559 result(s) have been found!
| Accession | Name | Sequence | Source/Organism | Mechanism | Assay Type | Cell Line | Cancer Type | Activity |
|---|---|---|---|---|---|---|---|---|
| dbacp00028 | Enkephalins7 analogue-8 | YA* | Synthetic Peptide | Apoptosis inducing | MTT/MTS assay | HEp-2 | Larynx cancer | 14.2% inhibition at 10-6 M |
| dbacp00029 | Enkephalins7 analogue-8 | YA* | Synthetic Peptide | Apoptosis inducing | MTT/MTS assay | HEp-2 | Larynx cancer | 19.7% inhibition at 10-5 M |
| dbacp00030 | Enkephalins7 analogue-8 | YA* | Synthetic Peptide | Apoptosis inducing | MTT/MTS assay | HEp-2 | Larynx cancer | 24.9% inhibition at 10-4 M |
| dbacp00031 | Enkephalins7 analogue-8 | YA* | Synthetic Peptide | Apoptosis inducing | MTT/MTS assay | HEp-2 | Larynx cancer | 30.4% inhibition at 10-3 M |
| dbacp00032 | Enkephalins7 analogue-8 | YA* | Synthetic Peptide | Apoptosis inducing | MTT/MTS assay | HeLa | Cervical cancer | 10% inhibition at 10-5 M |
| dbacp00033 | Enkephalins7 analogue-8 | YA* | Synthetic Peptide | Apoptosis inducing | MTT/MTS assay | HeLa | Cervical cancer | 8.2% inhibition at 10-4 M |
| dbacp00034 | Enkephalins7 analogue-8 | YA* | Synthetic Peptide | Apoptosis inducing | MTT/MTS assay | HeLa | Cervical cancer | 36.1% inhibition at 10-3 M |
| dbacp00035 | Enkephalins7 analogue-8 | YA* | Synthetic Peptide | Apoptosis inducing | MTT/MTS assay | HBL | Skin cancer | 6.5% inhibition at 10-6 M |
| dbacp00036 | Enkephalins7 analogue-8 | YA* | Synthetic Peptide | Apoptosis inducing | MTT/MTS assay | HBL | Skin cancer | 14% inhibition at 10-5 M |
| dbacp00037 | Enkephalins7 analogue-8 | YA* | Synthetic Peptide | Apoptosis inducing | MTT/MTS assay | HBL | Skin cancer | 7.5% inhibition at 10-4 M |
| dbacp00038 | Enkephalins7 analogue-8 | YA* | Synthetic Peptide | Apoptosis inducing | MTT/MTS assay | HBL | Skin cancer | 14% inhibition at 10-3 M |
| dbacp00039 | Enkephalins7 analogue-8 | YA* | Synthetic Peptide | Apoptosis inducing | MTT/MTS assay | HT-29 | Colon cancer | 9.8% inhibition at 10-6 M |
| dbacp00040 | Enkephalins7 analogue-8 | YA* | Synthetic Peptide | Apoptosis inducing | MTT/MTS assay | HT-29 | Colon cancer | 1.6% inhibition at 10-5 M |
| dbacp00041 | Enkephalins7 analogue-8 | YA* | Synthetic Peptide | Apoptosis inducing | MTT/MTS assay | HT-29 | Colon cancer | 5.4% inhibition at 10-4 M |
| dbacp00042 | Enkephalins7 analogue-8 | YA* | Synthetic Peptide | Apoptosis inducing | MTT/MTS assay | HT-29 | Colon cancer | 26.5% inhibition at 10-3 M |
| dbacp00043 | Enkephalins7 analogue-8 | YA* | Synthetic Peptide | Apoptosis inducing | MTT/MTS assay | SW-620 | Colon cancer | 12.9% inhibition at 10-6 M |
| dbacp00044 | Enkephalins7 analogue-8 | YA* | Synthetic Peptide | Apoptosis inducing | MTT/MTS assay | SW-620 | Colon cancer | 16.5% inhibition at 10-5 M |
| dbacp00045 | Enkephalins7 analogue-8 | YA* | Synthetic Peptide | Apoptosis inducing | MTT/MTS assay | SW-620 | Colon cancer | 28.1% inhibition at 10-4 M |
| dbacp00046 | Enkephalins7 analogue-8 | YA* | Synthetic Peptide | Apoptosis inducing | MTT/MTS assay | SW-620 | Colon cancer | 58.2% inhibition at 10-3 M |
| dbacp00047 | Enkephalins7 analogue-8 | YA* | Synthetic Peptide | Apoptosis inducing | MTT/MTS assay | CaCo-2 | Colon cancer | 3.5% inhibition at 10-6 M |
| dbacp00048 | Enkephalins7 analogue-8 | YA* | Synthetic Peptide | Apoptosis inducing | MTT/MTS assay | CaCo-2 | Colon cancer | 22.7% inhibition at 10-5 M |
| dbacp00049 | Enkephalins7 analogue-8 | YA* | Synthetic Peptide | Apoptosis inducing | MTT/MTS assay | CaCo-2 | Colon cancer | 18.9% inhibition at 10-4 M |
| dbacp00050 | Enkephalins7 analogue-8 | YA* | Synthetic Peptide | Apoptosis inducing | MTT/MTS assay | CaCo-2 | Colon cancer | 26.4% inhibition at 10-3 M |
| dbacp00051 | Enkephalins7 analogue-8 | YA* | Synthetic Peptide | Apoptosis inducing | MTT/MTS assay | MCF-7 | Breast cancer | 2.4% inhibition at 10-5 M |
| dbacp00052 | Enkephalins7 analogue-8 | YA* | Synthetic Peptide | Apoptosis inducing | MTT/MTS assay | MCF-7 | Breast cancer | 7.5% inhibition at 10-4 M |
| dbacp00053 | Enkephalins7 analogue-9 | YSA* | Synthetic Peptide | Apoptosis inducing | MTT/MTS assay | HEp-2 | Larynx cancer | 6.2% inhibition at 10-6 M |
| dbacp00054 | Enkephalins7 analogue-9 | YSA* | Synthetic Peptide | Apoptosis inducing | MTT/MTS assay | HEp-2 | Larynx cancer | 6.4% inhibition at 10-5 M |
| dbacp00055 | Enkephalins7 analogue-9 | YSA* | Synthetic Peptide | Apoptosis inducing | MTT/MTS assay | HEp-2 | Larynx cancer | 8.2% inhibition at 10-4 M |
| dbacp00056 | Enkephalins7 analogue-9 | YSA* | Synthetic Peptide | Apoptosis inducing | MTT/MTS assay | HEp-2 | Larynx cancer | 21.2% inhibition at 10-3 M |
| dbacp00057 | Enkephalins7 analogue-9 | YSA* | Synthetic Peptide | Apoptosis inducing | MTT/MTS assay | HeLa | Cervical cancer | 7.5% inhibition at 10-6 M |
| dbacp00058 | Enkephalins7 analogue-9 | YSA* | Synthetic Peptide | Apoptosis inducing | MTT/MTS assay | HeLa | Cervical cancer | 6.1% inhibition at 10-5 M |
| dbacp00059 | Enkephalins7 analogue-9 | YSA* | Synthetic Peptide | Apoptosis inducing | MTT/MTS assay | HeLa | Cervical cancer | 3.1% inhibition at 10-4 M |
| dbacp00060 | Enkephalins7 analogue-9 | YSA* | Synthetic Peptide | Apoptosis inducing | MTT/MTS assay | HeLa | Cervical cancer | 14.8% inhibition at 10-3 M |
| dbacp00061 | Enkephalins7 analogue-9 | YSA* | Synthetic Peptide | Apoptosis inducing | MTT/MTS assay | HBL | Skin cancer | 3.9% inhibition at 10-5 M |
| dbacp00062 | Enkephalins7 analogue-9 | YSA* | Synthetic Peptide | Apoptosis inducing | MTT/MTS assay | HBL | Skin cancer | 7.3% inhibition at 10-3 M |
| dbacp00063 | Enkephalins7 analogue-9 | YSA* | Synthetic Peptide | Apoptosis inducing | MTT/MTS assay | HT-29 | Colon cancer | 4.9% inhibition at 10-6 M |
| dbacp00064 | Enkephalins7 analogue-9 | YSA* | Synthetic Peptide | Apoptosis inducing | MTT/MTS assay | HT-29 | Colon cancer | 8.9% inhibition at 10-5 M |
| dbacp00065 | Enkephalins7 analogue-9 | YSA* | Synthetic Peptide | Apoptosis inducing | MTT/MTS assay | HT-29 | Colon cancer | 3.4% inhibition at 10-4 M |
| dbacp00066 | Enkephalins7 analogue-9 | YSA* | Synthetic Peptide | Apoptosis inducing | MTT/MTS assay | HT-29 | Colon cancer | 20.8% inhibition at 10-3 M |
| dbacp00067 | Enkephalins7 analogue-9 | YSA* | Synthetic Peptide | Apoptosis inducing | MTT/MTS assay | SW-620 | Colon cancer | 10.5% inhibition at 10-6 M |
| dbacp00068 | Enkephalins7 analogue-9 | YSA* | Synthetic Peptide | Apoptosis inducing | MTT/MTS assay | SW-620 | Colon cancer | 21.9% inhibition at 10-5 M |
| dbacp00069 | Enkephalins7 analogue-9 | YSA* | Synthetic Peptide | Apoptosis inducing | MTT/MTS assay | SW-620 | Colon cancer | 11.8% inhibition at 10-4 M |
| dbacp00070 | Enkephalins7 analogue-9 | YSA* | Synthetic Peptide | Apoptosis inducing | MTT/MTS assay | SW-620 | Colon cancer | 17.9% inhibition at 10-3 M |
| dbacp00071 | Enkephalins7 analogue-9 | YSA* | Synthetic Peptide | Apoptosis inducing | MTT/MTS assay | CaCo-2 | Colon cancer | 3.7% inhibition at 10-6 M |
| dbacp00072 | Enkephalins7 analogue-9 | YSA* | Synthetic Peptide | Apoptosis inducing | MTT/MTS assay | CaCo-2 | Colon cancer | 16.5% inhibition at 10-5 M |
| dbacp00073 | Enkephalins7 analogue-9 | YSA* | Synthetic Peptide | Apoptosis inducing | MTT/MTS assay | CaCo-2 | Colon cancer | 8.4% inhibition at 10-4 M |
| dbacp00074 | Enkephalins7 analogue-9 | YSA* | Synthetic Peptide | Apoptosis inducing | MTT/MTS assay | CaCo-2 | Colon cancer | 14.5% inhibition at 10-3 M |
| dbacp00075 | Enkephalins7 analogue-9 | YSA* | Synthetic Peptide | Apoptosis inducing | MTT/MTS assay | MCF-7 | Breast cancer | 1.1% inhibition at 10-5 M |
| dbacp00076 | Enkephalins7 analogue-9 | YSA* | Synthetic Peptide | Apoptosis inducing | MTT/MTS assay | MCF-7 | Breast cancer | 1.2% inhibition at 10-4 M |
| dbacp00077 | Enkephalins7 analogue-9 | YSA* | Synthetic Peptide | Apoptosis inducing | MTT/MTS assay | MCF-7 | Breast cancer | 17.8% inhibition at 10-3 M |
| dbacp00078 | Enkephalins7 analogue-10 | YSA* | Synthetic Peptide | Apoptosis inducing | MTT/MTS assay | HEp-2 | Larynx cancer | 8.5% inhibition at 10-6 M |
| dbacp00079 | Enkephalins7 analogue-10 | YSA* | Synthetic Peptide | Apoptosis inducing | MTT/MTS assay | HEp-2 | Larynx cancer | 4.9% inhibition at 10-5 M |
| dbacp00080 | Enkephalins7 analogue-10 | YSA* | Synthetic Peptide | Apoptosis inducing | MTT/MTS assay | HEp-2 | Larynx cancer | 1.9% inhibition at 10-4 M |
| dbacp00081 | Enkephalins7 analogue-10 | YSA* | Synthetic Peptide | Apoptosis inducing | MTT/MTS assay | HEp-2 | Larynx cancer | 16.2% inhibition at 10-3 M |
| dbacp00082 | Enkephalins7 analogue-10 | YSA* | Synthetic Peptide | Apoptosis inducing | MTT/MTS assay | HeLa | Cervical cancer | 7.2% inhibition at 10-6 M |
| dbacp00083 | Enkephalins7 analogue-10 | YSA* | Synthetic Peptide | Apoptosis inducing | MTT/MTS assay | HeLa | Cervical cancer | 17.1% inhibition at 10-5 M |
| dbacp00084 | Enkephalins7 analogue-10 | YSA* | Synthetic Peptide | Apoptosis inducing | MTT/MTS assay | HeLa | Cervical cancer | 11.0% inhibition at 10-4 M |
| dbacp00085 | Enkephalins7 analogue-10 | YSA* | Synthetic Peptide | Apoptosis inducing | MTT/MTS assay | HeLa | Cervical cancer | 20.5% inhibition at 10-3 M |
| dbacp00086 | Enkephalins7 analogue-10 | YSA* | Synthetic Peptide | Apoptosis inducing | MTT/MTS assay | HBL | Skin cancer | 3.0% inhibition at 10-6 M |
| dbacp00087 | Enkephalins7 analogue-10 | YSA* | Synthetic Peptide | Apoptosis inducing | MTT/MTS assay | HBL | Skin cancer | 4.7% inhibition at 10-5 M |
| dbacp00088 | Enkephalins7 analogue-10 | YSA* | Synthetic Peptide | Apoptosis inducing | MTT/MTS assay | HBL | Skin cancer | 2.7% inhibition at 10-4 M |
| dbacp00089 | Enkephalins7 analogue-10 | YSA* | Synthetic Peptide | Apoptosis inducing | MTT/MTS assay | HBL | Skin cancer | 7.3% inhibition at 10-3 M |
| dbacp00090 | Enkephalins7 analogue-10 | YSA* | Synthetic Peptide | Apoptosis inducing | MTT/MTS assay | HT-29 | Colon cancer | 0.7% inhibition at 10-6 M |
| dbacp00091 | Enkephalins7 analogue-10 | YSA* | Synthetic Peptide | Apoptosis inducing | MTT/MTS assay | HT-29 | Colon cancer | 8.3% inhibition at 10-5 M |
| dbacp00092 | Enkephalins7 analogue-10 | YSA* | Synthetic Peptide | Apoptosis inducing | MTT/MTS assay | HT-29 | Colon cancer | 10.5% inhibition at 10-4 M |
| dbacp00093 | Enkephalins7 analogue-10 | YSA* | Synthetic Peptide | Apoptosis inducing | MTT/MTS assay | HT-29 | Colon cancer | 21.8% inhibition at 10-3 M |
| dbacp00094 | Enkephalins7 analogue-10 | YSA* | Synthetic Peptide | Apoptosis inducing | MTT/MTS assay | SW-620 | Colon cancer | 10.7% inhibition at 10-6 M |
| dbacp00095 | Enkephalins7 analogue-10 | YSA* | Synthetic Peptide | Apoptosis inducing | MTT/MTS assay | SW-620 | Colon cancer | 10.0% inhibition at 10-5 M |
| dbacp00096 | Enkephalins7 analogue-10 | YSA* | Synthetic Peptide | Apoptosis inducing | MTT/MTS assay | MCF-7 | Breast cancer | 7.7% inhibition at 10-4 M |
| dbacp00097 | Enkephalins7 analogue-10 | YSA* | Synthetic Peptide | Apoptosis inducing | MTT/MTS assay | MCF-7 | Breast cancer | 18.7% inhibition at 10-3 M |
| dbacp00125 | Enkephalins7 analogue-15 | YSA*G | Synthetic Peptide | Apoptosis inducing | MTT/MTS assay | HEp-2 | Larynx cancer | 2.7% inhibition at 10-6 M |
| dbacp00126 | Enkephalins7 analogue-15 | YSA*G | Synthetic Peptide | Apoptosis inducing | MTT/MTS assay | HEp-2 | Larynx cancer | 2.0% inhibition at 10-5 M |
| dbacp00127 | Enkephalins7 analogue-15 | YSA*G | Synthetic Peptide | Apoptosis inducing | MTT/MTS assay | HEp-2 | Larynx cancer | 18.8% inhibition at 10-4 M |
| dbacp00128 | Enkephalins7 analogue-15 | YSA*G | Synthetic Peptide | Apoptosis inducing | MTT/MTS assay | HEp-2 | Larynx cancer | 26.7% inhibition at 10-3 M |
| dbacp00129 | Enkephalins7 analogue-15 | YSA*G | Synthetic Peptide | Apoptosis inducing | MTT/MTS assay | HeLa | Cervical cancer | 9.8% inhibition at 10-6 M |
| dbacp00130 | Enkephalins7 analogue-15 | YSA*G | Synthetic Peptide | Apoptosis inducing | MTT/MTS assay | HeLa | Cervical cancer | 7.3% inhibition at 10-5 M |
| dbacp00131 | Enkephalins7 analogue-15 | YSA*G | Synthetic Peptide | Apoptosis inducing | MTT/MTS assay | HeLa | Cervical cancer | 9.9% inhibition at 10-4 M |
