dbACP: A Comprehensive Database of Anti-Cancer Peptides

456 result(s) have been found!

Accession Name Sequence Source/Organism Mechanism Assay Type Cell Line Cancer Type Activity
dbacp00001 Citropin modified peptide-3 GLFAVIKKVASVIGGL Amphibian skin secretions Penetration and disruption of the membrane Sulforhodamine B assay Leukemia tumor cell line Leukemia cancer IC50 : 6 M
dbacp00010 Citropin modified peptide-5 GLFDVIKAVASVIGGL Amphibian skin secretions Penetration and disruption of the membrane Sulforhodamine B assay Leukemia tumor cell line Leukemia cancer IC50 : 5 M
dbacp00019 Citropin modified peptide-7 GLFDVIKKVAAVIGGL Amphibian skin secretions Penetration and disruption of the membrane Sulforhodamine B assay Leukemia tumor cell line Leukemia cancer IC50 : 5 M
dbacp00098 Citropin modified peptide-11 GLFDVIKKVASVIKGL Amphibian skin secretions Penetration and disruption of the membrane Sulforhodamine B assay Leukemia tumor cell line Leukemia cancer IC50 : 5 M
dbacp00107 Citropin modified peptide-13 GLFDVIKKVASVIKKL Amphibian skin secretions Penetration and disruption of the membrane Sulforhodamine B assay Leukemia tumor cell line Leukemia cancer IC50 : 5 M
dbacp00116 Citropin modified peptide-14 GLFDVIAKVASVIKKL Amphibian skin secretions Penetration and disruption of the membrane Sulforhodamine B assay Leukemia tumor cell line Leukemia cancer IC50 : 5 M
dbacp00150 Citropin modified peptide-15 GLFAVIKKVASVIKGL Amphibian skin secretions Penetration and disruption of the membrane Sulforhodamine B assay Leukemia tumor cell line Leukemia cancer IC50 : 5 M
dbacp00183 Citropin modified peptide-16 GLFAVIKKVASVIKKL Amphibian skin secretions Penetration and disruption of the membrane Sulforhodamine B assay Leukemia tumor cell line Leukemia cancer IC50 : 5 M
dbacp00217 Citropin modified peptide-17 GLFAVIKKVAAVIKKL Amphibian skin secretions Penetration and disruption of the membrane Sulforhodamine B assay Leukemia tumor cell line Leukemia cancer IC50 : 5 M
dbacp00252 Citropin modified peptide-18 GLFAVIKKVAAVIRRL Amphibian skin secretions Penetration and disruption of the membrane Sulforhodamine B assay Leukemia tumor cell line Leukemia cancer IC50 : 5 M
dbacp00261 Citropin modified peptide-19 GLFAVIKKVAKVIKKL Amphibian skin secretions Penetration and disruption of the membrane Sulforhodamine B assay Leukemia tumor cell line Leukemia cancer IC50 : 5 M
dbacp00270 Citropin modified peptide-22 GLFKVIKKVASVIGGL Amphibian skin secretions Penetration and disruption of the membrane Sulforhodamine B assay Leukemia tumor cell line Leukemia cancer IC50 : 5 M
dbacp00292 Citropin modified peptide-23 GLFKVIKKVAKVIKKL Amphibian skin secretions Penetration and disruption of the membrane Sulforhodamine B assay Leukemia tumor cell line Leukemia cancer IC50 : 5 M
