan Apoptosis inducing Not Available Not Available Not Available Not Available
dbacp06918 KM8-Aib KLLKINLK(Aib)LAALAKKIL Synthetic derivative of KM8 Apoptosis inducing Not Available Not Available Not Available Not Available
dbacp06941 PS14 PTECQVGTTCKVES Aphanomyces invadans Apoptosis inducing MTT assay Hep-2 Larynx Cancer IC50 = 21 µM
dbacp06942 HTDT-6-2-3-2 GPLGAGP Enteromorpha prolifera Apoptosis inducing CCK-8 assay NCI-H-460 Lung Cancer IC50 = 0.3686 ± 0.0935 mg/mL
dbacp06943 HTDT-6-2-3-2 GPLGAGP Enteromorpha prolifera Apoptosis inducing CCK-8 assay HepG-2 Liver Cancer IC50 = 1.2564 ± 0.0548 mg/mL
dbacp06944 HTDT-6-2-3-2 GPLGAGP Enteromorpha prolifera Apoptosis inducing CCK-8 assay A-549 Lung Cancer IC50 = 0.9867 ± 0.0857 mg/mL
dbacp06980 Ponericin-W1 (11-25), At1 KLLPSVVGLFKKKKQ Synthetic Apoptosis inducing MTT assay A-549 Lung Cancer IC50 > 100 µM
dbacp06981 Ponericin-W1 (11-25), At1 KLLPSVVGLFKKKKQ Synthetic Apoptosis inducing MTT assay HepG-2 Liver Cancer IC50 >100 µM
dbacp06982 Ponericin-W1 (11-25) [P4K KLLKKVVKLFKKKKK Synthetic Apoptosis inducing MTT assay A-549 Lung Cancer IC50 >100 µM
dbacp06983 Ponericin-W1 (11-25) [P4K KLLKKVVKLFKKKKK Synthetic Apoptosis inducing MTT assay HepG-2 Liver Cancer IC50 >100 µM
dbacp06984 Ponericin-W1 (11-25) [P4K KLLKKVVKLFKKLLK Synthetic Apoptosis inducing MTT assay A-549 Lung Cancer IC50 = 4.3 µM
dbacp06985 Ponericin-W1 (11-25) [P4K KLLKKVVKLFKKLLK Synthetic Apoptosis inducing MTT assay HepG-2 Liver Cancer IC50 = 2.2 µM
dbacp06986 At4 KLLKKLLKLLKKLLK Synthetic Apoptosis inducing MTT assay A-549 Lung Cancer IC50 = 7.2 µM
dbacp06987 At4 KLLKKLLKLLKKLLK Synthetic Apoptosis inducing MTT assay HepG-2 Liver Cancer IC50 = 2.5 µM
dbacp06988 At5 KIIKKIIKIIKKIIK Synthetic Apoptosis inducing MTT assay A-549 Lung Cancer IC50 = 3.6 µM
dbacp06989 At5 KIIKKIIKIIKKIIK Synthetic Apoptosis inducing MTT assay HepG-2 Liver Cancer IC50 = 1.5 µM
dbacp06990 At6 KVVKKVVKVVKKVVK Synthetic Apoptosis inducing MTT assay A-549 Lung Cancer IC50 > 100 µM
dbacp06991 At6 KVVKKVVKVVKKVVK Synthetic Apoptosis inducing MTT assay HepG-2 Liver Cancer IC50 = 70.8 µM
dbacp06992 At7 KIIKKIKKKIKKIIK Synthetic Apoptosis inducing MTT assay A-549 Lung Cancer IC50 = 10.3 µM
dbacp06993 At7 KIIKKIKKKIKKIIK Synthetic Apoptosis inducing MTT assay HepG-2 Liver Cancer IC50 = 8.8 µM
dbacp06994 At8 KLLKKLKKKLKKLLK Synthetic Apoptosis inducing MTT assay A-549 Lung Cancer IC50 = 13.4 µM
dbacp06995 At8 KLLKKLKKKLKKLLK Synthetic Apoptosis inducing MTT assay HepG-2 Liver Cancer IC50 = 8.9 µM
dbacp06996 At9 KVVKKVKKKVKKVVK Synthetic Apoptosis inducing MTT assay A-549 Lung Cancer IC50 = 100 µM
dbacp06997 At9 KVVKKVKKKVKKVVK Synthetic Apoptosis inducing MTT assay HepG-2 Liver Cancer IC50 = 51.7 µM
dbacp06998 At10 IKKIIKIIKKIIKKI Synthetic Apoptosis inducing MTT assay A-549 Lung Cancer IC50 = 4.4 µM