| dbacp00132 | Enkephalins7 analogue-15 | YSA*G | Synthetic Peptide | Apoptosis inducing | MTT/MTS assay | HeLa | Cervical cancer | 28.2% inhibition at 10-3 M |
| dbacp00133 | Enkephalins7 analogue-15 | YSA*G | Synthetic Peptide | Apoptosis inducing | MTT/MTS assay | HBL | Skin cancer | 1.6% inhibition at 10-6 M |
| dbacp00134 | Enkephalins7 analogue-15 | YSA*G | Synthetic Peptide | Apoptosis inducing | MTT/MTS assay | HBL | Skin cancer | 2.9% inhibition at 10-5 M |
| dbacp00135 | Enkephalins7 analogue-15 | YSA*G | Synthetic Peptide | Apoptosis inducing | MTT/MTS assay | HBL | Skin cancer | 5.9% inhibition at 10-4 M |
| dbacp00136 | Enkephalins7 analogue-15 | YSA*G | Synthetic Peptide | Apoptosis inducing | MTT/MTS assay | HBL | Skin cancer | 17.9% inhibition at 10-3 M |
| dbacp00137 | Enkephalins7 analogue-15 | YSA*G | Synthetic Peptide | Apoptosis inducing | MTT/MTS assay | HT-29 | Colon cancer | 5.4% inhibition at 10-6 M |
| dbacp00138 | Enkephalins7 analogue-15 | YSA*G | Synthetic Peptide | Apoptosis inducing | MTT/MTS assay | HT-29 | Colon cancer | 7.4% inhibition at 10-5 M |
| dbacp00139 | Enkephalins7 analogue-15 | YSA*G | Synthetic Peptide | Apoptosis inducing | MTT/MTS assay | HT-29 | Colon cancer | 9.5% inhibition at 10-4 M |
| dbacp00140 | Enkephalins7 analogue-15 | YSA*G | Synthetic Peptide | Apoptosis inducing | MTT/MTS assay | HT-29 | Colon cancer | 15.7% inhibition at 10-3 M |
| dbacp00141 | Enkephalins7 analogue-15 | YSA*G | Synthetic Peptide | Apoptosis inducing | MTT/MTS assay | SW-620 | Colon cancer | 13.6% inhibition at 10-6 M |
| dbacp00142 | Enkephalins7 analogue-15 | YSA*G | Synthetic Peptide | Apoptosis inducing | MTT/MTS assay | SW-620 | Colon cancer | 20.4% inhibition at 10-5 M |
| dbacp00143 | Enkephalins7 analogue-15 | YSA*G | Synthetic Peptide | Apoptosis inducing | MTT/MTS assay | SW-620 | Colon cancer | 14.4% inhibition at 10-4 M |
| dbacp00144 | Enkephalins7 analogue-15 | YSA*G | Synthetic Peptide | Apoptosis inducing | MTT/MTS assay | SW-620 | Colon cancer | 23.4% inhibition at 10-3 M |
| dbacp00145 | Enkephalins7 analogue-15 | YSA*G | Synthetic Peptide | Apoptosis inducing | MTT/MTS assay | CaCo-2 | Colon cancer | 2.2% inhibition at 10-6 M |
| dbacp00146 | Enkephalins7 analogue-15 | YSA*G | Synthetic Peptide | Apoptosis inducing | MTT/MTS assay | CaCo-2 | Colon cancer | 4.2% inhibition at 10-5 M |
| dbacp00147 | Enkephalins7 analogue-15 | YSA*G | Synthetic Peptide | Apoptosis inducing | MTT/MTS assay | CaCo-2 | Colon cancer | 6.4% inhibition at 10-4 M |
| dbacp00148 | Enkephalins7 analogue-15 | YSA*G | Synthetic Peptide | Apoptosis inducing | MTT/MTS assay | CaCo-2 | Colon cancer | 6.2% inhibition at 10-3 M |
| dbacp00149 | Enkephalins7 analogue-15 | YSA*G | Synthetic Peptide | Apoptosis inducing | MTT/MTS assay | MCF-7 | Breast cancer | 21.2% inhibition at 10-3 M |
| dbacp00159 | Enkephalins7 analogue-16 | YRA*G | Synthetic Peptide | Apoptosis inducing | MTT/MTS assay | HEp-2 | Larynx cancer | 4.6% inhibition at 10-6 M |
| dbacp00160 | Enkephalins7 analogue-16 | YRA*G | Synthetic Peptide | Apoptosis inducing | MTT/MTS assay | HEp-2 | Larynx cancer | 4.9% inhibition at 10-5 M |
| dbacp00161 | Enkephalins7 analogue-16 | YRA*G | Synthetic Peptide | Apoptosis inducing | MTT/MTS assay | HEp-2 | Larynx cancer | 12.6% inhibition at 10-4 M |
| dbacp00162 | Enkephalins7 analogue-16 | YRA*G | Synthetic Peptide | Apoptosis inducing | MTT/MTS assay | HEp-2 | Larynx cancer | 26.4% inhibition at 10-3 M |
| dbacp00163 | Enkephalins7 analogue-16 | YRA*G | Synthetic Peptide | Apoptosis inducing | MTT/MTS assay | HeLa | Cervical cancer | 11.0% inhibition at 10-6 M |
| dbacp00164 | Enkephalins7 analogue-16 | YRA*G | Synthetic Peptide | Apoptosis inducing | MTT/MTS assay | HeLa | Cervical cancer | 11.7% inhibition at 10-5 M |
| dbacp00165 | Enkephalins7 analogue-16 | YRA*G | Synthetic Peptide | Apoptosis inducing | MTT/MTS assay | HeLa | Cervical cancer | 11.6% inhibition at 10-4 M |
| dbacp00166 | Enkephalins7 analogue-16 | YRA*G | Synthetic Peptide | Apoptosis inducing | MTT/MTS assay | HeLa | Cervical cancer | 28.2% inhibition at 10-3 M |
| dbacp00167 | Enkephalins7 analogue-16 | YRA*G | Synthetic Peptide | Apoptosis inducing | MTT/MTS assay | HBL | Skin cancer | 1.2% inhibition at 10-5 M |
| dbacp00168 | Enkephalins7 analogue-16 | YRA*G | Synthetic Peptide | Apoptosis inducing | MTT/MTS assay | HBL | Skin cancer | 3.3% inhibition at 10-4 M |
| dbacp00169 | Enkephalins7 analogue-16 | YRA*G | Synthetic Peptide | Apoptosis inducing | MTT/MTS assay | HBL | Skin cancer | 19.4% inhibition at 10-3 M |
| dbacp00170 | Enkephalins7 analogue-16 | YRA*G | Synthetic Peptide | Apoptosis inducing | MTT/MTS assay | HT-29 | Colon cancer | 7.6% inhibition at 10-6 M |
| dbacp00171 | Enkephalins7 analogue-16 | YRA*G | Synthetic Peptide | Apoptosis inducing | MTT/MTS assay | HT-29 | Colon cancer | 3.8% inhibition at 10-5 M |
| dbacp00172 | Enkephalins7 analogue-16 | YRA*G | Synthetic Peptide | Apoptosis inducing | MTT/MTS assay | HT-29 | Colon cancer | 12.4% inhibition at 10-4 M |
| dbacp00173 | Enkephalins7 analogue-16 | YRA*G | Synthetic Peptide | Apoptosis inducing | MTT/MTS assay | HT-29 | Colon cancer | 22.4% inhibition at 10-3 M |
| dbacp00174 | Enkephalins7 analogue-16 | YRA*G | Synthetic Peptide | Apoptosis inducing | MTT/MTS assay | SW-620 | Colon cancer | 17.0% inhibition at 10-6 M |
| dbacp00175 | Enkephalins7 analogue-16 | YRA*G | Synthetic Peptide | Apoptosis inducing | MTT/MTS assay | SW-620 | Colon cancer | 13.5% inhibition at 10-5 M |
| dbacp00176 | Enkephalins7 analogue-16 | YRA*G | Synthetic Peptide | Apoptosis inducing | MTT/MTS assay | SW-620 | Colon cancer | 13.5% inhibition at 10-4 M |
| dbacp00177 | Enkephalins7 analogue-16 | YRA*G | Synthetic Peptide | Apoptosis inducing | MTT/MTS assay | SW-620 | Colon cancer | 25.3% inhibition at 10-3 M |
| dbacp00178 | Enkephalins7 analogue-16 | YRA*G | Synthetic Peptide | Apoptosis inducing | MTT/MTS assay | CaCo-2 | Colon cancer | 8.1% inhibition at 10-6 M |
| dbacp00179 | Enkephalins7 analogue-16 | YRA*G | Synthetic Peptide | Apoptosis inducing | MTT/MTS assay | CaCo-2 | Colon cancer | 6.9% inhibition at 10-5 M |
| dbacp00180 | Enkephalins7 analogue-16 | YRA*G | Synthetic Peptide | Apoptosis inducing | MTT/MTS assay | CaCo-2 | Colon cancer | 8.1% inhibition at 10-4 M |
| dbacp00181 | Enkephalins7 analogue-16 | YRA*G | Synthetic Peptide | Apoptosis inducing | MTT/MTS assay | CaCo-2 | Colon cancer | 8.6% inhibition at 10-3 M |
| dbacp00182 | Enkephalins7 analogue-16 | YRA*G | Synthetic Peptide | Apoptosis inducing | MTT/MTS assay | MCF-7 | Breast cancer | 15.6% inhibition at 10-3 M |
| dbacp00192 | Enkephalins7 analogue-17 | YA*GFM | Synthetic Peptide | Apoptosis inducing | MTT/MTS assay | HEp-2 | Larynx cancer | 1.0% inhibition at 10-6 M |
| dbacp00193 | Enkephalins7 analogue-17 | YA*GFM | Synthetic Peptide | Apoptosis inducing | MTT/MTS assay | HEp-2 | Larynx cancer | 10.1% inhibition at 10-5 M |
| dbacp00194 | Enkephalins7 analogue-17 | YA*GFM | Synthetic Peptide | Apoptosis inducing | MTT/MTS assay | HEp-2 | Larynx cancer | 16.8% inhibition at 10-4 M |
| dbacp00195 | Enkephalins7 analogue-17 | YA*GFM | Synthetic Peptide | Apoptosis inducing | MTT/MTS assay | HEp-2 | Larynx cancer | 36.1% inhibition at 10-3 M |
| dbacp00196 | Enkephalins7 analogue-17 | YA*GFM | Synthetic Peptide | Apoptosis inducing | MTT/MTS assay | HeLa | Cervical cancer | 4.9% inhibition at 10-6 M |
| dbacp00197 | Enkephalins7 analogue-17 | YA*GFM | Synthetic Peptide | Apoptosis inducing | MTT/MTS assay | HeLa | Cervical cancer | 10.2% inhibition at 10-5 M |
| dbacp00198 | Enkephalins7 analogue-17 | YA*GFM | Synthetic Peptide | Apoptosis inducing | MTT/MTS assay | HeLa | Cervical cancer | 13.3% inhibition at 10-4 M |
| dbacp00199 | Enkephalins7 analogue-17 | YA*GFM | Synthetic Peptide | Apoptosis inducing | MTT/MTS assay | HeLa | Cervical cancer | 28.0% inhibition at 10-3 M |
| dbacp00200 | Enkephalins7 analogue-17 | YA*GFM | Synthetic Peptide | Apoptosis inducing | MTT/MTS assay | HBL | Skin cancer | 0.8% inhibition at 10-6 M |
| dbacp00201 | Enkephalins7 analogue-17 | YA*GFM | Synthetic Peptide | Apoptosis inducing | MTT/MTS assay | HBL | Skin cancer | 1.4% inhibition at 10-5 M |
| dbacp00202 | Enkephalins7 analogue-17 | YA*GFM | Synthetic Peptide | Apoptosis inducing | MTT/MTS assay | HBL | Skin cancer | 2.4% inhibition at 10-4 M |
| dbacp00203 | Enkephalins7 analogue-17 | YA*GFM | Synthetic Peptide | Apoptosis inducing | MTT/MTS assay | HBL | Skin cancer | 18.3% inhibition at 10-3 M |
| dbacp00204 | Enkephalins7 analogue-17 | YA*GFM | Synthetic Peptide | Apoptosis inducing | MTT/MTS assay | HT-29 | Colon cancer | 3.3% inhibition at 10-6 M |
| dbacp00205 | Enkephalins7 analogue-17 | YA*GFM | Synthetic Peptide | Apoptosis inducing | MTT/MTS assay | HT-29 | Colon cancer | 11.0% inhibition at 10-5M |
| dbacp00206 | Enkephalins7 analogue-17 | YA*GFM | Synthetic Peptide | Apoptosis inducing | MTT/MTS assay | HT-29 | Colon cancer | 7.9% inhibition at 10-4 M |
| dbacp00207 | Enkephalins7 analogue-17 | YA*GFM | Synthetic Peptide | Apoptosis inducing | MTT/MTS assay | HT-29 | Colon cancer | 23.7% inhibition at 10-3 M |
| dbacp00208 | Enkephalins7 analogue-17 | YA*GFM | Synthetic Peptide | Apoptosis inducing | MTT/MTS assay | SW-620 | Colon cancer | 12.2% inhibition at 10-6 M |
| dbacp00209 | Enkephalins7 analogue-17 | YA*GFM | Synthetic Peptide | Apoptosis inducing | MTT/MTS assay | SW-620 | Colon cancer | 15.5% inhibition at 10-5 M |
| dbacp00210 | Enkephalins7 analogue-17 | YA*GFM | Synthetic Peptide | Apoptosis inducing | MTT/MTS assay | SW-620 | Colon cancer | 24.7% inhibition at 10-4 M |
| dbacp00211 | Enkephalins7 analogue-17 | YA*GFM | Synthetic Peptide | Apoptosis inducing | MTT/MTS assay | SW-620 | Colon cancer | 29.0% inhibition at 10-3 M |
| dbacp00212 | Enkephalins7 analogue-17 | YA*GFM | Synthetic Peptide | Apoptosis inducing | MTT/MTS assay | CaCo-2 | Colon cancer | 3.0% inhibition at 10-6 M |
| dbacp00213 | Enkephalins7 analogue-17 | YA*GFM | Synthetic Peptide | Apoptosis inducing | MTT/MTS assay | CaCo-2 | Colon cancer | 8.4% inhibition at 10-5 M |
| dbacp00214 | Enkephalins7 analogue-17 | YA*GFM | Synthetic Peptide | Apoptosis inducing | MTT/MTS assay | CaCo-2 | Colon cancer | 18.5% inhibition at 10-4 M |
| dbacp00215 | Enkephalins7 analogue-17 | YA*GFM | Synthetic Peptide | Apoptosis inducing | MTT/MTS assay | CaCo-2 | Colon cancer | 10.6% inhibition at 10-3 M |
| dbacp00216 | Enkephalins7 analogue-17 | YA*GFM | Synthetic Peptide | Apoptosis inducing | MTT/MTS assay | MCF-7 | Breast cancer | 22.8% inhibition at 10-3 M |
| dbacp00226 | Enkephalins7 analogue-18 | YA*GFM | Synthetic Peptide | Apoptosis inducing | MTT/MTS assay | HEp-2 | Larynx cancer | 13.7% inhibition at 10-6 M |
| dbacp00227 | Enkephalins7 analogue-18 | YA*GFM | Synthetic Peptide | Apoptosis inducing | MTT/MTS assay | HEp-2 | Larynx cancer | 25.8% inhibition at 10-5 M |
| dbacp00228 | Enkephalins7 analogue-18 | YA*GFM | Synthetic Peptide | Apoptosis inducing | MTT/MTS assay | HEp-2 | Larynx cancer | 34.7% inhibition at 10-4 M |
| dbacp00229 | Enkephalins7 analogue-18 | YA*GFM | Synthetic Peptide | Apoptosis inducing | MTT/MTS assay | HEp-2 | Larynx cancer | 44.5% inhibition at 10-3 M |
| dbacp00230 | Enkephalins7 analogue-18 | YA*GFM | Synthetic Peptide | Apoptosis inducing | MTT/MTS assay | HeLa | Cervical cancer | 8.5% inhibition at 10-6 M |
| dbacp00231 | Enkephalins7 analogue-18 | YA*GFM | Synthetic Peptide | Apoptosis inducing | MTT/MTS assay | HeLa | Cervical cancer | 9.5% inhibition at 10-5 M |
| dbacp00232 | Enkephalins7 analogue-18 | YA*GFM | Synthetic Peptide | Apoptosis inducing | MTT/MTS assay | HeLa | Cervical cancer | 15.4% inhibition at 10-4 M |
| dbacp00233 | Enkephalins7 analogue-18 | YA*GFM | Synthetic Peptide | Apoptosis inducing | MTT/MTS assay | HeLa | Cervical cancer | 24.1% inhibition at 10-3 M |
| dbacp00234 | Enkephalins7 analogue-18 | YA*GFM | Synthetic Peptide | Apoptosis inducing | MTT/MTS assay | HBL | Skin cancer | 2.4% inhibition at 10-6 M |