dbacp00323 [C/U, G1K, L5Y, K8R]cGm KURRYUYRQRUVTYURGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay CRL-1739 Chronic myeloid Leukemia CC50 : 46.2 ± 7.6 μM
dbacp00328 [C/U, G1K, L5Y, K8R]cGm KURRYUYRQRUVTYURGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay MM96L Chronic myeloid Leukemia CC50 : 2.3 ± 0.2 μM
dbacp00333 [C/U, G1K, L5Y, K8R]cGm KURRYUYRQRUVTYURGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay HFF-1 Chronic myeloid Leukemia CC50 : 30.8 ± 2.0 μM
dbacp00338 [C/U, G1K, L5Y, K8R]cGm KURRYUYRQRUVTYURGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay HeLa Chronic myeloid Leukemia CC50 : 36.2 ± 2.8 μM
dbacp00343 [C/U, G1K, L5Y, K8R]cGm KURRYUYRQRUVTYURGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay MCF-7 Chronic myeloid Leukemia CC50 : 29.0 ± 3.7 μM
dbacp00348 [C/U, G1K, L5Y, K8R]cGm KURRYUYRQRUVTYURGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay K-562 Chronic myeloid Leukemia CC50 : 6.4 ± 0.6 μM
dbacp00353 [C/U, G1K, L5Y, K8R]cGm KURRYUYRQRUVTYURGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay HL-60 Chronic myeloid Leukemia CC50 : 33.3 ±7.4 μM
dbacp00358 [C/U, G1K, L5Y, K8R]cGm KURRYUYRQRUVTYURGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay PBMCs Chronic myeloid Leukemia CC50 : 9.5 ± 0.5 μM
dbacp00363 [C/U]cGm GURRLUYKQRUVTYURGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay CRL-1739 Chronic myeloid Leukemia CC50 : 51.0 ± 4.6 μM
dbacp00368 [C/U]cGm GURRLUYKQRUVTYURGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay MM96L Chronic myeloid Leukemia CC50 : 4.6 ± 0.2 μM
dbacp00373 [C/U]cGm GURRLUYKQRUVTYURGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay HFF-1 Chronic myeloid Leukemia CC50 : 15.6 ± 3.6 μM
dbacp00378 [C/U]cGm GURRLUYKQRUVTYURGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay HeLa Chronic myeloid Leukemia CC50 : > 64 μM
dbacp00383 [C/U]cGm GURRLUYKQRUVTYURGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay MCF-7 Chronic myeloid Leukemia CC50 : 37.5 ± 3.3 μM
dbacp00388 [C/U]cGm GURRLUYKQRUVTYURGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay K-562 Chronic myeloid Leukemia CC50 : 1.4 ± 0.2 μM
dbacp00393 [C/U]cGm GURRLUYKQRUVTYURGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay HL-60 Chronic myeloid Leukemia CC50 : 38.5 ± 4.8 μM
dbacp00398 [C/U]cGm GURRLUYKQRUVTYURGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay PBMCs Chronic myeloid Leukemia CC50 : 15.5 ± 0.8 μM
dbacp00404 [D-P L-P]cGm GCRRLCYKQRCVTYCRGpPR Synthetic construct Target and destroy tumor cell membranes Cell viability assay CRL-1739 Chronic myeloid Leukemia CC50 : 22.5 ± 3.3 μM
dbacp00409 [D-P L-P]cGm GCRRLCYKQRCVTYCRGpPR Synthetic construct Target and destroy tumor cell membranes Cell viability assay MM96L Chronic myeloid Leukemia CC50 : 3.0 ± 0.1 μM