dbacp06999 At10 IKKIIKIIKKIIKKI Synthetic Apoptosis inducing MTT assay HepG-2 Liver Cancer IC50 = 3.2 µM
dbacp07000 At11 IIIKKIKKKIKKIII Synthetic Apoptosis inducing MTT assay A-549 Lung Cancer IC50 = 7.9 µM
dbacp07001 At11 IIIKKIKKKIKKIII Synthetic Apoptosis inducing MTT assay HepG-2 Liver Cancer IC50 = 7.6 µM
dbacp07002 At12 KIIIKIKKKIKIIIK Synthetic Apoptosis inducing MTT assay A-549 Lung Cancer IC50 = 14.0 µM
dbacp07003 At12 KIIIKIKKKIKIIIK Synthetic Apoptosis inducing MTT assay HepG-2 Liver Cancer IC50 = 13.4 µM
dbacp07986 SmacN7-Arg8 fused peptide P4 Ahx-AVPIAQK(KRRRRRRRRRE) Synthetic Apoptosis inducing Cell Titer Blue Cell Viability assay U-266 Skin Cancer Cell viability < 50% at 50 μM
dbacp07987 SmacN7-Arg8 fused peptide P5 Ahx-(KAVPIAQKE)RRRRRRRR Synthetic Apoptosis inducing Cell Titer Blue Cell Viability assay U-266 Skin Cancer Cell viability < 50% at 50 μM
dbacp07988 SmacN7-Arg8 fused peptide P7 Ahx-(KAVPIAQKE)GG(KRRRRRRRRE) Synthetic Apoptosis inducing Cell Titer Blue Cell Viability assay U-266 Skin Cancer Cell viability < 50% at 50 μM
dbacp08136 Laterosporulin10 (LS10) ACVNQCPDAIDRFIVKDKGCHGVEKKYYKQVYVACMNGQHLYCRTEGGPCQL Brevibacillus sp. strain SKDU10 Apoptosis inducing MTT assay MCF-7 Breast Cancer 40% cytotoxicity at 5 μM concentration
dbacp08137 Laterosporulin10 (LS10) ACVNQCPDAIDRFIVKDKGCHGVEKKYYKQVYVACMNGQHLYCRTEGGPCQL Brevibacillus sp. strain SKDU10 Apoptosis inducing LDH leakage assay MCF-7 Breast Cancer >80% LDH release at 15 μM
dbacp08138 Laterosporulin10 (LS10) ACVNQCPDAIDRFIVKDKGCHGVEKKYYKQVYVACMNGQHLYCRTEGGPCQL Brevibacillus sp. strain SKDU10 Apoptosis inducing MTT assay HEK-293T Renal Cancer 20% cytotoxicity 5 μM concentration
dbacp08139 Laterosporulin10 (LS10) ACVNQCPDAIDRFIVKDKGCHGVEKKYYKQVYVACMNGQHLYCRTEGGPCQL Brevibacillus sp. strain SKDU10 Apoptosis inducing MTT assay HT-1080 Fibrosarcoma 20% cytotoxicity 5 μM concentration
dbacp08140 Laterosporulin10 (LS10) ACVNQCPDAIDRFIVKDKGCHGVEKKYYKQVYVACMNGQHLYCRTEGGPCQL Brevibacillus sp. strain SKDU10 Apoptosis inducing MTT assay HeLa Cervical Cancer 20% cytotoxicity 5 μM concentration
dbacp08141 Laterosporulin10 (LS10) ACVNQCPDAIDRFIVKDKGCHGVEKKYYKQVYVACMNGQHLYCRTEGGPCQL Brevibacillus sp. strain SKDU10 Apoptosis inducing LDH leakage assay HeLa Cervical Cancer ~80% LDH release at 15 μM
dbacp08142 Laterosporulin10 (LS10) ACVNQCPDAIDRFIVKDKGCHGVEKKYYKQVYVACMNGQHLYCRTEGGPCQL Brevibacillus sp. strain SKDU10 Apoptosis inducing MTT assay H-1299 Lung Cancer 80% cytotoxicity 10 μM concentration
dbacp08143 MccJ25-18-4 GGAGHVPEYFVGIGTPISFYG-WxEAAYQrFL Synthetic Apoptosis inducing MTT assay MCF-7 Breast Cancer IC50 = 14.2 ± 1.5 μM
dbacp08144 MccJ25-18-4 GGAGHVPEYFVGIGTPISFYG-WxEAAYQrFL Synthetic Apoptosis inducing MTT assay MDA-MB-435 Breast Cancer IC50 = 20.0 ± 0.5 μM
dbacp08145 MccJ25-18-4 GGAGHVPEYFVGIGTPISFYG-WxEAAYQrFL Synthetic Apoptosis inducing MTT assay MDA-MB-435-MDR Breast Cancer IC50 = 25.0 ± 0.5 μM