| dbacp00235 | Enkephalins7 analogue-18 | YA*GFM | Synthetic Peptide | Apoptosis inducing | MTT/MTS assay | HBL | Skin cancer | 4.5% inhibition at 10-5 M |
| dbacp00236 | Enkephalins7 analogue-18 | YA*GFM | Synthetic Peptide | Apoptosis inducing | MTT/MTS assay | HBL | Skin cancer | 11.4% inhibition at 10-4 M |
| dbacp00237 | Enkephalins7 analogue-18 | YA*GFM | Synthetic Peptide | Apoptosis inducing | MTT/MTS assay | HBL | Skin cancer | 23.2% inhibition at 10-3 M |
| dbacp00238 | Enkephalins7 analogue-18 | YA*GFM | Synthetic Peptide | Apoptosis inducing | MTT/MTS assay | HT-29 | Colon cancer | 16.2% inhibition at 10-6 M |
| dbacp00239 | Enkephalins7 analogue-18 | YA*GFM | Synthetic Peptide | Apoptosis inducing | MTT/MTS assay | HT-29 | Colon cancer | 6.6% inhibition at 10-5 M |
| dbacp00240 | Enkephalins7 analogue-18 | YA*GFM | Synthetic Peptide | Apoptosis inducing | MTT/MTS assay | HT-29 | Colon cancer | 5.1% inhibition at 10-4 M |
| dbacp00241 | Enkephalins7 analogue-18 | YA*GFM | Synthetic Peptide | Apoptosis inducing | MTT/MTS assay | HT-29 | Colon cancer | 14.5% inhibition at 10-3 M |
| dbacp00242 | Enkephalins7 analogue-18 | YA*GFM | Synthetic Peptide | Apoptosis inducing | MTT/MTS assay | SW-620 | Colon cancer | 26.4% inhibition at 10-6 M |
| dbacp00243 | Enkephalins7 analogue-18 | YA*GFM | Synthetic Peptide | Apoptosis inducing | MTT/MTS assay | SW-620 | Colon cancer | 13.1% inhibition at 10-5 M |
| dbacp00244 | Enkephalins7 analogue-18 | YA*GFM | Synthetic Peptide | Apoptosis inducing | MTT/MTS assay | SW-620 | Colon cancer | 14.6% inhibition at 10-4 M |
| dbacp00245 | Enkephalins7 analogue-18 | YA*GFM | Synthetic Peptide | Apoptosis inducing | MTT/MTS assay | SW-620 | Colon cancer | 38.4% inhibition at 10-3 M |
| dbacp00246 | Enkephalins7 analogue-18 | YA*GFM | Synthetic Peptide | Apoptosis inducing | MTT/MTS assay | CaCo-2 | Colon cancer | 17.7% inhibition at 10-6 M |
| dbacp00247 | Enkephalins7 analogue-18 | YA*GFM | Synthetic Peptide | Apoptosis inducing | MTT/MTS assay | CaCo-2 | Colon cancer | 10.9% inhibition at 10-5 M |
| dbacp00248 | Enkephalins7 analogue-18 | YA*GFM | Synthetic Peptide | Apoptosis inducing | MTT/MTS assay | CaCo-2 | Colon cancer | 12.1% inhibition at 10-4 M |
| dbacp00249 | Enkephalins7 analogue-18 | YA*GFM | Synthetic Peptide | Apoptosis inducing | MTT/MTS assay | CaCo-2 | Colon cancer | 8.1% inhibition at 10-3 M |
| dbacp00250 | Enkephalins7 analogue-18 | YA*GFM | Synthetic Peptide | Apoptosis inducing | MTT/MTS assay | MCF-7 | Breast cancer | 9.6% inhibition at 10-4 M |
| dbacp00251 | Enkephalins7 analogue-18 | YA*GFM | Synthetic Peptide | Apoptosis inducing | MTT/MTS assay | MCF-7 | Breast cancer | 29.9% inhibition at 10-3 M |
| dbacp00279 | Enkephalins7 analogue-23 | YGGFMA* | Synthetic Peptide | Apoptosis inducing | MTT/MTS assay | HEp-2 | Larynx cancer | 3.9% inhibition at 10-5 M |
| dbacp00280 | Enkephalins7 analogue-23 | YGGFMA* | Synthetic Peptide | Apoptosis inducing | MTT/MTS assay | HEp-2 | Larynx cancer | 45% inhibition at 10-3 M |
| dbacp00281 | Enkephalins7 analogue-23 | YGGFMA* | Synthetic Peptide | Apoptosis inducing | MTT/MTS assay | HeLa | Cervical cancer | 9.3% inhibition at 10-3 M |
| dbacp00282 | Enkephalins7 analogue-23 | YGGFMA* | Synthetic Peptide | Apoptosis inducing | MTT/MTS assay | HBL | Skin cancer | 4.1% inhibition at 10-6 M |
| dbacp00283 | Enkephalins7 analogue-23 | YGGFMA* | Synthetic Peptide | Apoptosis inducing | MTT/MTS assay | HBL | Skin cancer | 70.7% inhibition at 10-5 M |
| dbacp00284 | Enkephalins7 analogue-23 | YGGFMA* | Synthetic Peptide | Apoptosis inducing | MTT/MTS assay | HBL | Skin cancer | 34.4% inhibition at 10-3 M |
| dbacp00285 | Enkephalins7 analogue-23 | YGGFMA* | Synthetic Peptide | Apoptosis inducing | MTT/MTS assay | HT-29 | Colon cancer | 9.2% inhibition at 10-3 M |
| dbacp00286 | Enkephalins7 analogue-23 | YGGFMA* | Synthetic Peptide | Apoptosis inducing | MTT/MTS assay | CaCo-2 | Colon cancer | 11.08% inhibition at 10-5 M |
| dbacp00287 | Enkephalins7 analogue-23 | YGGFMA* | Synthetic Peptide | Apoptosis inducing | MTT/MTS assay | CaCo-2 | Colon cancer | 47.0% inhibition at 10-3 M |
| dbacp00288 | Enkephalins7 analogue-23 | YGGFMA* | Synthetic Peptide | Apoptosis inducing | MTT/MTS assay | MCF-7 | Breast cancer | 2.2% inhibition at 10-6 M |
| dbacp00289 | Enkephalins7 analogue-23 | YGGFMA* | Synthetic Peptide | Apoptosis inducing | MTT/MTS assay | MCF-7 | Breast cancer | 7.1% inhibition at 10-5 M |
| dbacp00290 | Enkephalins7 analogue-23 | YGGFMA* | Synthetic Peptide | Apoptosis inducing | MTT/MTS assay | MCF-7 | Breast cancer | 6.9% inhibition at 10-4 M |
| dbacp00291 | Enkephalins7 analogue-23 | YGGFMA* | Synthetic Peptide | Apoptosis inducing | MTT/MTS assay | MCF-7 | Breast cancer | 25.9% inhibition at 10-3 M |
| dbacp00301 | (cpm)-1285 | KNLWAAQRYGRELRRMSDEFEGSFKGL | BH3-only, Sensizers (BAD, HRK, Noxa) | Apoptosis inducing | Not specified | HL-60 | Various cancers | Not found |
| dbacp00302 | (cpm)-1285 | KNLWAAQRYGRELRRMSDEFEGSFKGL | BH3-only, Sensizers (BAD, HRK, Noxa) | Apoptosis inducing | Not specified | PBL | Various cancers | Not found |
| dbacp00303 | Temporin-SHf | FFFLSRIF* | Sahara frog | Apoptosis inducing | MTT assay | A549 | Not specified | IC50 : 24.03 ± 0.945 µM |
| dbacp00304 | Temporin-SHf | FFFLSRIF* | Sahara frog | Apoptosis inducing | MTT assay | MCF-7 | Not specified | IC50 : 32.76 ± 1.528 µM |
| dbacp00305 | Temporin-SHf | FFFLSRIF* | Sahara frog | Apoptosis inducing | MTT assay | HepG2 | Not specified | IC50 : 32.64 ± 1.350 µM |
| dbacp00306 | Temporin-SHf | FFFLSRIF* | Sahara frog | Apoptosis inducing | MTT assay | PC3 | Not specified | IC50 : 36.67 ± 0.729 µM |
| dbacp00308 | (ATAP) Amphipathic tail-anchoring peptide of Bfl-1 | KFEPKSGWMTFLEVTGKICEMLSLLKQYC | Anti apoptotic (MCL-1, BFL1) | Apoptosis inducing | Not specified | HeLa | Not found | Not found |
| dbacp00309 | (Bl- LAAO) L-amino acid oxidases (L-AAO) | ADDRNPLEECFRETDYEEFLEIAKNGLSTT | Venom base | Apoptosis inducing | MTT assay | MKN-45 | Stomach cancer | Not found |
| dbacp00310 | (Bl- LAAO) L-amino acid oxidases (L-AAO) | ADDRNPLEECFRETDYEEFLEIAKNGLSTT | Venom base | Apoptosis inducing | MTT assay | HUTU | Adenocarcinoma | Not found |
| dbacp00311 | (Bl- LAAO) L-amino acid oxidases (L-AAO) | ADDRNPLEECFRETDYEEFLEIAKNGLSTT | Venom base | Apoptosis inducing | MTT assay | RKO | Colorectal cancer | Not found |
| dbacp00318 | (RGD-4C)-GG-D(KLAKLAK)2 | ACDCRGDCFCGGKLAKLAKKLAKLAK | Synthetic Peptide | Apoptosis inducing | Internalization assay,Mitochondrial swelling assay,Cell-free apoptosis assay,Caspase activation assay | KS1767 | Not specified | LC50 : 10 μM |
| dbacp00725 | 6,7-dimethyl-8-ribityllumazine synthase 2 | MNQSCPNKTSFKIAFIQARWHADIVDEARKSFVAELAAKTGGSVEVEIFDVPGAYEIPLHAKTLARTGRYAAIVGAAFVIDGGIYRHDFVATAVINGMMQVQLETEVPVLSVVLTPHHFHESKEHHDFFHAHFKVKGVEAAHAALQIVSERSRIAALV | Not found | Apoptosis inducing | Apoptosis assay | B16 | Melanoma | Not found |
| dbacp00771 | A12 | RPEIWMGQGLRRLGDEINAYYAR | BH3-only, Direct activators, BIM analogues | Apoptosis inducing | Not specified | Mcl-1/Myc 2640 | Not found | Not found |
| dbacp00772 | A12 | RPEIWMGQGLRRLGDEINAYYAR | BH3-only, Direct activators, BIM analogues | Apoptosis inducing | Not specified | Bcl-2/Myc 2924 | Not found | Not found |
| dbacp00813 | A5 | KAQIRAMECNIL | Cyclin B (285-296) | Apoptosis inducing | MTT/MTS assay | HCT-116 | Colon cancer | Not found |
| dbacp00814 | AAD (or Aa-Pri1) | MDSNKDERAYAQWVIIILHNVGSSPFKIANLGLSWGKLYADGNKDKEVYPSDYNGKTVGPDEKIQINSCGRENASSGTEGSFDIVDPNDGNKTIRHFYWECPWGSKRNTWTPSGSNTKWMVEWSGQNLDSGALGTITVDVLRKGN | Purified from chestnut mushroom | Apoptosis inducing | MTT/MTS assay | HepG-2 | Liver cancer | At 2.5 µM concentration,decrease in cell vibility: 35% |
| dbacp00815 | AAD (or Aa-Pri1) | MDSNKDERAYAQWVIIILHNVGSSPFKIANLGLSWGKLYADGNKDKEVYPSDYNGKTVGPDEKIQINSCGRENASSGTEGSFDIVDPNDGNKTIRHFYWECPWGSKRNTWTPSGSNTKWMVEWSGQNLDSGALGTITVDVLRKGN | Purified from chestnut mushroom | Apoptosis inducing | MTT/MTS assay | HeLa | Cervical cancer | At 2.5 µM concentration,decrease in cell vibility: 70% |
| dbacp00816 | AAD (or Aa-Pri1) | MDSNKDERAYAQWVIIILHNVGSSPFKIANLGLSWGKLYADGNKDKEVYPSDYNGKTVGPDEKIQINSCGRENASSGTEGSFDIVDPNDGNKTIRHFYWECPWGSKRNTWTPSGSNTKWMVEWSGQNLDSGALGTITVDVLRKGN | Purified from chestnut mushroom | Apoptosis inducing | MTT/MTS assay | SH-SY5Y | Brain tumor | At 2.5 µM concentration,decrease in cell vibility: 70% |
| dbacp00833 | AAP-H | YVPGP | Marine invertebrates | Apoptosis inducing | MTT assay | DU-145 | Prostate cancer | IC50 : 9.605 mM |
| dbacp00834 | AAP-H | YVPGP | Marine invertebrates | Apoptosis inducing | MTT assay | DU-146 | Prostate cancer | IC50 : 7.910 mM |
| dbacp00835 | AAP-H | YVPGP | Marine invertebrates | Apoptosis inducing | MTT assay | DU-147 | Prostate cancer | IC50 : 2.298 mM |
| dbacp00951 | ABP-dHC-Cecropin A | RWKIFKKIERVGQNVRDGIIKAGPAIQVLGTAKALGK | Synthetic construct | Apoptosis inducing | MTT assay | K562 cells | Leukemia | IC50 : 349.5 μM |
| dbacp00952 | ABP-dHC-Cecropin A | RWKIFKKIERVGQNVRDGIIKAGPAIQVLGTAKALGK | Synthetic construct | Apoptosis inducing | MTT assay | U937 cells | Leukemia | IC50 : 303.2 μM |
| dbacp00953 | ABP-dHC-Cecropin A | RWKIFKKIERVGQNVRDGIIKAGPAIQVLGTAKALGK | Synthetic construct | Apoptosis inducing | MTT assay | THP-1 cells | Leukemia | IC50 : 228.5 μM |
| dbacp00954 | ABP-dHC-Cecropin A-K | RWKIFKKIERVGQNVRDGIIKAGKAIQVLGTAKALGK | Synthetic construct | Apoptosis inducing | MTT assay | K562 cells | Leukemia | IC50 : 349.5 μM |
| dbacp00955 | ABP-dHC-Cecropin A-K | RWKIFKKIERVGQNVRDGIIKAGKAIQVLGTAKALGK | Synthetic construct | Apoptosis inducing | MTT assay | U937 cells | Leukemia | IC50 : 303.2 μM |
| dbacp00956 | ABP-dHC-Cecropin A-K | RWKIFKKIERVGQNVRDGIIKAGKAIQVLGTAKALGK | Synthetic construct | Apoptosis inducing | MTT assay | THP-1 cells | Leukemia | IC50 : 228.5 μM |
| dbacp00962 | ACL LAO L-amino acid oxidase(LAO) | ADSRNPLEEEFRETNYEEF | Venom base | Apoptosis inducing | HL-60 cell culture assay | HL-60 | Not specified | Not found |
| dbacp01144 | Ansalvamide A | NA | Marine fungus, Wilt of banana | Apoptosis inducing | Not specified | COLO 205 | Colorectal cancer | IC50 : 3.5 µg/mL |
| dbacp01145 | Ansalvamide A | NA | Marine fungus, Wilt of banana | Apoptosis inducing | Not specified | SKMEL-2 | Melanoma cells | IC50 : 5.9 µg/mL |
| dbacp01146 | Ansalvamide A | NA | Marine fungus, Wilt of banana | Apoptosis inducing | Not specified | HCT-116 | Colon cancer | IC50 : 9.8 µg/mL |
| dbacp01147 | Ant-Bad | RQIKIWFQNRRMKWKKNLWAAQRYGRELRRMSDEFVD | BH3-only, Sensizers (BAD, HRK, Noxa) | Apoptosis inducing | Not specified | 1483 | Head and neck squamous cell carcinomas (HNSCC) | IC50 : 24.8 µM |
| dbacp01148 | Ant-Bad | RQIKIWFQNRRMKWKKNLWAAQRYGRELRRMSDEFVD | BH3-only, Sensizers (BAD, HRK, Noxa) | Apoptosis inducing | Not specified | UM-22A | Head and neck squamous cell carcinomas (HNSCC) | IC50 : 18.3 µM |
| dbacp01149 | Ant-Bad | RQIKIWFQNRRMKWKKNLWAAQRYGRELRRMSDEFVD | BH3-only, Sensizers (BAD, HRK, Noxa) | Apoptosis inducing | Not specified | UM-22B | Head and neck squamous cell carcinomas (HNSCC) | IC50 : 40.2 µM |
| dbacp01150 | Ant-Bak | RQIKIWFQNRRMKWKKMGQVGRQLAIIGDDINRRY | Effectors (BAK, BAX) | Apoptosis inducing | Not specified | 1483 | Head and neck squamous cell carcinomas (HNSCC) | IC50 : 32.9 µM |
| dbacp01151 | Ant-Bak | RQIKIWFQNRRMKWKKMGQVGRQLAIIGDDINRRY | Effectors (BAK, BAX) | Apoptosis inducing | Not specified | UM-22A | Head and neck squamous cell carcinomas (HNSCC) | IC50 : 82 µM |
| dbacp01152 | Ant-Bak | RQIKIWFQNRRMKWKKMGQVGRQLAIIGDDINRRY | Effectors (BAK, BAX) | Apoptosis inducing | Not specified | UM-22B | Head and neck squamous cell carcinomas (HNSCC) | IC50 : > 100 µM |
| dbacp01153 | Ant-Bax | RQIKIWFQNRRMKWKKSTKKLSECLKRIGDELDSnM | Effectors (BAK, BAX) | Apoptosis inducing | Not specified | 1483 | Head and neck squamous cell carcinomas (HNSCC) | IC50 : 18.2 µM |
| dbacp01154 | Ant-Bax | RQIKIWFQNRRMKWKKSTKKLSECLKRIGDELDSnM | Effectors (BAK, BAX) | Apoptosis inducing | Not specified | UM-22A | Head and neck squamous cell carcinomas (HNSCC) | IC50 : 45.5 µM |
| dbacp01155 | Ant-Bax | RQIKIWFQNRRMKWKKSTKKLSECLKRIGDELDSnM | Effectors (BAK, BAX) | Apoptosis inducing | Not specified | UM-22B | Head and neck squamous cell carcinomas (HNSCC) | IC50 : > 100 µM |