dbacp00414 [D-P L-P]cGm GCRRLCYKQRCVTYCRGpPR Synthetic construct Target and destroy tumor cell membranes Cell viability assay HFF-1 Chronic myeloid Leukemia CC50 : 14.9 ± 0.8 μM
dbacp00419 [D-P L-P]cGm GCRRLCYKQRCVTYCRGpPR Synthetic construct Target and destroy tumor cell membranes Cell viability assay HeLa Chronic myeloid Leukemia CC50 : 51.5 ± 3.9 μM
dbacp00424 [D-P L-P]cGm GCRRLCYKQRCVTYCRGpPR Synthetic construct Target and destroy tumor cell membranes Cell viability assay K-562 Chronic myeloid Leukemia CC50 : 3.9 ± 0.2 μM
dbacp00429 [D-P L-P]cGm GCRRLCYKQRCVTYCRGpPR Synthetic construct Target and destroy tumor cell membranes Cell viability assay PBMCs Chronic myeloid Leukemia CC50 : 14.1 ± 0.9 μM
dbacp00441 [G1K, K8R]cGm KCRRLCYRQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay CRL-1739 Chronic myeloid Leukemia CC50 : 19.5 ± 0.5 μM
dbacp00446 [G1K, K8R]cGm KCRRLCYRQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay MM96L Chronic myeloid Leukemia CC50 : 1.7 ± 0.1 μM
dbacp00451 [G1K, K8R]cGm KCRRLCYRQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay HFF-1 Chronic myeloid Leukemia CC50 : 9.0 ± 0.5 μM
dbacp00456 [G1K, K8R]cGm KCRRLCYRQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay HeLa Chronic myeloid Leukemia CC50 : 44.2 ± 2.2 μM
dbacp00461 [G1K, K8R]cGm KCRRLCYRQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay MCF-7 Chronic myeloid Leukemia CC50 : 6.7 ± 0.7 μM
dbacp00466 [G1K, K8R]cGm KCRRLCYRQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay K-562 Chronic myeloid Leukemia CC50 : 2.1 ± 0.2 μM
dbacp00471 [G1K, K8R]cGm KCRRLCYRQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay HL-60 Chronic myeloid Leukemia CC50 : 9.0 ± 1.1μM
dbacp00476 [G1K, K8R]cGm KCRRLCYRQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay PBMCs Chronic myeloid Leukemia CC50 : 5.1 ± 0.3 μM
dbacp00481 [G1K, L5Y, K8R]cGm KCRRYCYRQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay CRL-1739 Chronic myeloid Leukemia CC50 : 26.5 ± 2.4 μM
dbacp00486 [G1K, L5Y, K8R]cGm KCRRYCYRQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay MM96L Chronic myeloid Leukemia CC50 : 2.0 ± 0.1 μM
dbacp00491 [G1K, L5Y, K8R]cGm KCRRYCYRQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay HFF-1 Chronic myeloid Leukemia CC50 : 14.7 ± 1.5 μM
dbacp00496 [G1K, L5Y, K8R]cGm KCRRYCYRQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay HeLa Chronic myeloid Leukemia CC50 : 20.9 ± 1.4 μM
dbacp00501 [G1K, L5Y, K8R]cGm KCRRYCYRQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay MCF-7 Chronic myeloid Leukemia CC50 : 15.2 ± 1.9 μM
dbacp00506 [G1K, L5Y, K8R]cGm KCRRYCYRQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay K-562 Chronic myeloid Leukemia CC50 : 1.3 ± 0.1 μM