| dbacp01156 | Ant-p53pep | GSRAHSSHLKSKKGQSTSRHKKWKMRRNQFWVKVQRG | Not found | Apoptosis inducing | Annexin V-FITC Binding assay | MDA-MB-468 | Breast cancer | IC50 : 30 µM |
| dbacp01157 | Anthopleura anjunae anti-tumor peptide | YVPGP | Sea anemone anti-tumor peptide | Apoptosis inducing | MTT Cell Proliferation and Cytotoxicity assay | DU-145 | Prostate cancer | IC50 : 9.605 μM |
| dbacp01158 | Anticancer bioactive peptide | NA | Goat spleen | Apoptosis inducing | Cell proliferation assay | HCT116 | Human Colorectal cancer | IC50 : 35 μg/mL |
| dbacp01172 | Antp-LP4 | RQIKIWFQNRRMKWKKSWTWEKKLETAVNLAWTAGNSNKWTWK | VDAC1(voltage-dependent anion channel1) | Apoptosis inducing | Not specified | CLL | Leukemia | IC50 : 0.7 ± 0.1 µM |
| dbacp01173 | Antp-LP4 | RQIKIWFQNRRMKWKKSWTWEKKLETAVNLAWTAGNSNKWTWK | VDAC1(voltage-dependent anion channel1) | Apoptosis inducing | Not specified | MEC-1 | Leukemia | IC50 : 2.5 ± 0.1 µM |
| dbacp01441 | BAA-2 | NA | Bovine lactoferrin (Lf-B) | Apoptosis inducing | MTT/MTS assay | Ramos | Lymphoma cancer | IC50 : 3.8 µg/ml |
| dbacp01442 | Baceridin | cyclo(L-Trp-D-Ala-D-allo-Ile-L-Val-D-Leu-L-Leu-) | Synthetic construct | Apoptosis inducing | MTT assay | HCT116 | Not specified | Not found |
| dbacp01443 | Baceridin | cyclo(L-Trp-D-Ala-D-allo-Ile-L-Val-D-Leu-L-Leu-) | Synthetic construct | Apoptosis inducing | MTT assay | RKO | Not specified | Not found |
| dbacp01444 | Baceridin | cyclo(L-Trp-D-Ala-D-allo-Ile-L-Val-D-Leu-L-Leu-) | Synthetic construct | Apoptosis inducing | MTT assay | HeLa | Not specified | Not found |
| dbacp01445 | Baceridin | WAIVLL | Plant-associated rod-shaped, Gram-positive bacteria | Apoptosis inducing | MTT assay | HCT116 | Not specified | Not found |
| dbacp01446 | Baceridin | WAIVLL | Plant-associated rod-shaped, Gram-positive bacteria | Apoptosis inducing | MTT assay | RKO | Not specified | Not found |
| dbacp01447 | Baceridin | WAIVLL | Plant-associated rod-shaped, Gram-positive bacteria | Apoptosis inducing | MTT assay | HeLa | Not specified | Not found |
| dbacp01448 | Bad | LWAAQRYGRELRRMSDEFEGSFKGL | BH3-only, Sensizers (BAD, HRK, Noxa) | Apoptosis inducing | Not specified | Not found | Not specified | Not found |
| dbacp01449 | Bad | LWAAQRYGRELRRMSDEFVDSFKK | BH3-only, Sensizers (BAD, HRK, Noxa) | Apoptosis inducing | Not specified | Not found | Not found | Not found |
| dbacp01450 | Bad a | NLWAARYGRELRRMSDKFVD | BH3-only, Sensizers (BAD, HRK, Noxa) | Apoptosis inducing | Not specified | Not found | Not found | Not found |
| dbacp02304 | Cartilage protein hydrolysate peptide | FIMGPY | Skate | Cell proliferation inhibition; Apoptosis inducing | MTT assay | HeLa | Cervical cancer | IC50 : 4.81 mg/mL |
| dbacp02305 | Caseinphosphopeptides | PPPEE | Bovine milk | Regulation of immune response; Apoptosis inducing | MTT/MTS assay | AZ-97 | Colon cancer | Inhibition at 24-28g/l |
| dbacp02378 | Cercopin D | GNFFKDLEKMGQRVRDAVISAAPAVDTLAKAKALGQ | Domestic silk moth | Apoptosis inducing | Not specified | Not found | Not found | Not found |
| dbacp02379 | Ceropin | MNFNKLFVFVALVLAVCIGQSEAGWLKKIGKKIERVGQHTRDATIQTIGVAQQAANVAATLKG | House fly | Apoptosis inducing | Trypan blue assay | BEL-7402 | Liver cancer | 91.8% cell viability at 12.5 µM |
| dbacp02380 | Ceropin | MNFNKLFVFVALVLAVCIGQSEAGWLKKIGKKIERVGQHTRDATIQTIGVAQQAANVAATLKG | House fly | Apoptosis inducing | Trypan blue assay | BEL-7402 | Liver cancer | 84.1% cell viability at 25 µM |
| dbacp02381 | Ceropin | MNFNKLFVFVALVLAVCIGQSEAGWLKKIGKKIERVGQHTRDATIQTIGVAQQAANVAATLKG | House fly | Apoptosis inducing | Trypan blue assay | BEL-7402 | Liver cancer | 76.3% cell viability at 50 µM |
| dbacp02382 | Ceropin | MNFNKLFVFVALVLAVCIGQSEAGWLKKIGKKIERVGQHTRDATIQTIGVAQQAANVAATLKG | House fly | Apoptosis inducing | Trypan blue assay | BEL-7402 | Liver cancer | 71.5 % cell viability at 75 µM |
| dbacp02383 | Ceropin | MNFNKLFVFVALVLAVCIGQSEAGWLKKIGKKIERVGQHTRDATIQTIGVAQQAANVAATLKG | House fly | Apoptosis inducing | Trypan blue assay | BEL-7402 | Liver cancer | 54.2 % cell viability at 100 µM |
| dbacp02384 | Ceropin | MNFNKLFVFVALVLAVCIGQSEAGWLKKIGKKIERVGQHTRDATIQTIGVAQQAANVAATLKG | House fly | Apoptosis inducing | Trypan blue assay | BEL-7402 | Liver cancer | 87.3 % cell viability at 25 µM |
| dbacp02385 | Ceropin | MNFNKLFVFVALVLAVCIGQSEAGWLKKIGKKIERVGQHTRDATIQTIGVAQQAANVAATLKG | House fly | Apoptosis inducing | Trypan blue assay | BEL-7402 | Liver cancer | 75.6 % cell viability at 50 µM |
| dbacp02386 | Ceropin | MNFNKLFVFVALVLAVCIGQSEAGWLKKIGKKIERVGQHTRDATIQTIGVAQQAANVAATLKG | House fly | Apoptosis inducing | Trypan blue assay | BEL-7402 | Liver cancer | 62.8 % cell viability at 75 µM |
| dbacp02387 | Ceropin | MNFNKLFVFVALVLAVCIGQSEAGWLKKIGKKIERVGQHTRDATIQTIGVAQQAANVAATLKG | House fly | Apoptosis inducing | Trypan blue assay | BEL-7402 | Liver cancer | 54.3 % cell viability at 100 µM |
| dbacp02388 | Ceropin | MNFNKLFVFVALVLAVCIGQSEAGWLKKIGKKIERVGQHTRDATIQTIGVAQQAANVAATLKG | House fly | Apoptosis inducing | Trypan blue assay | BEL-7402 | Liver cancer | 48.6 % cell viability at 100 µM |
| dbacp02389 | Ceropin | MNFNKLFVFVALVLAVCIGQSEAGWLKKIGKKIERVGQHTRDATIQTIGVAQQAANVAATLKG | House fly | Apoptosis inducing | Trypan blue assay | BEL-7402 | Liver cancer | 72.1 % cell viability at 12.5 µM |
| dbacp02390 | Ceropin | MNFNKLFVFVALVLAVCIGQSEAGWLKKIGKKIERVGQHTRDATIQTIGVAQQAANVAATLKG | House fly | Apoptosis inducing | Trypan blue assay | BEL-7402 | Liver cancer | 63.3 % cell viability at 25 µM |
| dbacp02391 | Ceropin | MNFNKLFVFVALVLAVCIGQSEAGWLKKIGKKIERVGQHTRDATIQTIGVAQQAANVAATLKG | House fly | Apoptosis inducing | Trypan blue assay | BEL-7402 | Liver cancer | 49.7 % cell viability at 50 µM |
| dbacp02392 | Ceropin | MNFNKLFVFVALVLAVCIGQSEAGWLKKIGKKIERVGQHTRDATIQTIGVAQQAANVAATLKG | House fly | Apoptosis inducing | Trypan blue assay | BEL-7402 | Liver cancer | 41.1 % cell viability at 75 µM |
| dbacp02393 | Ceropin | MNFNKLFVFVALVLAVCIGQSEAGWLKKIGKKIERVGQHTRDATIQTIGVAQQAANVAATLKG | House fly | Apoptosis inducing | Trypan blue assay | BEL-7402 | Liver cancer | 35.2 % cell viability at 100 µM |
| dbacp02458 | Chartergellus-CP1 peptide | IIGTILGLLKSLNH2 | Social wasp | Apoptosis inducing | MTT assay | A375 | Human melanoma | IC50 : 40.5 µg/mL |
| dbacp02459 | Chartergellus-CP1 peptide | IIGTILGLLKSLNH2 | Social wasp | Apoptosis inducing; Intracellular ROS formation | MTT assay | MNT-1 | Human melanoma | IC50 : 51.6 µg/mL |
| dbacp02561 | Cr-ACP1 | AWKLFDDGV | Seeds, sago palm | Apoptosis inducing | Not specified | Not found | Not found | Not found |
| dbacp02631 | DC1 | GAFLKCGESCVYLPCLTTVVGCSCQNSVCYRD | Snake-needle grass | Apoptosis inducing | Colorimetric Cell viability assay,Migration assay ,Wound healing assay and Human prostate cancer xenograft assay | DC3 | Prostate cancer | Not found |
| dbacp02632 | DC1 | GAFLKCGESCVYLPCLTTVVGCSCQNSVCYRD | Snake-needle grass | Apoptosis inducing | Colorimetric Cell viability assay,Migration assay ,Wound healing assay and Human prostate cancer xenograft assay | LNCap | Prostate cancer | Not found |
| dbacp02633 | DC2 | GAVPCGETCVYLPCITPDIGCSCQNKVCYRD | Snake-needle grass | Apoptosis inducing | Colorimetric Cell viability assay,Migration assay ,Wound healing assay and Human prostate cancer xenograft assay | DC3 | Prostate cancer | Not found |
| dbacp02634 | DC2 | GAVPCGETCVYLPCITPDIGCSCQNKVCYRD | Snake-needle grass | Apoptosis inducing | Colorimetric Cell viability assay,Migration assay ,Wound healing assay and Human prostate cancer xenograft assay | LNCap | Prostate cancer | Not found |
| dbacp02635 | DC3 | GTSCGETCVLLPCLSSVLGCTCQNKRCYKD | Snake-needle grass | Apoptosis inducing | Colorimetric Cell viability assay,Migration assay ,Wound healing assay and Human prostate cancer xenograft assay | DC3 | Prostate cancer | Not found |
| dbacp02636 | DC3 | GTSCGETCVLLPCLSSVLGCTCQNKRCYKD | Snake-needle grass | Apoptosis inducing | Colorimetric Cell viability assay,Migration assay ,Wound healing assay and Human prostate cancer xenograft assay | LNCap | Prostate cancer | Not found |
| dbacp02660 | Dermaseptin-B3 | ALWKnMLKGIGKLAGQAALGAVKTLVGA | South American frog, Giant leaf frog | Apoptosis inducing | Thymidine Incorporation assay | MCF-7 | Breast cancer | Not found |
| dbacp02661 | Dermaseptin-B4 | ALWKDILKNVGKAAGKAVLNTVTDMVNQ | Giant leaf frog | Apoptosis inducing | Thymidine Incorporation assay | MCF-7 | Breast cancer | Not found |
| dbacp02801 | Dolastatin 10 | 2-[[2-(dimethylamino)-3-methylbutanoyl]amino]-N-[3-methoxy-1-[2-[1-methoxy-2-methyl-3-oxo-3-[[2-phenyl-1-(1,3-thiazol-2-yl)ethyl]amino]propyl]pyrrolidin-1-yl]-5-methyl-1-oxoheptan-4-yl]-N,3-dimethylbutaNAmide | Wedge sea hare | Apoptosis inducing | TUNEL assay | DU-145 | Prostate cancer | IC50 : 0.5 nM |
| dbacp02802 | Dolastatin 10 | 2-[[2-(dimethylamino)-3-methylbutanoyl]amino]-N-[3-methoxy-1-[2-[1-methoxy-2-methyl-3-oxo-3-[[2-phenyl-1-(1,3-thiazol-2-yl)ethyl]amino]propyl]pyrrolidin-1-yl]-5-methyl-1-oxoheptan-4-yl]-N,3-dimethylbutaNAmide | Wedge sea hare | Apoptosis inducing | Cell viability assay | DB | Lymphoma cancer | IC50 : 0.0013 - 0.013 nM |
| dbacp02803 | Dolastatin 10 | 2-[[2-(dimethylamino)-3-methylbutanoyl]amino]-N-[3-methoxy-1-[2-[1-methoxy-2-methyl-3-oxo-3-[[2-phenyl-1-(1,3-thiazol-2-yl)ethyl]amino]propyl]pyrrolidin-1-yl]-5-methyl-1-oxoheptan-4-yl]-N,3-dimethylbutaNAmide | Wedge sea hare | Apoptosis inducing | Cell viability assay | HT | Lymphoma cancer | IC50 : 0.0013 - 0.013 nM |
| dbacp02804 | Dolastatin 10 | 2-[[2-(dimethylamino)-3-methylbutanoyl]amino]-N-[3-methoxy-1-[2-[1-methoxy-2-methyl-3-oxo-3-[[2-phenyl-1-(1,3-thiazol-2-yl)ethyl]amino]propyl]pyrrolidin-1-yl]-5-methyl-1-oxoheptan-4-yl]-N,3-dimethylbutaNAmide | Wedge sea hare | Apoptosis inducing | Cell viability assay | RL | Lymphoma cancer | IC50 : 0.0013 - 0.013 nM |
| dbacp02805 | Dolastatin 10 | 2-[[2-(dimethylamino)-3-methylbutanoyl]amino]-N-[3-methoxy-1-[2-[1-methoxy-2-methyl-3-oxo-3-[[2-phenyl-1-(1,3-thiazol-2-yl)ethyl]amino]propyl]pyrrolidin-1-yl]-5-methyl-1-oxoheptan-4-yl]-N,3-dimethylbutaNAmide | Wedge sea hare | Apoptosis inducing | Cell viability assay | SR | Leukemia cancer | IC50 : 0.0013 - 0.013 nM |
| dbacp02806 | Dolastatin 15 | VV-nMe-VPP-2hydroxyisovaleryl-2-oxo-4-methoxy-5-benzyl-3-pyrroline | Wedge sea hare | Apoptosis inducing | Cell viability assay | DB | Lymphoma cancer | IC50 : 0.0013 - 0.013 nM |
| dbacp02807 | Dolastatin 15 | VV-nMe-VPP-2hydroxyisovaleryl-2-oxo-4-methoxy-5-benzyl-3-pyrroline | Wedge sea hare | Apoptosis inducing | Cell viability assay | HT | Lymphoma cancer | IC50 : 0.0013 - 0.013 nM |
| dbacp02808 | Dolastatin 15 | VV-nMe-VPP-2hydroxyisovaleryl-2-oxo-4-methoxy-5-benzyl-3-pyrroline | Wedge sea hare | Apoptosis inducing | Cell viability assay | RL | Lymphoma cancer | IC50 : 0.0013 - 0.013 nM |
| dbacp02809 | Dolastatin 15 | VV-nMe-VPP-2hydroxyisovaleryl-2-oxo-4-methoxy-5-benzyl-3-pyrroline | Wedge sea hare | Apoptosis inducing | Cell viability assay | SR | Leukemia cancer | IC50 : 0.0013 - 0.013 nM |
| dbacp02815 | DRS B3 | ALWKnMLKGIGKLAGQAALGAVKTLVGA | Dermaseptins B | Apoptosis inducing | Thymidine incorporation assay | MCF-7 | Breast cancer | Cytotoxicity :12 µM |
| dbacp02816 | DRS B4 | ALWKDILKNVGKAAGKAVLNTVTDMVNQ | Dermaseptins B | Apoptosis inducing | Thymidine incorporation assay | MCF-7 | Breast cancer | Cytotoxicity :15 µM |
| dbacp02817 | DRS S1 | ALWKTMLKKLGTMALHAGKAALGAAADTISQGTQ | Dermaseptins B | Apoptosis inducing | Thymidine incorporation assay | MCF-7 | Breast cancer | Not found |
| dbacp02818 | DRS-DU-1 | ALWKSLLKNVGKAAGKAALNAVTDMVNQ | Purple and orange leaf frog | Apoptosis inducing | Not specified | Not found | Not found | Not found |
| dbacp02829 | Elastin derived peptide | VGVAPG | Elastin derived | Apoptosis inducing | Cell viability assay | MCF-7 | Breast cancer | Not found |
| dbacp02830 | Elastin derived peptide | VGVAPG | Elastin derived | Apoptosis inducing | Cell viability assay | A549 | Lung cancer | Not found |
| dbacp03289 | HCAP18(109-135) | FRKSKEKIGKEFKRIVQRIKDFLRNLV | HCAP18 synthetic peptide | Apoptosis inducing | Not specified | SAS-H1 | Oral cancer | Not found |
| dbacp03305 | HIV-TAT48-57 | GRKKRRQRRR | Not found | Apoptosis inducing | LDH leakage assay | HeLa | Cervical cancer | 7% apoptosis at 10 µM |
| dbacp03306 | HIV-TAT48-57 | GRKKRRQRRR | Not found | Apoptosis inducing | LDH leakage assay | HeLa | Cervical cancer | 15% apoptosis at 20 µM |
| dbacp03307 | HIV-TAT48-57 | GRKKRRQRRR | Not found | Apoptosis inducing | LDH leakage assay | HeLa | Cervical cancer | 35% apoptosis at 30 µM |
| dbacp03308 | HIV-TAT48-57 | GRKKRRQRRR | Not found | Apoptosis inducing | LDH leakage assay | HeLa | Cervical cancer | 65% apoptosis at 50 µM |
| dbacp03367 | Ichthyophthirius multifiliis (strain G5) B4 | LKKLFKKILKYL | White spot disease (strain G5) B4 | Apoptosis inducing; Penetration of the cell membrane | MTT assay | MCF-7 | Breast cancer | MIC : 5 μM |
| dbacp03368 | Ichthyophthirius multifiliis (strain G5) B4 | LKKLFKKILKYL | White spot disease (strain G5) B4 | Apoptosis inducing; Penetration of the cell membrane | MTT assay | K562 | Breast cancer | MIC : 5 μM |
| dbacp03369 | Ichthyophthirius multifiliis (strain G5) B8 | LKKLFKKILKY | White spot disease (strain G5) B8 | Apoptosis inducing; Penetration of the cell membrane | MTT assay | MCF-7 | Breast cancer | MIC : 7 μM |
| dbacp03370 | Ichthyophthirius multifiliis (strain G5) B8 | LKKLFKKILKY | White spot disease (strain G5) B8 | Apoptosis inducing; Penetration of the cell membrane | MTT assay | K562 | Breast cancer | MIC : 7 μM |
| dbacp03371 | Ichthyophthirius multifiliis BP100 | KKLFKKILKYL | White spot disease BP100 | Apoptosis inducing; Penetration of the cell membrane | MTT assay | MCF-7 | Breast cancer | MIC : 25 μM |
| dbacp03372 | Ichthyophthirius multifiliis BP100 | KKLFKKILKYL | White spot disease BP100 | Apoptosis inducing; Penetration of the cell membrane | MTT assay | K562 | Breast cancer | MIC : 25 μM |
| dbacp03526 | KT2 | NGVQPKYKWWKWWKKWW-NH2 | Siamese freshwater crocodile leukocyte | Apoptosis inducing | Sulforhodamine B colorimetric assay | CaSki | Cervical cancer | IC50 : 17.3 – 30.8 μM |
| dbacp03527 | KT2 | NGVQPKYKWWKWWKKWW-NH2 | Siamese freshwater crocodile leukocyte | Apoptosis inducing | Sulforhodamine B colorimetric assay | CaSki | Cervical cancer | IC50 : 17.3 – 30.8 μM |
| dbacp04312 | Lunasin | SKWQHQQDSCRKQLQGVNLTPCEKHIMEKIQGRGDDDDDDDDD | Soyabean | Apoptosis inducing; Anti-proliferative | MTT/MTS | HT-29 | Not specified | IC50 : 61.7 µM |
| dbacp04313 | Lunasin | SKWQHQQDSCRKQLQGVNLTPCEKHIMEKIQGRGDDDDDDDDD | Soyabean | Apoptosis inducing; Anti-proliferative | MTT/MTS | HCT-116 | Not specified | IC50 : 31.6 µM |
| dbacp04314 | Lunasin | SKWQHQQDSCRKQLQGVNLTPCEKHIMEKIQGRGDDDDDDDDD | Soyabean | Apoptosis inducing; Anti-proliferative | MTT/MTS | MCF-7 | Not specified | IC50 : 431.9 µM |
| dbacp04698 | MP06 | LAVISWKCQEWNSLWKKRKRKT | Green algae | Apoptosis inducing | CCK-8 assay | MRC5 | Lung cancer | IC50 : 10 μM |
| dbacp04713 | mt_E17L/L22 W/P27A | LTFSDWWKLLAE | MDM3 | Apoptosis inducing | MTT/MTS assay | MCF-7 | Breast cancer | IC50 : 15.1 µM |
| dbacp04714 | mt_L22 W/P27A | ETFSDWWKLLAE | MDM2 | Apoptosis inducing | MTT/MTS assay | MCF-7 | Breast cancer | IC50 : 16.3 µM |
| dbacp04715 | mt_S20A/L22 W/P27A | ETFADWWKLLAE | MDM5 | Apoptosis inducing | MTT/MTS assay | MCF-7 | Breast cancer | IC50 : 8.7 µM |
| dbacp04716 | mt_T18S/L22 W/P27A | ESFSDWWKLLAE | MDM4 | Apoptosis inducing | MTT/MTS assay | MCF-7 | Breast cancer | IC50 : 27 µM |
| dbacp04884 | Non-digestible fraction peptide | GLTSK | Common bean | Cell proliferation inhibition; Apoptosis inducing | MTS assay | HCT116 | Colorectal cancer | IC50 : 0.51 mg/ml |
| dbacp04885 | Non-digestible fraction peptide | LSGNK | Common bean | Cell proliferation inhibition; Apoptosis inducing | MTS assay | HCT116 | Colorectal cancer | IC50 : 0.51 mg/ml |
| dbacp04886 | Non-digestible fraction peptide | GEGSGA | Common bean | Cell proliferation inhibition; Apoptosis inducing | MTS assay | HCT116 | Colorectal cancer | IC50 : 0.51 mg/ml |
| dbacp04887 | Non-digestible fraction peptide | MPACGSS | Common bean | Cell proliferation inhibition; Apoptosis inducing | MTS assay | HCT116 | Colorectal cancer | IC50 : 0.51 mg/ml |
| dbacp04888 | Non-digestible fraction peptide | MTEEY | Common bean | Cell proliferation inhibition; Apoptosis inducing | MTS assay | HCT116 | Colorectal cancer | IC50 : 0.51 mg/ml |
| dbacp05031 | P04 | IGEHTPSALAIMENANVLAR | Aldolase A derived | Apoptosis inducing | MTT assay | PDAC | Pancreatic ductal adenocarcinoma | MIC : 25 µg/mL |
| dbacp05032 | P1 | KWKLFKKIGIGAVLKVLKKG | Ceropin A-African clawed frog | Apoptosis inducing | MTT/MTS assay | NCI-H69 | Lung cancer | IC50 :3.4 µM |
| dbacp05033 | P1 | KWKLFKKIGIGAVLKVLKKG | Ceropin A-African clawed frog | Apoptosis inducing | MTT/MTS assay | NCI-H128 | Lung cancer | IC50 :3.5 µM |
| dbacp05034 | P1 | KWKLFKKIGIGAVLKVLKKG | Ceropin A-African clawed frog | Apoptosis inducing | MTT/MTS assay | NCI-H146 | Lung cancer | IC50 :4.5 µM |
| dbacp05037 | P160 | VPWMEPAYQRFL | Not found | Apoptosis inducing | MTT cytotoxicity assay | MCF-7 | Breast cancer | IC50 : 14.2 ± 1.5 μM |
| dbacp05052 | P2 | KWKLFKKIGIGKFLHSATTF | Ceropin A-African clawed frog | Apoptosis inducing | MTT/MTS assay | NCI-H69 | Lung cancer | IC50 : 36.2 µM |
| dbacp05053 | P2 | KWKLFKKIGIGKFLHSATTF | Ceropin A-African clawed frog | Apoptosis inducing | MTT/MTS assay | NCI-H128 | Lung cancer | IC50 : 37.9 µM |
| dbacp05054 | P2 | KWKLFKKIGIGKFLHSATTF | Ceropin A-African clawed frog | Apoptosis inducing | MTT/MTS assay | NCI-H146 | Lung cancer | IC50 : 47.7 µM |
| dbacp05058 | P3 | KWKLFKKIGIGAFLHSAKKF | Ceropin A-African clawed frog | Apoptosis inducing | MTT/MTS assay | NCI-H69 | Lung cancer | IC50 : 9.3 µM |
| dbacp05059 | P3 | KWKLFKKIGIGAFLHSAKKF | Ceropin A-African clawed frog | Apoptosis inducing | MTT/MTS assay | NCI-H128 | Lung cancer | IC50 : 9.3 µM |
| dbacp05060 | P3 | KWKLFKKIGIGAFLHSAKKF | Ceropin A-African clawed frog | Apoptosis inducing | MTT/MTS assay | NCI-H146 | Lung cancer | IC50 : 10.9 µM |
| dbacp05072 | P4 | KWKLFKKIGIGKFLHLAKKF | Ceropin A-African clawed frog | Apoptosis inducing | MTT/MTS assay | NCI-H69 | Lung cancer | IC50 : 1.9 µM |
| dbacp05073 | P4 | KWKLFKKIGIGKFLHLAKKF | Ceropin A-African clawed frog | Apoptosis inducing | MTT/MTS assay | NCI-H128 | Lung cancer | IC50 : 1.3 µM |
| dbacp05074 | P4 | KWKLFKKIGIGKFLHLAKKF | Ceropin A-African clawed frog | Apoptosis inducing | MTT/MTS assay | NCI-H146 | Lung cancer | IC50 : 2.8 µM |
| dbacp05075 | P5 | KWKLFKKIGIGAFLHLAKKF | Ceropin A-African clawed frog | Apoptosis inducing | MTT/MTS assay | NCI-H69 | Lung cancer | IC50 : 2.9 µM |
| dbacp05076 | P5 | KWKLFKKIGIGAFLHLAKKF | Ceropin A-African clawed frog | Apoptosis inducing | MTT/MTS assay | NCI-H128 | Lung cancer | IC50 : 2.9 µM |
| dbacp05077 | P5 | KWKLFKKIGIGAFLHLAKKF | Ceropin A-African clawed frog | Apoptosis inducing | MTT/MTS assay | NCI-H146 | Lung cancer | IC50 : 3.2 µM |
| dbacp05086 | P6 | KWKLFKKIGIGKFKLAKKF | Ceropin A-African clawed frog | Apoptosis inducing | MTT/MTS assay | NCI-H69 | Lung cancer | IC50 : 1.7 µM |
| dbacp05087 | P6 | KWKLFKKIGIGKFKLAKKF | Ceropin A-African clawed frog | Apoptosis inducing | MTT/MTS assay | NCI-H128 | Lung cancer | IC50 : 2 µM |
| dbacp05088 | P6 | KWKLFKKIGIGKFKLAKKF | Ceropin A-African clawed frog | Apoptosis inducing | MTT/MTS assay | NCI-H146 | Lung cancer | IC50 : 3.1 µM |
| dbacp05094 | P7 | PLLQATLGGGS | Not found | Apoptosis inducing | WST-1 assay | B16-F10 | Skin cancer | IC50 : 1 µM |
| dbacp05095 | P7 | KWKLFAKIGIGKFLHLAKKF | Ceropin A-African clawed frog | Apoptosis inducing | MTT/MTS assay | NCI-H69 | Lung cancer | IC50 : 3.1 µM |
| dbacp05096 | P7 | KWKLFAKIGIGKFLHLAKKF | Ceropin A-African clawed frog | Apoptosis inducing | MTT/MTS assay | NCI-H128 | Lung cancer | IC50 : 2.4 µM |
| dbacp05097 | P7 | KWKLFAKIGIGKFLHLAKKF | Ceropin A-African clawed frog | Apoptosis inducing | MTT/MTS assay | NCI-H146 | Lung cancer | IC50 : 2.4 µM |
| dbacp05100 | P8 | KWKKFLKIGIGKFLHLAKKF | Ceropin A-African clawed frog | Apoptosis inducing | MTT/MTS assay | NCI-H128 | Lung cancer | IC50 : 2.3 µM |
| dbacp05101 | P8 | KWKKFLKIGIGKFLHLAKKF | Ceropin A-African clawed frog | Apoptosis inducing | MTT/MTS assay | NCI-H146 | Lung cancer | IC50 : 1.8 µM |
| dbacp05246 | Pep27 | MRKEFHNVLSSGQLLADKRPARDYNRK | Pneumococcus | Apoptosis inducing | MTT/MTS assay | AML-2 | Leukemia cancer | Not found |
| dbacp05247 | Pep27 | MRKEFHNVLSSGQLLADKRPARDYNRK | Pneumococcus | Apoptosis inducing | MTT/MTS assay | HL-60 | Leukemia cancer | IC50 : > 70 µM |
| dbacp05248 | Pep27 | MRKEFHNVLSSGQLLADKRPARDYNRK | Pneumococcus | Apoptosis inducing | MTT/MTS assay | Jurkat | Blood cancer | IC50 : > 70 µM |
| dbacp05249 | Pep27 | MRKEFHNVLSSGQLLADKRPARDYNRK | Pneumococcus | Apoptosis inducing | MTT/MTS assay | SNU-601 | Gastric cancer | IC50 : > 70 µM |
| dbacp05250 | Pep27 | MRKEFHNVLSSGQLLADKRPARDYNRK | Pneumococcus | Apoptosis inducing | MTT/MTS assay | MCF-7 | Breast cancer | IC50 : > 70 µM |
| dbacp05256 | Pep27 | MRKEFHNVLSSGQLLADKRPARDYNRK | Pneumococcus | Apoptosis inducing | MTT/MTS assay | MCF-7 | Breast cancer | IC50 : > 70 µM |
| dbacp05282 | Pep27anal1 | MWKWFHNVLSSWQLLADKRPARDYNRK | Pneumococcus | Apoptosis inducing | MTT/MTS assay | AML-2 | Leukemia cancer | IC50 : 50 µM |
| dbacp05283 | Pep27anal1 | MWKWFHNVLSSWQLLADKRPARDYNRK | Pneumococcus | Apoptosis inducing | MTT/MTS assay | HL-60 | Leukemia cancer | IC50 : 53 µM |
| dbacp05284 | Pep27anal1 | MWKWFHNVLSSWQLLADKRPARDYNRK | Pneumococcus | Apoptosis inducing | MTT/MTS assay | Jurkat | Blood cancer | IC50 : 47 µM |
| dbacp05285 | Pep27anal1 | MWKWFHNVLSSWQLLADKRPARDYNRK | Pneumococcus | Apoptosis inducing | MTT/MTS assay | SNU-601 | Gastric cancer | IC50 : 37 µM |
| dbacp05286 | Pep27anal1 | MWKWFHNVLSSWQLLADKRPARDYNRK | Pneumococcus | Apoptosis inducing | MTT/MTS assay | MCF-7 | Breast cancer | IC50 : 55 µM |
| dbacp05287 | Pep27anal2 | MWKWFHNVLSWWWLLADKRPARDYNRK | Pneumococcus | Apoptosis inducing | MTT/MTS assay | AML-2 | Leukemia cancer | IC50 : 29 µM |
| dbacp05288 | Pep27anal2 | MWKWFHNVLSWWWLLADKRPARDYNRK | Pneumococcus | Apoptosis inducing | MTT/MTS assay | HL-60 | Leukemia cancer | IC50 : 20 µM |
| dbacp05289 | Pep27anal2 | MWKWFHNVLSWWWLLADKRPARDYNRK | Pneumococcus | Apoptosis inducing | MTT/MTS assay | Jurkat | Blood cancer | IC50 : 23 µM |
| dbacp05290 | Pep27anal2 | MWKWFHNVLSWWWLLADKRPARDYNRK | Pneumococcus | Apoptosis inducing | MTT/MTS assay | SNU-601 | Gastric cancer | IC50 : 25 µM |
| dbacp05291 | Pep27anal2 | MWKWFHNVLSWWWLLADKRPARDYNRK | Pneumococcus | Apoptosis inducing | MTT/MTS assay | MCF-7 | Breast cancer | IC50 : < 10 µM |
| dbacp05292 | Pep27anal3 | MRKWFHNVLSSGQLLADKWPAWDYNRK | Pneumococcus | Apoptosis inducing | MTT/MTS assay | AML-2 | Leukemia cancer | IC50 : 67 µM |
| dbacp05293 | Pep27anal3 | MRKWFHNVLSSGQLLADKWPAWDYNRK | Pneumococcus | Apoptosis inducing | MTT/MTS assay | HL-60 | Leukemia cancer | IC50 : 52 µM |
| dbacp05294 | Pep27anal3 | MRKWFHNVLSSGQLLADKWPAWDYNRK | Pneumococcus | Apoptosis inducing | MTT/MTS assay | Jurkat | Blood cancer | IC50 : 50 µM |
| dbacp05295 | Pep27anal3 | MRKWFHNVLSSGQLLADKWPAWDYNRK | Pneumococcus | Apoptosis inducing | MTT/MTS assay | SNU-601 | Gastric cancer | IC50 : 50 µM |
| dbacp05296 | Pep27anal3 | MRKWFHNVLSSGQLLADKWPAWDYNRK | Pneumococcus | Apoptosis inducing | MTT/MTS assay | MCF-7 | Breast cancer | IC50 : 38 µM |
| dbacp05297 | Pep27anal4 | MWKEFHNVLSSGQLLADKRWARWYNRW | Pneumococcus | Apoptosis inducing | MTT/MTS assay | AML-2 | Leukemia cancer | IC50 : 50 µM |
| dbacp05298 | Pep27anal4 | MWKEFHNVLSSGQLLADKRWARWYNRW | Pneumococcus | Apoptosis inducing | MTT/MTS assay | HL-60 | Leukemia cancer | IC50 : 51 µM |
| dbacp05299 | Pep27anal4 | MWKEFHNVLSSGQLLADKRWARWYNRW | Pneumococcus | Apoptosis inducing | MTT/MTS assay | Jurkat | Blood cancer | IC50 : 46 µM |
| dbacp05300 | Pep27anal4 | MWKEFHNVLSSGQLLADKRWARWYNRW | Pneumococcus | Apoptosis inducing | MTT/MTS assay | SNU-601 | Gastric cancer | IC50 : 37 µM |
| dbacp05301 | Pep27anal4 | MWKEFHNVLSSGQLLADKRWARWYNRW | Pneumococcus | Apoptosis inducing | MTT/MTS assay | MCF-7 | Breast cancer | IC50 : 29 µM |
| dbacp05302 | Pep27anal5 | MWKWFHNVLSSGQLLADKWWAWWYNWW | Pneumococcus | Apoptosis inducing | MTT/MTS assay | AML-2 | Leukemia cancer | IC50 : >70 µM |