dbacp00511 [G1K, L5Y, K8R]cGm KCRRYCYRQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay HL-60 Chronic myeloid Leukemia CC50 : 15.7 ±1.1μM
dbacp00516 [G1K, L5Y, K8R]cGm KCRRYCYRQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay PBMCs Chronic myeloid Leukemia CC50 : 10.4 ± 1.0 μM
dbacp00521 [K8R]cGm GCRRLCYRQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay CRL-1739 Chronic myeloid Leukemia CC50 : 29.4 ± 1.1 μM
dbacp00526 [K8R]cGm GCRRLCYRQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay MM96L Chronic myeloid Leukemia CC50 : 5.0 ± 0.3 μM
dbacp00531 [K8R]cGm GCRRLCYRQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay HFF-1 Chronic myeloid Leukemia CC50 : 34.5 ± 3.6 μM
dbacp00536 [K8R]cGm GCRRLCYRQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay HeLa Chronic myeloid Leukemia CC50 : 39.4 ± 2.6 μM
dbacp00541 [K8R]cGm GCRRLCYRQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay K-562 Chronic myeloid Leukemia CC50 : 3.1 ± 0.1 μM
dbacp00546 [L5W]cGm GCRRWCYKQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay CRL-1739 Chronic myeloid Leukemia CC50 : 18.3 ± 1.4 μM
dbacp00551 [L5W]cGm GCRRWCYKQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay MM96L Chronic myeloid Leukemia CC50 : 4.0 ± 0.1 μM
dbacp00556 [L5W]cGm GCRRWCYKQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay HFF-1 Chronic myeloid Leukemia CC50 : 25.0 ± 2.9 μM
dbacp00561 [L5W]cGm GCRRWCYKQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay HeLa Chronic myeloid Leukemia CC50 : 17.1 ± 0.7 μM
dbacp00566 [L5W]cGm GCRRWCYKQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay K-562 Chronic myeloid Leukemia CC50 : 1.0 ± 0.1 μM
dbacp00572 [L9]-P18 KWKLFKKILKFLHLAKKF Ceropin A Cell membrane disintegration MTT/MTS assay K-562 Leukemia cancer IC50 : 3 µM
dbacp00574 [R4A, R18A]cGm GCRALCYKQRCVTYCRGA Synthetic construct Target and destroy tumor cell membranes Cell viability assay CRL-1739 Chronic myeloid Leukemia CC50 : > 64 μM
dbacp00579 [R4A, R18A]cGm GCRALCYKQRCVTYCRGA Synthetic construct Target and destroy tumor cell membranes Cell viability assay MM96L Chronic myeloid Leukemia CC50 : 10.3 ± 1.1 μM
dbacp00584 [R4A, R18A]cGm GCRALCYKQRCVTYCRGA Synthetic construct Target and destroy tumor cell membranes Cell viability assay HFF-1 Chronic myeloid Leukemia CC50 : 51.2 ± 4.0 μM
dbacp00589 [R4A, R18A]cGm GCRALCYKQRCVTYCRGA Synthetic construct Target and destroy tumor cell membranes Cell viability assay HeLa Chronic myeloid Leukemia CC50 : > 64 μM
dbacp00594 [R4A, R18A]cGm GCRALCYKQRCVTYCRGA Synthetic construct Target and destroy tumor cell membranes Cell viability assay MCF-7 Chronic myeloid Leukemia CC50 : 48.4 ± 0.7 μM
dbacp00599 [R4A, R18A]cGm GCRALCYKQRCVTYCRGA Synthetic construct Target and destroy tumor cell membranes Cell viability assay K-562 Chronic myeloid Leukemia CC50 : 11.5 ± 0.6 μM