| dbacp05303 | Pep27anal5 | MWKWFHNVLSSGQLLADKWWAWWYNWW | Pneumococcus | Apoptosis inducing | MTT/MTS assay | HL-60 | Leukemia cancer | IC50 : >70 µM |
| dbacp05304 | Pep27anal5 | MWKWFHNVLSSGQLLADKWWAWWYNWW | Pneumococcus | Apoptosis inducing | MTT/MTS assay | Jurkat | Blood cancer | IC50 : >70 µM |
| dbacp05305 | Pep27anal5 | MWKWFHNVLSSGQLLADKWWAWWYNWW | Pneumococcus | Apoptosis inducing | MTT/MTS assay | SNU-601 | Gastric cancer | IC50 : >70 µM |
| dbacp05306 | Pep27anal5 | MWKWFHNVLSSGQLLADKWWAWWYNWW | Pneumococcus | Apoptosis inducing | MTT/MTS assay | MCF-7 | Breast cancer | IC50 : >70 µM |
| dbacp05462 | Peptidoglycan recognition protein 1 | MLFAWAPFPALLGLADSCCFVVPRSEWKALPSECSKGLKKPVRYVVISHTAGSFCSSPDSCEQQARNVQLYQMKQLGWCDVAYNFLIGEDGHVYEGRGWTIKGDHTGPIWNPMSIGITFMGDYSHRVPAKRALRAALNLLKCGVSEGFLRSNYEVKGHRDVQSTLSPGDQLYEIIQSWDHYRE | Rat | Apoptosis inducing | Not specified | L929 | Not found | Not found |
| dbacp05463 | Peptidoglycan recognition protein 1 | MSRRSMLLAWALPSLLRLGAAQETEDPACCSPIVPRNEWKALASECAQHLSLPLRYVVVSHTAGSSCNTPASCQQQARNVQHYHMKTLGWCDVGYNFLIGEDGLVYEGRGWNFTGAHSGHLWNPMSIGISFMGNYMDRVPTPQAIRAAQGLLACGVAQGALRSNYVLKGHRDVQRTLSPGNQLYHLIQNWPHYRSP | Human | Apoptosis inducing; Necrotic cell death | Enzyme inhibition assay | K562 | Not specified | Not found |
| dbacp05464 | Peptidoglycan recognition protein 1 | MSRRSMLLAWALPSLLRLGAAQETEDPACCSPIVPRNEWKALASECAQHLSLPLRYVVVSHTAGSSCNTPASCQQQARNVQHYHMKTLGWCDVGYNFLIGEDGLVYEGRGWNFTGAHSGHLWNPMSIGISFMGNYMDRVPTPQAIRAAQGLLACGVAQGALRSNYVLKGHRDVQRTLSPGNQLYHLIQNWPHYRSP | Human | Apoptosis inducing; Necrotic cell death | Enzyme inhibition assay | Molt4 | Not specified | Not found |
| dbacp05465 | Peptidoglycan recognition protein 1 | MSRRSMLLAWALPSLLRLGAAQETEDPACCSPIVPRNEWKALASECAQHLSLPLRYVVVSHTAGSSCNTPASCQQQARNVQHYHMKTLGWCDVGYNFLIGEDGLVYEGRGWNFTGAHSGHLWNPMSIGISFMGNYMDRVPTPQAIRAAQGLLACGVAQGALRSNYVLKGHRDVQRTLSPGNQLYHLIQNWPHYRSP | Human | Apoptosis inducing; Necrotic cell death | Enzyme inhibition assay | HeLa | Not specified | Not found |
| dbacp05466 | Peptidoglycan recognition protein 1 | MSRRSMLLAWALPSLLRLGAAQETEDPACCSPIVPRNEWKALASECAQHLSLPLRYVVVSHTAGSSCNTPASCQQQARNVQHYHMKTLGWCDVGYNFLIGEDGLVYEGRGWNFTGAHSGHLWNPMSIGISFMGNYMDRVPTPQAIRAAQGLLACGVAQGALRSNYVLKGHRDVQRTLSPGNQLYHLIQNWPHYRSP | Human | Apoptosis inducing; Necrotic cell death | Enzyme inhibition assay | L929 | Not specified | Not found |
| dbacp05565 | piscidin-1 | FFHHIFRGIVHVGKTIHRLVTG | Striped bass fish | Apoptosis inducing; Elevation of ROS | MTT/MTS assay | SCC4 | Oral squamous cell carcinoma | IC50 : 10.82 – 13.77 μM |
| dbacp05566 | piscidin-1 | FFHHIFRGIVHVGKTIHRLVTG | Striped bass fish | Inhibits angiogenesis; Apoptosis inducing; Elevation of ROS | MTT/MTS assay | OC2 | Oral cancer | IC50 : 16.94 – 19.20 μM |
| dbacp05576 | Pleurocidin | GWGSFFKKAAHVGKHVGKAALTHYL | Winter flounder | Apoptosis inducing; Anti-proliferative activity | MTT assay | J5 | Hepatocellular carcinoma | IC50 : 54.9 µM |
| dbacp05577 | Pleurocidin | GWGSFFKKAAHVGKHVGKAALTHYL | Winter flounder | Apoptosis inducing; Anti-proliferative activity | MTT assay | Hep3B | Hepatocellular carcinoma | IC50 : 340.9 µM |
| dbacp05578 | Pleurocidin | GWGSFFKKAAHVGKHVGKAALTHYL | Winter flounder | Apoptosis inducing; Anti-proliferative activity | MTT assay | A549 | Non-small cell lung adenocarcinoma | IC50 : 300.8 µM |
| dbacp05579 | Pleurocidin | GWGSFFKKAAHVGKHVGKAALTHYL | Winter flounder | Apoptosis inducing; Anti-proliferative activity | MTT assay | AGS | Stomach adenocarcinoma | IC50 : 186.5 µM |
| dbacp05580 | Pleurocidin-a | GWGSFFKKAAHVGKHVGKAALTHYL-NH2 | Winter flounder | Apoptosis inducing; Anti-proliferative activity | MTT assay | J5 | Hepatocellular carcinoma | IC50 :1 1 µM |
| dbacp05581 | Pleurocidin-a | GWGSFFKKAAHVGKHVGKAALTHYL-NH3 | Winter flounder | Apoptosis inducing; Anti-proliferative activity | MTT assay | Huh7 | Hepatocellular carcinoma | IC50 : 60 µM |
| dbacp05582 | Pleurocidin-a | GWGSFFKKAAHVGKHVGKAALTHYL-NH4 | Winter flounder | Apoptosis inducing; Anti-proliferative activity | MTT assay | Hep3B | Hepatocellular carcinoma | IC50 : 77.5 µM |
| dbacp05583 | Pleurocidin-a | GWGSFFKKAAHVGKHVGKAALTHYL-NH5 | Winter flounder | Apoptosis inducing; Anti-proliferative activity | MTT assay | A549 | Non-small cell lung adenocarcinoma | IC50 : 42.1 µM |
| dbacp05584 | Pleurocidin-a | GWGSFFKKAAHVGKHVGKAALTHYL-NH6 | Winter flounder | Apoptosis inducing; Anti-proliferative activity | MTT assay | AGS | Stomach adenocarcinoma | IC50 : 29.8 µM |
| dbacp05585 | Pleurocidin-a | GWGSFFKKAAHVGKHVGKAALTHYL-NH7 | Winter flounder | Apoptosis inducing; Anti-proliferative activity | MTT assay | WiDr | Colon adenocarcinoma | IC50 : 197.3 µM |
| dbacp05586 | Pleurocidin-a | GWGSFFKKAAHVGKHVGKAALTHYL-NH8 | Winter flounder | Apoptosis inducing; Anti-proliferative activity | MTT assay | NIH-3T3 | Mouse fibroblast | IC50 : 313 µM |
| dbacp05674 | Protein S100-A8 | MLTELEKALNSIIDVYHKYSLIKGNFHAVYRDDLKKLLETECPQYIRKKGADVWFKELDINTDGAVNFQEFLILVIKMGVAAHKKSHEESHKE | Human | Apoptosis inducing | MTT/MTS assay | MM46 | Breast cancer | IC50 : 10 µM |
| dbacp05873 | Radical SAM domain protein | MEAVLYVTRKCNLSCGHCIVDKEDNSDLPTDKVETLASDYPIDRTILSGGEPFLHDNFEELVALVPEPTVLSNGLVLSDEEYVGENSDMLEELNGIQLSVEGKEETTDARRGEGVWDRVMEAHQNLSEIGVESYLRSTYSREMMEEVGELMEFCDAEGISLVLFPEIGKPPLSPTENASFFDYAVEKGVVVATPDFHSYIGEGGECPAARTRISVDVNGEIYPCQFNWDYCLGEVGDEWGLIESRIERFDRTEPVPRTCSRCDFANKCRGCGVADTWSGCPIARGLSHSESPSRRPLKRVQETMNTLEDVGAPRGCHGC | Uncultured archaeon | Apoptosis inducing | MTT assay | MCF-7 | Breast cancer | MIC : 42% ± 8.1 μM |
| dbacp05874 | Radical SAM domain protein | MEAVLYVTRKCNLSCGHCIVDKEDNSDLPTDKVETLASDYPIDRTILSGGEPFLHDNFEELVALVPEPTVLSNGLVLSDEEYVGENSDMLEELNGIQLSVEGKEETTDARRGEGVWDRVMEAHQNLSEIGVESYLRSTYSREMMEEVGELMEFCDAEGISLVLFPEIGKPPLSPTENASFFDYAVEKGVVVATPDFHSYIGEGGECPAARTRISVDVNGEIYPCQFNWDYCLGEVGDEWGLIESRIERFDRTEPVPRTCSRCDFANKCRGCGVADTWSGCPIARGLSHSESPSRRPLKRVQETMNTLEDVGAPRGCHGC | Uncultured archaeon | Apoptosis inducing | MTT assay | U2OS | Osteosarcoma | No significant effect |
| dbacp05928 | Red Sea microbiome peptide | AAEKEFIKYPYPTPLQYQQLATRLKVEKKLVRRW | Red Sea microbiome derived peptide | Apoptosis inducing | MTT/MTS assay | U2OS | Osteosarcoma | Not found |
| dbacp05961 | RGD-mda-7 | MNFQQRLQSLWTLARPFCPPLLATASQMQMVVLPCLGFTLLLWSQVSGAQGQEFHFGPCQVKGVVPQKLWEAFWAVKDTMQAQDNITSARLLQQEVLQNVSDAESCYLVHTLLEFYLKTVFKNYHNRTVEVRTLKSFSTLANNFVLIVSQLQPSQENEMFSIRGDSAHRRFLLFRRAFKQLDVEAALTKALGEVDILLTWMQKFYKL | Derived from wtmda-7/IL-24 by insertion or a glycine residue between Arg(164) and Asp(165). | Apoptosis inducing | MTT/MTS assay | MCF-7 | Breast cancer | Cell viability(% of control):0.5 at concentration 4 µg/ml |
| dbacp05962 | RGD-mda-7 | MNFQQRLQSLWTLARPFCPPLLATASQMQMVVLPCLGFTLLLWSQVSGAQGQEFHFGPCQVKGVVPQKLWEAFWAVKDTMQAQDNITSARLLQQEVLQNVSDAESCYLVHTLLEFYLKTVFKNYHNRTVEVRTLKSFSTLANNFVLIVSQLQPSQENEMFSIRGDSAHRRFLLFRRAFKQLDVEAALTKALGEVDILLTWMQKFYKL | Derived from wtmda-7/IL-24 by insertion or a glycine residue between Arg(164) and Asp(165). | Apoptosis inducing | MTT/MTS assay | Ket-3 | Tumor | Cell viability(% of control): 0.5 at concentration 8 µg/ml |
| dbacp05963 | RGD-mda-7 | MNFQQRLQSLWTLARPFCPPLLATASQMQMVVLPCLGFTLLLWSQVSGAQGQEFHFGPCQVKGVVPQKLWEAFWAVKDTMQAQDNITSARLLQQEVLQNVSDAESCYLVHTLLEFYLKTVFKNYHNRTVEVRTLKSFSTLANNFVLIVSQLQPSQENEMFSIRGDSAHRRFLLFRRAFKQLDVEAALTKALGEVDILLTWMQKFYKL | Derived from wtmda-7/IL-24 by insertion or a glycine residue between Arg(164) and Asp(165). | Apoptosis inducing | MTT/MTS assay | MCF-7 | Breast cancer | Apoptotic rate(%): >70% at concentration of 8 µg/ml |
| dbacp05964 | RGD-mda-7 | MNFQQRLQSLWTLARPFCPPLLATASQMQMVVLPCLGFTLLLWSQVSGAQGQEFHFGPCQVKGVVPQKLWEAFWAVKDTMQAQDNITSARLLQQEVLQNVSDAESCYLVHTLLEFYLKTVFKNYHNRTVEVRTLKSFSTLANNFVLIVSQLQPSQENEMFSIRDSAHRRFLLFRRAFKQL | Derived from wtmda-7/IL-24 by insertion or a glycine residue between Arg(164) and Asp(165). | Apoptosis inducing | MTT/MTS assay | Ket-3 | Tumor | Apoptotic rate(%): >50% at concentration of 8 µg/ml |
| dbacp05969 | RGSALTHLP | RGSALTHLP | Siamese crocodile Leukocyte | Apoptosis inducing | Sulforhodamine B colorimetric assay | HeLa | Cervical cancer | IC50 : 126.24 ± 3.5 μM |
| dbacp05970 | RGSALTHLP | RGSALTHLP | Siamese crocodile Leukocyte | Apoptosis inducing | Sulforhodamine B colorimetric assay | CaSki | Cervical cancer | IC50 : 168.33 ± 1.6 μM |
| dbacp05982 | RT2 | NGVQPKYRWWRWWRRWW-NH2 | Siamese crocodile leukocyte | Apoptosis inducing | Sulforhodamine B colorimetric assay | HeLa | Cervical cancer | IC50 : 28.7–53.4 μM |
| dbacp05983 | RT2 | NGVQPKYRWWRWWRRWW-NH2 | Siamese crocodile leukocyte | Apoptosis inducing | Sulforhodamine B colorimetric assay | HeLa | Cervical cancer | IC50 : 28.7–53.4 μM |
| dbacp06183 | t Mastoparan-C(tMP-C, Tat (49-57)-Mastoparan-C) | RKKRRQRRRLNLKALLAVAKKIL | Synthetic construct | Apoptosis inducing | MTT assay | H157 | Non-small cell Lung cancer | IC50 : 2.79 μM |
| dbacp06184 | t Mastoparan-C(tMP-C, Tat (49-57)-Mastoparan-C) | RKKRRQRRRLNLKALLAVAKKIL | Synthetic construct | Apoptosis inducing | MTT assay | MBD-MB-435S | Melanocyte | IC50 : 3.86 μM |
| dbacp06185 | t Mastoparan-C(tMP-C, Tat (49-57)-Mastoparan-C) | RKKRRQRRRLNLKALLAVAKKIL | Synthetic construct | Apoptosis inducing | MTT assay | PC-3 | Human prostate carcinoma | IC50 : 3.86 μM |
| dbacp06186 | t Mastoparan-C(tMP-C, Tat (49-57)-Mastoparan-C) | RKKRRQRRRLNLKALLAVAKKIL | Synthetic construct | Apoptosis inducing | MTT assay | U251-MG | Human glioblastoma astrocytoma | IC50 : 3.36 μM |
| dbacp06187 | t Mastoparan-C(tMP-C, Tat (49-57)-Mastoparan-C) | RKKRRQRRRLNLKALLAVAKKIL | Synthetic construct | Apoptosis inducing | MTT assay | MCF-7 | Human breast cancer | IC50 : 3.70 μM |
| dbacp06192 | Tachyplesin I | KWCFRVCYRGICYRRCR | Hemocytes, Southeast Asia, Japanese horseshoe crab | Apoptosis inducing | Luciferase reporter assay, TUNEL assay | T167 | Squamous cell oral carcinoma | Not found |
| dbacp06193 | Tachyplesin I | KWCFRVCYRGICYRRCR | Hemocytes, Southeast Asia, Japanese horseshoe crab | Apoptosis inducing | Luciferase reporter assay, TUNEL assay | T-409 | Squamous cell oral carcinoma | Not found |
| dbacp06195 | Tat | RKKRRQRRR | HIV-Tat (49-57) | Apoptosis inducing | MTT/MTS assay | HCT-116 | Colon cancer | ~10% cytotoxicity at 100 µM |
| dbacp06199 | Tat-a5 | KAQIRAMECNILGRKKRRQRRR | HIV-Tat (49-57) | Apoptosis inducing | MTT/MTS assay | HCT-116 | Colon cancer | ~80% cytotoxicity at 100 µM |
| dbacp06215 | TAT-Ras-GAP317-326 | GRKKRRQRRRGGWMWVTNLRTD | Not found | Apoptosis inducing | LDH leakage assay | HeLa | Cervical cancer | 15% apoptosis at 10 µM |
| dbacp06216 | TAT-Ras-GAP317-326 | GRKKRRQRRRGGWMWVTNLRTD | Not found | Apoptosis inducing | LDH leakage assay | HeLa | Cervical cancer | 47% apoptosis at 20 µM |
| dbacp06217 | TAT-Ras-GAP317-326 | GRKKRRQRRRGGWMWVTNLRTD | Not found | Apoptosis inducing | LDH leakage assay | HeLa | Cervical cancer | 72% apoptosis at 30 µM |
| dbacp06218 | TAT-Ras-GAP317-326 | GRKKRRQRRRGGWMWVTNLRTD | Not found | Apoptosis inducing | LDH leakage assay | HeLa | Cervical cancer | 79% apoptosis at 50 µM |
| dbacp06326 | Transactivator of transcript-DV1-Bcl-2, AT-DV1-BH3 | RRRQRRKKRGGGGLGASWHRPDK | Transactivator of transcript-DV1-Bcl-2 TAT-DV1-BH3 | Apoptosis inducing | Cell viability assay, Transwell invasion assay | MDA-MB-231 | Breast cancer | Not specified |
| dbacp06327 | Transactivator of transcript-DV1-Bcl-2, AT-DV1-BH3 | RRRQRRKKRGGGGLGASWHRPDK | Transactivator of transcript-DV1-Bcl-2 TAT-DV1-BH4 | Apoptosis inducing | Cell viability assay, Transwell invasion assay | MCF-7 | Breast cancer | Not specified |
| dbacp06328 | Transactivator of transcript-DV1-Bcl-2, AT-DV1-BH3 | RRRQRRKKRGGGGLGASWHRPDK | Transactivator of transcript-DV1-Bcl-2 TAT-DV1-BH5 | Apoptosis inducing | Cell viability assay, Transwell invasion assay | HEK-293 | Kidney cancer | Not specified |
| dbacp06500 | Vigno 5 | GLPLCGETCVGGTCNTPGCSCGWPVCVRN | Viola ignobilis | Apoptosis inducing | MTT assay, AO/EB and DAPI staining assay | HeLa cells | Cervical cancer | IC50 : 2.5 – 10 μM |
| dbacp06501 | Vigno 5 | GLPLCGETCVGGTCNTPGCSCGWPVCVRN | Viola ignobilis | Apoptosis inducing | MTT assay, AO/EB and DAPI staining assay | L929 | Cervical cancer | IC50 : 2.5 – 10 μM |
| dbacp06534 | wtmda-7/IL-24 | MNFQQRLQSLWTLARPFCPPLLATASQMQMVVLPCLGFTLLLWSQVSGAQGQEFHFGPCQVKGVVPQKLWEAFWAVKDTMQAQDNITSARLLQQEVLQNVSDAESCYLVHTLLEFYLKTVFKNYHNRTVEVRTLKSFSTLANNFVLIVSQLQPSQENEMFSIRDSAHRRFLLFRRAFKQL | Not found | Apoptosis inducing | MTT/MTS assay | MCF-7 | Breast cancer | Cell viability (% of control):0.5 at concentration 7 µg/ml |
| dbacp06535 | wtmda-7/IL-24 | MNFQQRLQSLWTLARPFCPPLLATASQMQMVVLPCLGFTLLLWSQVSGAQGQEFHFGPCQVKGVVPQKLWEAFWAVKDTMQAQDNITSARLLQQEVLQNVSDAESCYLVHTLLEFYLKTVFKNYHNRTVEVRTLKSFSTLANNFVLIVSQLQPSQENEMFSIRDSAHRRFLLFRRAFKQL | Not found | Apoptosis inducing | MTT/MTS assay | Ket-3 | Tumor | Cell viability (% of control): 0.5 at concentration 8 µg/ml |
| dbacp06536 | wtmda-7/IL-24 | MNFQQRLQSLWTLARPFCPPLLATASQMQMVVLPCLGFTLLLWSQVSGAQGQEFHFGPCQVKGVVPQKLWEAFWAVKDTMQAQDNITSARLLQQEVLQNVSDAESCYLVHTLLEFYLKTVFKNYHNRTVEVRTLKSFSTLANNFVLIVSQLQPSQENEMFSIRDSAHRRFLLFRRAFKQL | Not found | Apoptosis inducing | MTT/MTS assay | MCF-7 | Breast cancer | Apoptotic rate(%) : > 50% at concentration of 8 µg/ml |
| dbacp06537 | wtmda-7/IL-24 | MNFQQRLQSLWTLARPFCPPLLATASQMQMVVLPCLGFTLLLWSQVSGAQGQEFHFGPCQVKGVVPQKLWEAFWAVKDTMQAQDNITSARLLQQEVLQNVSDAESCYLVHTLLEFYLKTVFKNYHNRTVEVRTLKSFSTLANNFVLIVSQLQPSQENEMFSIRDSAHRRFLLFRRAFKQL | Not found | Apoptosis inducing | MTT/MTS assay | Ket-3 | Tumor | Apoptotic rate(%) : > 30% at concentration of 8 µg/ml |
| dbacp06605 | αs1-casein f(90_95) | RYLGYL | Bovine milk | Regulation of immune response; Apoptosis inducing | MTT/MTS assay | AZ-97 | Colon cancer | Inhibition at 12 - 15 g/l |
| dbacp06606 | β-Casomorphins 5 f(60_64) | YPFPG | Bovine milk | Regulation of immune response; Apoptosis inducing | MTT/MTS assay | AZ-97 | Colon cancer | Inhibition at 9 - 11 g/l |
| dbacp06656 | LfcinB (21-25)Pal | RWQWRWQWR | LfcinB | Apoptosis inducing | MTT assay | CaCo-2 | Colorectal Cancer | IC50 = 86 μM |
| dbacp06657 | LfcinB (21-25)Pal | RWQWRWQWR | LfcinB | Apoptosis inducing | MTT assay | HT-29 | Colon Cancer | IC50 = 100 μM |
| dbacp06658 | LfcinB (21-25)Pal | RWQWRWQWR | LfcinB | Apoptosis inducing | MTT assay | DU-145 | Prostrate Cancer | IC50 = 40 μM |
| dbacp06659 | Ahx-[Pal] | Ahx-RWQWRWQWR | Synthetic | Apoptosis inducing | MTT assay | HT-29 | Colon Cancer | IC50 = 119 μM |
| dbacp06660 | Ahx-[Pal] | Ahx-RWQWRWQWR | Synthetic | Apoptosis inducing | MTT assay | CaCo-2 | Colorectal Cancer | IC50 = 40 μM |
| dbacp06661 | 9[Orn] [Pal] | RWQWRWQWO | Synthetic | Apoptosis inducing | MTT assay | HT-29 | Colon Cancer | IC50 = 109 μM |
| dbacp06662 | 9[Orn] [Pal] | RWQWRWQWO | Synthetic | Apoptosis inducing | MTT assay | CaCo-2 | Colorectal Cancer | IC50 = 40 μM |
| dbacp06663 | 9[Orn] [Pal] | RWQWRWQWO | Synthetic | Apoptosis inducing | MTT assay | DU-145 | Prostrate Cancer | IC50 = 62 μM |
| dbacp06664 | CH3CO-Ahx-[Pal] | CH3-CO-Ahx-RWQWRWQWR | Synthetic | Apoptosis inducing | MTT assay | CaCo-2 | Colorectal Cancer | IC50 = 31 μM |
| dbacp06665 | 1[dR][Pal] | rWQWRWQWR | Synthetic | Apoptosis inducing | MTT assay | CaCo-2 | Colorectal Cancer | IC50 = 105 μM |
| dbacp06666 | 1[Orn] [Pal] | OWQWRWQWR | Synthetic | Apoptosis inducing | MTT assay | CaCo-2 | Colorectal Cancer | IC50 = 91 μM |
| dbacp06667 | 5[Orn] [Pal] | RWQWOWQWR | Synthetic | Apoptosis inducing | MTT assay | CaCo-2 | Colorectal Cancer | IC50 = 64 μM |
| dbacp06668 | 1[dR] 5[Orn] [Pal] | rWQWOWQWR | Synthetic | Apoptosis inducing | MTT assay | CaCo-2 | Colorectal Cancer | IC50 = 109 μM |
| dbacp06704 | P05 | ADDGRPFPQVIK | Aldolase A fragment | Apoptosis inducing | MTT assay | MG-63 | Bone Cancer | Relative viability = 0.85 at 50 μg/ml |
| dbacp06705 | P05 | ADDGRPFPQVIK | Aldolase A fragment | Apoptosis inducing | MTT assay | U-2 OS | Bone Cancer | Relative viability = 0.98 at 50 μg/ml |
| dbacp06706 | P02 | AEEYEFLTPMEEAPK | Rho GDP Dissociation Inhibitor Alpha fragment | Apoptosis inducing | MTT assay | MG-63 | Bone Cancer | Relative viability = 0.88 at 50 μg/ml |
| dbacp06707 | P02 | AEEYEFLTPMEEAPK | Rho GDP Dissociation Inhibitor Alpha fragment | Apoptosis inducing | MTT assay | U-2 OS | Bone Cancer | Relative viability = 0.93 at 50 μg/ml |
| dbacp06708 | P01 | SETAPAAPAAPAPAEK | Histone H1.4 (H1-4) Fragment | Apoptosis inducing | MTT assay | MG-63 | Bone Cancer | Relative viability = 0.84 at 50 μg/ml |
| dbacp06709 | P01 | SETAPAAPAAPAPAEK | Histone H1.4 (H1-4) Fragment | Apoptosis inducing | MTT assay | U-2 OS | Bone Cancer | Relative viability = 1.13 at 50 μg/ml |
| dbacp06710 | P03 | HVFGESDELIGQK | Triosephosphate Isomerase (TPI) fragment | Apoptosis inducing | MTT assay | MG-63 | Bone Cancer | Relative viability = 1.04 at 50 μg/ml |
| dbacp06711 | P03 | HVFGESDELIGQK | Triosephosphate Isomerase (TPI) fragment | Apoptosis inducing | MTT assay | U-2 OS | Bone Cancer | Relative viability = 0.98 at 50 μg/ml |
| dbacp06712 | P06 | GAGTGGLGLAVEGPSEAK | FLNA (Filamin A) fragment | Apoptosis inducing | MTT assay | MG-63 | Bone Cancer | Relative viability = 0.92 at 50 μg/ml |
| dbacp06713 | P06 | GAGTGGLGLAVEGPSEAK | FLNA (Filamin A) fragment | Apoptosis inducing | MTT assay | U-2 OS | Bone Cancer | Relative viability = 1.17 at 50 μg/ml |
| dbacp06714 | P07 | VEPGLGADNSVVR | FLNA (Filamin A) fragment | Apoptosis inducing | MTT assay | MG-63 | Bone Cancer | Relative viability = 0.96 at 50 μg/ml |
| dbacp06715 | P07 | VEPGLGADNSVVR | FLNA (Filamin A) fragment | Apoptosis inducing | MTT assay | U-2 OS | Bone Cancer | Relative viability = 0.96 at 50 μg/ml |
| dbacp06716 | P08 | NSNLVGAAHEELQQSR | Lamin A/C (LMNA) fragment | Apoptosis inducing | MTT assay | MG-63 | Bone Cancer | Relative viability = 0.92 at 50 μg/ml |
| dbacp06717 | P08 | NSNLVGAAHEELQQSR | Lamin A/C (LMNA) fragment | Apoptosis inducing | MTT assay | U-2 OS | Bone Cancer | Relative viability = 1.06 at 50 μg/ml |
| dbacp06718 | P09 | AAGTLYTYPENWR | Eukaryotic Translation Elongation Factor 1 Gamma (Eef1G) fragment | Apoptosis inducing | MTT assay | MG-63 | Bone Cancer | Relative viability = 0.85 at 50 μg/ml |
| dbacp06719 | P09 | AAGTLYTYPENWR | Eukaryotic Translation Elongation Factor 1 Gamma (Eef1G) fragment | Apoptosis inducing | MTT assay | U-2 OS | Bone Cancer | Relative viability = 1.07 at 50 μg/ml |
| dbacp06720 | P10 | FAAATGATPIAGR | 40S ribosomal protein fragment | Apoptosis inducing | MTT assay | MG-63 | Bone Cancer | Relative viability = 1.08 at 50 μg/ml |
| dbacp06721 | P10 | FAAATGATPIAGR | 40S ribosomal protein fragment | Apoptosis inducing | MTT assay | U-2 OS | Bone Cancer | Relative viability = 1.01 at 50 μg/ml |
| dbacp06735 | NKL-WT | KLKSKLMVVCNKIGLLKSLCRKFVKSH | Trematomus bernacchii | Apoptosis inducing | luciferase-based ATPlite assay | B16-F10 | Skin Cancer | ATP level = 0.753 ± 0.254 at 40 μM |
| dbacp06736 | NKL-MUT | KLKSKLMVVANKIGLLKSLARKFVKSH | Trematomus bernacchii | Apoptosis inducing | luciferase-based ATPlite assay | B16-F10 | Skin Cancer | ATP level = 0.023 ± 0.007 at 40 μM |
| dbacp06754 | 37-mer peptide | TKEQKEQIAKATGLTTKQVRNWYVQLNASIKVCMCSC | Synthetic | Apoptosis inducing | MTT assay | SNU-449 | Liver Cancer | IC50 = 76.4 ± 0.6015 μM |
| dbacp06755 | 37-mer peptide | TKEQKEQIAKATGLTTKQVRNWYVQLNASIKVCMCSC | Synthetic | Apoptosis inducing | MTT assay | HepG-2 | Liver Cancer | IC50 = 33.65 ± 1.09 μM |
| dbacp06756 | 37-mer peptide | TKEQKEQIAKATGLTTKQVRNWYVQLNASIKVCMCSC | Synthetic | Apoptosis inducing | MTT assay | SK-OV-3 | Ovarian cancer | IC50 = 27.45 ± 1.5085 μM |
| dbacp06757 | ATMP5 | THPPTTTTTTTTTTTYTAAPATTT | Synthetic Analog of ATMP1 | Apoptosis inducing | MTT assay | MDA-MB-231 | Breast Cancer | IC50 = 64.04 ± 0.021 μg /ml |
| dbacp06758 | ATMP1 | THPPTTTTTTTTTTTYTAAPATTT | Anabas testudineus | Apoptosis inducing | MTT assay | MDA-MB-231 | Breast Cancer | IC50 = 8.25 ± 0.14 μg/ml |
| dbacp06759 | p28 | LSTAADMQGVVTDGMASGLDKDYLKPDD | Pseudomonas aeruginosa | Apoptosis inducing | MTT assay | HT-29 | Colon Cancer | IC50 ~ 200 μg/ml |
| dbacp06760 | p28 | LSTAADMQGVVTDGMASGLDKDYLKPDD | Pseudomonas aeruginosa | Apoptosis inducing | MTT assay | CT-26 | Colorectal Cancer | IC50 ~ 150 μg/ml |
| dbacp06761 | RP7 | ATRQPNH | RAGE(receptor for advanced glycation end product) inhibitor | Apoptosis inducing | MTT assay | MDA-MB-231 | Breast Cancer | IC50 = 24.5 µM |
| dbacp06762 | RP7 | ATRQPNH | RAGE(receptor for advanced glycation end product) inhibitor | Apoptosis inducing | MTT assay | BT-549 | Breast Cancer | IC50 = 29.9 µM |
| dbacp06793 | CPSA-CPSC-L-ACAN | Not Available | Recombinant Fusion Peptide | Apoptosis inducing | MTT assay | HeLa | Cervical Cancer | IC50 = 63.15 μg/ml |
| dbacp06794 | CM11 | WKLFKKILKVL | Cecropin-Melittin Hybrid Peptide | Apoptosis inducing | MTT assay | Jurkat | Blood Cancer | Survival rate = 47% at 32 μg/ml |
| dbacp06795 | CM11 | WKLFKKILKVL | Cecropin-Melittin Hybrid Peptide | Apoptosis inducing | MTT assay | Raji | Blood Cancer | Survival rate = 51% at 32 μg/ml |
| dbacp06796 | LHRH-BinBC | QHWSYGLRPGGRGPKDAVRAVKGSALLPCIIVHDPNLNNSDKMKFNTYYLLEYKEYWHQLWSQIIPAHQTVKIQERTGISEVVQNSMIEDLNMYIGADFGMYFYLRSSGFKEQITRGLNRPLSQTTTQLGERVEEMEYYNSNDLDVRYVKYALAREFTLKRVNGEIVKNWVAVDYRMAGIQSYPNAPITNPLTLT | Synthetic | Apoptosis inducing | MTT assay | MCF-7 | Breast Cancer | IC50 = 10.96 μM |
| dbacp06797 | LHRH-BinBC | QHWSYGLRPGGRGPKDAVRAVKGSALLPCIIVHDPNLNNSDKMKFNTYYLLEYKEYWHQLWSQIIPAHQTVKIQERTGISEVVQNSMIEDLNMYIGADFGMYFYLRSSGFKEQITRGLNRPLSQTTTQLGERVEEMEYYNSNDLDVRYVKYALAREFTLKRVNGEIVKNWVAVDYRMAGIQSYPNAPITNPLTLT | Synthetic | Apoptosis inducing | LDH leakage assay | MCF-7 | Breast Cancer | 40% LDH efflux at 16 µM |
| dbacp06851 | WP1 | RLLRLMRLRMLLRM | Derived from RLL peptide | Apoptosis inducing | HDAC inhibition assay | HeLa | Cervical Cancer | IC50 = 0.310±0.064 µM |
| dbacp06852 | WP1 | RLLRLMRLRMLLRM | Derived from RLL peptide | Apoptosis inducing | Cell Viability assay | Huh-7 | Liver Cancer | IC50 = 43.74 ± 5.4 μM |
| dbacp06853 | WP1 | RLLRLMRLRMLLRM | Derived from RLL peptide | Apoptosis inducing | Cell Viability assay | HepG-2 | Liver Cancer | IC50 = 52.23 ± 0.9 μM |
| dbacp06854 | WP1 | RLLRLMRLRMLLRM | Derived from RLL peptide | Apoptosis inducing | Cell Viability assay | HT-29 | Colon Cancer | IC50 = 54.6 ± 2.1 μM |
| dbacp06855 | WP2 | RLLRLLRLRRLLRL | Derived from RLL peptide | Apoptosis inducing | HDAC inhibition assay | HeLa | Cervical Cancer | IC50 = 0.446±0.095 µM |
| dbacp06856 | WP2 | RLLRLLRLRRLLRL | Derived from RLL peptide | Apoptosis inducing | Cell Viability assay | Huh-7 | Liver Cancer | IC50 = 28.12 ± 1.5 μM |
| dbacp06857 | WP2 | RLLRLLRLRRLLRL | Derived from RLL peptide | Apoptosis inducing | Cell Viability assay | HepG-2 | Liver Cancer | IC50 = 34.05 ± 0.53 μM |
| dbacp06858 | WP2 | RLLRLLRLRRLLRL | Derived from RLL peptide | Apoptosis inducing | Cell Viability assay | HT-29 | Colon Cancer | IC50 = 42.6 ± 4.0 μM |
| dbacp06864 | AMP-WF3 | FLKSLWRGVKAIFNGARQGYKEHKN | Poecilia Mexicana fish | Apoptosis inducing | MTT assay | Jurkat | Blood Cancer | IC50 = 50 µM |
| dbacp06868 | LfcinB(21-25)Pal | RWQWRWQWR | LfcinB | Apoptosis inducing | MTT assay | MDA-MB-468 | Breast Cancer | IC50 = 72 µM |
| dbacp06869 | LfcinB(21-25)Pal | RWQWRWQWR | LfcinB | Apoptosis inducing | MTT assay | MDA-MB-231 | Breast Cancer | IC50 = 103 µM |
| dbacp06870 | LfcinB(21-25)Pal | RWQWRWQWR | LfcinB | Apoptosis inducing | MTT assay | MCF-7 | Breast Cancer | IC50 = 81 µM |
| dbacp06871 | RR-1-RR | RRWQWRWQWRR | Synthetic analogue of LfcinB(21-25)Pal | Apoptosis inducing | MTT assay | MCF-7 | Breast Cancer | IC50 = 58 µM |
| dbacp06872 | RR-1-RR | RRWQWRWQWRR | Synthetic analogue of LfcinB(21-25)Pal | Apoptosis inducing | MTT assay | MDA-MB-231 | Breast Cancer | IC50 = 67 µM |
| dbacp06873 | R-1-RR | RWQWRWQWRR | Synthetic analogue of LfcinB(21-25)Pal | Apoptosis inducing | MTT assay | MCF-7 | Breast Cancer | IC50 = 122 µM |
| dbacp06874 | R-1-RR | RWQWRWQWRR | Synthetic analogue of LfcinB(21-25)Pal | Apoptosis inducing | MTT assay | MDA-MB-231 | Breast Cancer | IC50 = 95 µM |
| dbacp06875 | RR-1-R | RRWQWRWQWR | Synthetic analogue of LfcinB(21-25)Pal | Apoptosis inducing | MTT assay | MCF-7 | Breast Cancer | IC50 = 68 µM |
| dbacp06876 | RR-1-R | RRWQWRWQWR | Synthetic analogue of LfcinB(21-25)Pal | Apoptosis inducing | MTT assay | MDA-MB-231 | Breast Cancer | IC50 = 73 µM |