dbacp00604 [R4A, R18A]cGm GCRALCYKQRCVTYCRGA Synthetic construct Target and destroy tumor cell membranes Cell viability assay HL-60 Chronic myeloid Leukemia CC50 : 34.1 ± 3.9 μM
dbacp00609 [R4A, R18A]cGm GCRALCYKQRCVTYCRGA Synthetic construct Target and destroy tumor cell membranes Cell viability assay PBMCs Chronic myeloid Leukemia CC50 : 30.8 ± 2.5 μM
dbacp00620 [S9]-P18 KWKLFKKISKFLHLAKKF Ceropin A Cell membrane disintegration MTT/MTS assay K-562 Leukemia cancer IC50 : 3 µM
dbacp00622 [Y14W]cGm GCRRLCYKQRCVTWCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay CRL-1739 Chronic myeloid Leukemia CC50 : 30.3 ± 1.1 μM
dbacp00627 [Y14W]cGm GCRRLCYKQRCVTWCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay MM96L Chronic myeloid Leukemia CC50 : 4.0 ± 0.1 μM
dbacp00632 [Y14W]cGm GCRRLCYKQRCVTWCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay HFF-1 Chronic myeloid Leukemia CC50 : 68.4 ± 9.6 μM
dbacp00637 [Y14W]cGm GCRRLCYKQRCVTWCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay HeLa Chronic myeloid Leukemia CC50 : 50.4 ± 2.4 μM
dbacp00642 [Y14W]cGm GCRRLCYKQRCVTWCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay K-562 Chronic myeloid Leukemia CC50 : 2.7 ± 0.1 μM
dbacp00647 [Y7W, K8R, Y14W]cGm GCRRLCWRQRCVTWCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay CRL-1739 Chronic myeloid Leukemia CC50 : 31.6 ± 1.3 μM
dbacp00652 [Y7W, K8R, Y14W]cGm GCRRLCWRQRCVTWCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay MM96L Chronic myeloid Leukemia CC50 : 5.4 ± 0.3 μM
dbacp00657 [Y7W, K8R, Y14W]cGm GCRRLCWRQRCVTWCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay HFF-1 Chronic myeloid Leukemia CC50 : 31.3 ± 2.6 μM
dbacp00662 [Y7W, K8R, Y14W]cGm GCRRLCWRQRCVTWCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay HeLa Chronic myeloid Leukemia CC50 : 41.0 ± 4.2 μM
dbacp00667 [Y7W, K8R, Y14W]cGm GCRRLCWRQRCVTWCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay MCF-7 Chronic myeloid Leukemia CC50 : 15.1 ± 1.4 μM
dbacp00672 [Y7W, K8R, Y14W]cGm GCRRLCWRQRCVTWCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay K-562 Chronic myeloid Leukemia CC50 : 3.9 ± 0.1 μM
dbacp00677 [Y7W]cGm GCRRLCWKQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay CRL-1739 Chronic myeloid Leukemia CC50 : 23.3 ± 0.4 μM
dbacp00682 [Y7W]cGm GCRRLCWKQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay MM96L Chronic myeloid Leukemia CC50 : 5.1 ± 0.3 μM
dbacp00687 [Y7W]cGm GCRRLCWKQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay HFF-1 Chronic myeloid Leukemia CC50 : 39.7 ± 3.8 μM
dbacp00692 [Y7W]cGm GCRRLCWKQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay HeLa Chronic myeloid Leukemia CC50 : > 64 μM