| dbacp06877 | 1 | WQWRWQW | Synthetic analogue of LfcinB(21-25)Pal | Apoptosis inducing | MTT assay | MCF-7 | Breast Cancer | IC50 = 105 µM |
| dbacp06878 | 1 | WQWRWQW | Synthetic analogue of LfcinB(21-25)Pal | Apoptosis inducing | MTT assay | MDA-MB-231 | Breast Cancer | IC50 > 170 µM |
| dbacp06879 | R-1 | RWQWRWQW | Synthetic analogue of LfcinB(21-25)Pal | Apoptosis inducing | MTT assay | MCF-7 | Breast Cancer | IC50 = 58 µM |
| dbacp06880 | R-1 | RWQWRWQW | Synthetic analogue of LfcinB(21-25)Pal | Apoptosis inducing | MTT assay | MDA-MB-231 | Breast Cancer | IC50 > 150 µM |
| dbacp06881 | 1-R | WQWRWQWR | Synthetic analogue of LfcinB(21-25)Pal | Apoptosis inducing | MTT assay | MCF-7 | Breast Cancer | IC50 = 130 µM |
| dbacp06882 | 1-R | WQWRWQWR | Synthetic analogue of LfcinB(21-25)Pal | Apoptosis inducing | MTT assay | MDA-MB-231 | Breast Cancer | IC50 > 150 µM |
| dbacp06883 | trichoderin A | MDA-P-Cha-Aib-Aib-IV-Aib-Aib-AMAE | Trichoderma sp. fungus, strain 05FI48 | Apoptosis inducing | PrestoBlue assay | BxPC-3 | Pancreatic Cancer | IC50 = 0.4 μM |
| dbacp06884 | trichoderin A | MDA-P-Cha-Aib-Aib-IV-Aib-Aib-AMAE | Trichoderma sp. fungus, strain 05FI48 | Apoptosis inducing | CyQUANT Direct assay | PANC-1 | Pancreatic Cancer | IC50 = 0.3 μM |
| dbacp06885 | trichoderin A analogue 4 | P-Cha-Aib-Aib-IV-Aib-Aib-AMAE | Trichoderin A | Apoptosis inducing | PrestoBlue assay | BxPC-3 | Pancreatic Cancer | IC50 = 0.4 μM |
| dbacp06886 | trichoderin A analogue 12 | P-Cha-Aib-Aib-IV-Aib-Aib-AMAE | Trichoderin A | Apoptosis inducing | PrestoBlue assay | BxPC-3 | Pancreatic Cancer | IC50 > 1 μM |
| dbacp06887 | trichoderin A analogue 13 | P-Cha-Aib-Aib-IV-Aib-Aib-AMAE | Trichoderin A | Apoptosis inducing | PrestoBlue assay | BxPC-3 | Pancreatic Cancer | IC50 > 1 μM |
| dbacp06888 | trichoderin A analogue 14 | P-Cha-Aib-Aib-IV-Aib-Aib-AMAE | Trichoderin A | Apoptosis inducing | PrestoBlue assay | BxPC-3 | Pancreatic Cancer | IC50 = 0.6 μM |
| dbacp06889 | trichoderin A analogue 15 | P-Cha-Aib-Aib-IV-Aib-Aib-AMAE | Trichoderin A | Apoptosis inducing | PrestoBlue assay | BxPC-3 | Pancreatic Cancer | IC50 = 0.5 μM |
| dbacp06890 | trichoderin A analogue 16 | P-Cha-Aib-Aib-IV-Aib-Aib-AMAE | Trichoderin A | Apoptosis inducing | PrestoBlue assay | BxPC-3 | Pancreatic Cancer | IC50 = 0.4 μM |
| dbacp06891 | trichoderin A analogue 17 | P-Cha-Aib-Aib-IV-Aib-Aib-AMAE | Trichoderin A | Apoptosis inducing | PrestoBlue assay | BxPC-3 | Pancreatic Cancer | IC50 = 0.4 μM |
| dbacp06892 | trichoderin A analogue 18 | P-Cha-Aib-Aib-IV-Aib-Aib-AMAE | Trichoderin A | Apoptosis inducing | PrestoBlue assay | BxPC-3 | Pancreatic Cancer | IC50 = 0.2 μM |
| dbacp06893 | trichoderin A analogue 4 | P-Cha-Aib-Aib-IV-Aib-Aib-AMAE | Trichoderin A | Apoptosis inducing | CyQUANT Direct assay | PANC-1 | Pancreatic Cancer | IC50 = 0.5 μM |
| dbacp06894 | trichoderin A analogue 12 | P-Cha-Aib-Aib-IV-Aib-Aib-AMAE | Trichoderin A | Apoptosis inducing | CyQUANT Direct assay | PANC-1 | Pancreatic Cancer | IC50 > 9 μM |
| dbacp06895 | trichoderin A analogue 13 | P-Cha-Aib-Aib-IV-Aib-Aib-AMAE | Trichoderin A | Apoptosis inducing | CyQUANT Direct assay | PANC-1 | Pancreatic Cancer | IC50 = 6.0 μM |
| dbacp06896 | trichoderin A analogue 14 | P-Cha-Aib-Aib-IV-Aib-Aib-AMAE | Trichoderin A | Apoptosis inducing | CyQUANT Direct assay | PANC-1 | Pancreatic Cancer | IC50 = 1.8 μM |
| dbacp06897 | trichoderin A analogue 15 | P-Cha-Aib-Aib-IV-Aib-Aib-AMAE | Trichoderin A | Apoptosis inducing | CyQUANT Direct assay | PANC-1 | Pancreatic Cancer | IC50 = 0.9 μM |
| dbacp06898 | trichoderin A analogue 16 | P-Cha-Aib-Aib-IV-Aib-Aib-AMAE | Trichoderin A | Apoptosis inducing | CyQUANT Direct assay | PANC-1 | Pancreatic Cancer | IC50 = 0.5 μM |
| dbacp06899 | trichoderin A analogue 17 | P-Cha-Aib-Aib-IV-Aib-Aib-AMAE | Trichoderin A | Apoptosis inducing | CyQUANT Direct assay | PANC-1 | Pancreatic Cancer | IC50 = 0.6 μM |
| dbacp06900 | trichoderin A analogue 18 | P-Cha-Aib-Aib-IV-Aib-Aib-AMAE | Trichoderin A | Apoptosis inducing | CyQUANT Direct assay | PANC-1 | Pancreatic Cancer | IC50 = 0.2 μM |
| dbacp06901 | trichoderin A analogue 19 | P-Cha-Aib-Aib-IV-Aib-Aib-AMAE | Trichoderin A | Apoptosis inducing | CyQUANT Direct assay | PANC-1 | Pancreatic Cancer | IC50 = 0.2 μM |
| dbacp06902 | trichoderin A analogue 19 | MDA-P-AHMOD-Aib-Aib-IV-Aib-Aib-AMAE | Trichoderin A | Apoptosis inducing | PrestoBlue assay | BxPC-3 | Pancreatic Cancer | IC50 = 0.1 μM |
| dbacp06904 | LFcin17–30 | FKCRRWQWRMKKLG | Lectoferrin Peptide | Apoptosis inducing | MTT assay | HepG-2 | Liver Cancer | cell viability ~ 50% at 1 µM |
| dbacp06905 | LFcin17–30 | FKCRRWQWRMKKLG | Lectoferrin Peptide | Apoptosis inducing | MTT assay | Jurkat | Blood Cancer | cell viability ~ 70% at 20 µM |
| dbacp06906 | LFampin265–284 | DLIWKLLSKAQEKFGKNKSR | Lectoferrin Peptide | Apoptosis inducing | MTT assay | HepG-2 | Liver Cancer | cell viability ~ 50% at 1 µM |
| dbacp06907 | LFampin265–284 | DLIWKLLSKAQEKFGKNKSR | Lectoferrin Peptide | Apoptosis inducing | MTT assay | Jurkat | Blood Cancer | cell viability ~ 47% at 10 µM |
| dbacp06908 | LFchimera | FKCRRWQWRMKKLG-K-RSKNKGFKEQAKSLLKWILD | Synthetic - Lectoferrin chimera | Apoptosis inducing | MTT assay | HepG-2 | Liver Cancer | cell viability ~ 44% at 10 µM |
| dbacp06909 | LFchimera | FKCRRWQWRMKKLG-K-RSKNKGFKEQAKSLLKWILD | Synthetic - Lectoferrin chimera | Apoptosis inducing | MTT assay | Jurkat | Blood Cancer | cell viability ~ 8% at 20 µM |
| dbacp06917 | KM8 | KLLKINLKALAALAKKIL | Synthetic derivative of Mastoparan | Apoptosis inducing | Not Available | Not Available | Not Available | Not Available |
| dbacp06918 | KM8-Aib | KLLKINLK(Aib)LAALAKKIL | Synthetic derivative of KM8 | Apoptosis inducing | Not Available | Not Available | Not Available | Not Available |
| dbacp06941 | PS14 | PTECQVGTTCKVES | Aphanomyces invadans | Apoptosis inducing | MTT assay | Hep-2 | Larynx Cancer | IC50 = 21 µM |
| dbacp06942 | HTDT-6-2-3-2 | GPLGAGP | Enteromorpha prolifera | Apoptosis inducing | CCK-8 assay | NCI-H-460 | Lung Cancer | IC50 = 0.3686 ± 0.0935 mg/mL |
| dbacp06943 | HTDT-6-2-3-2 | GPLGAGP | Enteromorpha prolifera | Apoptosis inducing | CCK-8 assay | HepG-2 | Liver Cancer | IC50 = 1.2564 ± 0.0548 mg/mL |
| dbacp06944 | HTDT-6-2-3-2 | GPLGAGP | Enteromorpha prolifera | Apoptosis inducing | CCK-8 assay | A-549 | Lung Cancer | IC50 = 0.9867 ± 0.0857 mg/mL |
| dbacp06980 | Ponericin-W1 (11-25), At1 | KLLPSVVGLFKKKKQ | Synthetic | Apoptosis inducing | MTT assay | A-549 | Lung Cancer | IC50 > 100 µM |
| dbacp06981 | Ponericin-W1 (11-25), At1 | KLLPSVVGLFKKKKQ | Synthetic | Apoptosis inducing | MTT assay | HepG-2 | Liver Cancer | IC50 >100 µM |
| dbacp06982 | Ponericin-W1 (11-25) [P4K | KLLKKVVKLFKKKKK | Synthetic | Apoptosis inducing | MTT assay | A-549 | Lung Cancer | IC50 >100 µM |
| dbacp06983 | Ponericin-W1 (11-25) [P4K | KLLKKVVKLFKKKKK | Synthetic | Apoptosis inducing | MTT assay | HepG-2 | Liver Cancer | IC50 >100 µM |
| dbacp06984 | Ponericin-W1 (11-25) [P4K | KLLKKVVKLFKKLLK | Synthetic | Apoptosis inducing | MTT assay | A-549 | Lung Cancer | IC50 = 4.3 µM |
| dbacp06985 | Ponericin-W1 (11-25) [P4K | KLLKKVVKLFKKLLK | Synthetic | Apoptosis inducing | MTT assay | HepG-2 | Liver Cancer | IC50 = 2.2 µM |
| dbacp06986 | At4 | KLLKKLLKLLKKLLK | Synthetic | Apoptosis inducing | MTT assay | A-549 | Lung Cancer | IC50 = 7.2 µM |
| dbacp06987 | At4 | KLLKKLLKLLKKLLK | Synthetic | Apoptosis inducing | MTT assay | HepG-2 | Liver Cancer | IC50 = 2.5 µM |
| dbacp06988 | At5 | KIIKKIIKIIKKIIK | Synthetic | Apoptosis inducing | MTT assay | A-549 | Lung Cancer | IC50 = 3.6 µM |
| dbacp06989 | At5 | KIIKKIIKIIKKIIK | Synthetic | Apoptosis inducing | MTT assay | HepG-2 | Liver Cancer | IC50 = 1.5 µM |
| dbacp06990 | At6 | KVVKKVVKVVKKVVK | Synthetic | Apoptosis inducing | MTT assay | A-549 | Lung Cancer | IC50 > 100 µM |
| dbacp06991 | At6 | KVVKKVVKVVKKVVK | Synthetic | Apoptosis inducing | MTT assay | HepG-2 | Liver Cancer | IC50 = 70.8 µM |
| dbacp06992 | At7 | KIIKKIKKKIKKIIK | Synthetic | Apoptosis inducing | MTT assay | A-549 | Lung Cancer | IC50 = 10.3 µM |
| dbacp06993 | At7 | KIIKKIKKKIKKIIK | Synthetic | Apoptosis inducing | MTT assay | HepG-2 | Liver Cancer | IC50 = 8.8 µM |
| dbacp06994 | At8 | KLLKKLKKKLKKLLK | Synthetic | Apoptosis inducing | MTT assay | A-549 | Lung Cancer | IC50 = 13.4 µM |
| dbacp06995 | At8 | KLLKKLKKKLKKLLK | Synthetic | Apoptosis inducing | MTT assay | HepG-2 | Liver Cancer | IC50 = 8.9 µM |
| dbacp06996 | At9 | KVVKKVKKKVKKVVK | Synthetic | Apoptosis inducing | MTT assay | A-549 | Lung Cancer | IC50 = 100 µM |
| dbacp06997 | At9 | KVVKKVKKKVKKVVK | Synthetic | Apoptosis inducing | MTT assay | HepG-2 | Liver Cancer | IC50 = 51.7 µM |
| dbacp06998 | At10 | IKKIIKIIKKIIKKI | Synthetic | Apoptosis inducing | MTT assay | A-549 | Lung Cancer | IC50 = 4.4 µM |
| dbacp06999 | At10 | IKKIIKIIKKIIKKI | Synthetic | Apoptosis inducing | MTT assay | HepG-2 | Liver Cancer | IC50 = 3.2 µM |
| dbacp07000 | At11 | IIIKKIKKKIKKIII | Synthetic | Apoptosis inducing | MTT assay | A-549 | Lung Cancer | IC50 = 7.9 µM |
| dbacp07001 | At11 | IIIKKIKKKIKKIII | Synthetic | Apoptosis inducing | MTT assay | HepG-2 | Liver Cancer | IC50 = 7.6 µM |
| dbacp07002 | At12 | KIIIKIKKKIKIIIK | Synthetic | Apoptosis inducing | MTT assay | A-549 | Lung Cancer | IC50 = 14.0 µM |
| dbacp07003 | At12 | KIIIKIKKKIKIIIK | Synthetic | Apoptosis inducing | MTT assay | HepG-2 | Liver Cancer | IC50 = 13.4 µM |
| dbacp07986 | SmacN7-Arg8 fused peptide P4 | Ahx-AVPIAQK(KRRRRRRRRRE) | Synthetic | Apoptosis inducing | Cell Titer Blue Cell Viability assay | U-266 | Skin Cancer | Cell viability < 50% at 50 μM |
| dbacp07987 | SmacN7-Arg8 fused peptide P5 | Ahx-(KAVPIAQKE)RRRRRRRR | Synthetic | Apoptosis inducing | Cell Titer Blue Cell Viability assay | U-266 | Skin Cancer | Cell viability < 50% at 50 μM |
| dbacp07988 | SmacN7-Arg8 fused peptide P7 | Ahx-(KAVPIAQKE)GG(KRRRRRRRRE) | Synthetic | Apoptosis inducing | Cell Titer Blue Cell Viability assay | U-266 | Skin Cancer | Cell viability < 50% at 50 μM |
| dbacp08136 | Laterosporulin10 (LS10) | ACVNQCPDAIDRFIVKDKGCHGVEKKYYKQVYVACMNGQHLYCRTEGGPCQL | Brevibacillus sp. strain SKDU10 | Apoptosis inducing | MTT assay | MCF-7 | Breast Cancer | 40% cytotoxicity at 5 μM concentration |
| dbacp08137 | Laterosporulin10 (LS10) | ACVNQCPDAIDRFIVKDKGCHGVEKKYYKQVYVACMNGQHLYCRTEGGPCQL | Brevibacillus sp. strain SKDU10 | Apoptosis inducing | LDH leakage assay | MCF-7 | Breast Cancer | >80% LDH release at 15 μM |
| dbacp08138 | Laterosporulin10 (LS10) | ACVNQCPDAIDRFIVKDKGCHGVEKKYYKQVYVACMNGQHLYCRTEGGPCQL | Brevibacillus sp. strain SKDU10 | Apoptosis inducing | MTT assay | HEK-293T | Renal Cancer | 20% cytotoxicity 5 μM concentration |
| dbacp08139 | Laterosporulin10 (LS10) | ACVNQCPDAIDRFIVKDKGCHGVEKKYYKQVYVACMNGQHLYCRTEGGPCQL | Brevibacillus sp. strain SKDU10 | Apoptosis inducing | MTT assay | HT-1080 | Fibrosarcoma | 20% cytotoxicity 5 μM concentration |
| dbacp08140 | Laterosporulin10 (LS10) | ACVNQCPDAIDRFIVKDKGCHGVEKKYYKQVYVACMNGQHLYCRTEGGPCQL | Brevibacillus sp. strain SKDU10 | Apoptosis inducing | MTT assay | HeLa | Cervical Cancer | 20% cytotoxicity 5 μM concentration |
| dbacp08141 | Laterosporulin10 (LS10) | ACVNQCPDAIDRFIVKDKGCHGVEKKYYKQVYVACMNGQHLYCRTEGGPCQL | Brevibacillus sp. strain SKDU10 | Apoptosis inducing | LDH leakage assay | HeLa | Cervical Cancer | ~80% LDH release at 15 μM |
| dbacp08142 | Laterosporulin10 (LS10) | ACVNQCPDAIDRFIVKDKGCHGVEKKYYKQVYVACMNGQHLYCRTEGGPCQL | Brevibacillus sp. strain SKDU10 | Apoptosis inducing | MTT assay | H-1299 | Lung Cancer | 80% cytotoxicity 10 μM concentration |
| dbacp08143 | MccJ25-18-4 | GGAGHVPEYFVGIGTPISFYG-WxEAAYQrFL | Synthetic | Apoptosis inducing | MTT assay | MCF-7 | Breast Cancer | IC50 = 14.2 ± 1.5 μM |
| dbacp08144 | MccJ25-18-4 | GGAGHVPEYFVGIGTPISFYG-WxEAAYQrFL | Synthetic | Apoptosis inducing | MTT assay | MDA-MB-435 | Breast Cancer | IC50 = 20.0 ± 0.5 μM |
| dbacp08145 | MccJ25-18-4 | GGAGHVPEYFVGIGTPISFYG-WxEAAYQrFL | Synthetic | Apoptosis inducing | MTT assay | MDA-MB-435-MDR | Breast Cancer | IC50 = 25.0 ± 0.5 μM |