dbacp00697 [Y7W]cGm GCRRLCWKQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay K-562 Chronic myeloid Leukemia CC50 : 3.9 ± 0.2 μM
dbacp00701 072RB DMRPEIYI(Aib)QELRRIGDAFN(Aib)YRQIKIWFQNRRMKWKK BH3-only, Direct activators, BIM analogues Inducing apoptosis Not specified Jurkat Leukemia Not found
dbacp00702 072RB DMRPEIYI(Aib)QELRRIGDAFN(Aib)YRQIKIWFQNRRMKWKK BH3-only, Direct activators, BIM analogues Inducing apoptosis Not specified Namalwa Leukemia Not found
dbacp00703 072RB DMRPEIYI(Aib)QELRRIGDAFN(Aib)YRQIKIWFQNRRMKWKK BH3-only, Direct activators, BIM analogues Inducing apoptosis Not specified U937 Leukemia Not found
dbacp00718 2XAkt-in VTDHPDRLWAWEKGGGVTDHPDRLWAWEK Not found Inducing apoptosis Cell death assay T4 Leukemia Not found
dbacp00951 ABP-dHC-Cecropin A RWKIFKKIERVGQNVRDGIIKAGPAIQVLGTAKALGK Synthetic construct Apoptosis inducing MTT assay K562 cells Leukemia IC50 : 349.5 μM
dbacp00952 ABP-dHC-Cecropin A RWKIFKKIERVGQNVRDGIIKAGPAIQVLGTAKALGK Synthetic construct Apoptosis inducing MTT assay U937 cells Leukemia IC50 : 303.2 μM
dbacp00953 ABP-dHC-Cecropin A RWKIFKKIERVGQNVRDGIIKAGPAIQVLGTAKALGK Synthetic construct Apoptosis inducing MTT assay THP-1 cells Leukemia IC50 : 228.5 μM
dbacp00954 ABP-dHC-Cecropin A-K RWKIFKKIERVGQNVRDGIIKAGKAIQVLGTAKALGK Synthetic construct Apoptosis inducing MTT assay K562 cells Leukemia IC50 : 349.5 μM
dbacp00955 ABP-dHC-Cecropin A-K RWKIFKKIERVGQNVRDGIIKAGKAIQVLGTAKALGK Synthetic construct Apoptosis inducing MTT assay U937 cells Leukemia IC50 : 303.2 μM
dbacp00956 ABP-dHC-Cecropin A-K RWKIFKKIERVGQNVRDGIIKAGKAIQVLGTAKALGK Synthetic construct Apoptosis inducing MTT assay THP-1 cells Leukemia IC50 : 228.5 μM
dbacp00992 Akt-in AVTDHPDRLWAWEKF Not found Inducing apoptosis Co-immunoprecipitation, GST Pull-down,GST Competition, In Vitro Akt Kinase, PKA Kinase, In Vitro PDK1 Kinase, PtdIns(3,4,5)P3 Lipid-Protein Pull-down, Proliferation assay, Cell Death assay and Mitochondrial Permeability Transition assay T4 T-cell Leukemia Not found
dbacp01000 Alloferon 1 HGVSGHGQHGVHG Blow fly Immune modulation Cytotoxicity assay P388 Murine leukemia Activity : 25 µg
dbacp01002 Alloferon 2 GVSGHGQHGVHG Blue blowfly Immune modulation Cytotoxicity assay P388 Murine leukemia Activity : 25 µg
dbacp01004 Alloferon-1 HGVSGHGHQHGVHG Blue blowfly Immune modulation Anti-tumor activity assay P388 Murine leukemia Not found
dbacp01005 Alloferon-1 [Cleaved into: Alloferon-2] HGVSGHGQHGVHG Blue blowfly Immune modulation Cytotoxicity assay P388 Murine leukemia Activity : 25 µg
dbacp01172 Antp-LP4 RQIKIWFQNRRMKWKKSWTWEKKLETAVNLAWTAGNSNKWTWK VDAC1(voltage-dependent anion channel1) Apoptosis inducing Not specified CLL Leukemia IC50 : 0.7 ± 0.1 µM
dbacp01173 Antp-LP4 RQIKIWFQNRRMKWKKSWTWEKKLETAVNLAWTAGNSNKWTWK VDAC1(voltage-dependent anion channel1) Apoptosis inducing Not specified MEC-1 Leukemia IC50 : 2.5 ± 0.1 µM
dbacp01212 ATP-binding cassette sub-family C member 3 MDALCGSGELGSKFWDSNLSVHTENPDLTPCFQNSLLAWVPCIYLWVALPCYLLYLRHHCRGYIILSHLSKLKMVLGVLLWCVSWADLFYSFHGLVHGRAPAPVFFVTPLVVGVTMLLATLLIQYERLQGVQSSGVLIIFWFLCVVCAIVPFRSKILLAKAEGEISDPFRFTTFYIHFALVLSALILACFREKPPFFSAKNVDPNPYPETSAGFLSRLFFWWFTKMAIYGYRHPLEEKDLWSLKEEDRSQMVVQQLLEAWRKQEKQTARHKASAAPGKNASGEDEVLLGARPRPRKPSFLKALLATFGSSFLISACFKLIQDLLSFINPQLLSILIRFISNPMAPSWWGFLVAGLMFLCSMMQSLILQHYYHYIFVTGVKFRTGIMGVIYRKALVITNSVKRASTVGEIVNLMSVDAQRFMDLAPFLNLLWSAPLQIILAIYFLWQNLGPSVLAGVAFMVLLIPLNGAVAVKMRAFQVKQMKLKDSRIKLMSEILNGIKVLKLYAWEPSFLKQVEGIRQGELQLLRTAAYLHTTTTFTWMCSPFLVTLITLWVYVYVDPNNVLDAEKAFVSVSLFNILRLPLnMLPQLISNLTQASVSLKRIQQFLSQEELDPQSVERKTISPGYAITIHSGTFTWAQDLPPTLHSLDIQVPKGALVAVVGPVGCGKSSLVSALLGEMEKLEGKVHMKGSVAYVPQQAWIQNCTLQENVLFGKALNPKRYQQTLEACALLADLEMLPGGDQTEIGEKGINLSGGQRQRVSLARAVYSDADIFLLDDPLSAVDSHVAKHIFDHVIGPEGVLAGKTRVLVTHGISFLPQTDFIIVLADGQVSEMGPYPALLQRNGSFANFLCNYAPDEDQGHLEDSWTALEGAEDKEALLIEDTLSNHTDLTDNDPVTYVVQKQFMRQLSALSSDGEGQGRPVPRRHLGPSEKVQVTEAKADGALTQEEKAAIGTVELSVFWDYAKAVGLCTTLAICLLYVGQSAAAIGANVWLSAWTNDAMADSRQNNTSLRLGVYAALGILQGFLVMLAAMAMAAGGIQAARVLHQALLHNKIRSPQSFFDTTPSGRILNCFSKDIYVVDEVLAPVILMLLNSFFNAISTLVVIMASTPLFTVVILPLAVLYTLVQRFYAATSRQLKRLESVSRSPIYSHFSETVTGASVIRAYNRSRDFEIISDTKVDANQRSCYPYIISNRWLSIGVEFVGNCVVLFAALFAVIGRSSLNPGLVGLSVSYSLQVTFALNWMIRMMSDLESNIVAVERVKEYSKTETEAPWVVEGSRPPEGWPPRGEVEFRNYSVRYRPGLDLVLRDLSLHVHGGEKVGIVGRTGAGKSSMTLCLFRILEAAKGEIRIDGLNVADIGLHDLRSQLTIIPQDPILFSGTLRMNLDPFGSYSEEDIWWALELSHLHTFVSSQPAGLDFQCSEGGENLSVGQRQLVCLARALLRKSRILVLDEATAAIDLETDNLIQATIRTQFDTCTVLTIAHRLNTIMDYTRVLVLDKGVVAEFDSPANLIAARGIFYGMARDAGLA Human Antiproliferative effect Formate dehydrogenase–coupled PDF assay, Thymidine incorporation assay HL60 Leukemia cells IC50 ± SD : 9.3 ± 2.9μM
dbacp01216 ATP-binding cassette sub-family C member 5 MKDIDIGKEYIIPSPGYRSVRERTSTSGTHRDREDSKFRRTRPLECQDALETAARAEGLSLDASMHSQLRILDEEHPKGKYHHGLSALKPIRTTSKHQHPVDNAGLFSCMTFSWLSSLARVAHKKGELSMEDVWSLSKHESSDVNCRRLERLWQEELNEVGPDAASLRRVVWIFCRTRLILSIVCLMITQLAGFSGPAFMVKHLLEYTQATESNLQYSLLLVLGLLLTEIVRSWSLALTWALNYRTGVRLRGAILTMAFKKILKLKNIKEKSLGELINICSNDGQRMFEAAAVGSLLAGGPVVAILGMIYNVIILGPTGFLGSAVFILFYPAMMFASRLTAYFRRKCVAATDERVQKMNEVLTYIKFIKMYAWVKAFSQSVQKIREEERRILEKAGYFQSITVGVAPIVVVIASVVTFSVHMTLGFDLTAAQAFTVVTVFNSMTFALKVTPFSVKSLSEASVAVDRFKSLFLMEEVHMIKNKPASPHIKIEMKNATLAWDSSHSSIQNSPKLTPKMKKDKRASRGKKEKVRQLQRTEHQAVLAEQKGHLLLDSDERPSPEEEEGKHIHLGHLRLQRTLHSIDLEIQEGKLVGICGSVGSGKTSLISAILGQMTLLEGSIAISGTFAYVAQQAWILNATLRDNILFGKEYDEERYNSVLNSCCLRPDLAILPSSDLTEIGERGANLSGGQRQRISLARALYSDRSIYILDDPLSALDAHVGNHIFNSAIRKHLKSKTVLFVTHQLQYLVDCDEVIFMKEGCITERGTHEELMNLNGDYATIFNNLLLGETPPVEINSKKETSGSQKKSQDKGPKTGSVKKEKAVKPEEGQLVQLEEKGQGSVPWSVYGVYIQAAGGPLAFLVIMALFMLNVGSTAFSTWWLSYWIKQGSGNTTVTRGNETSVSDSMKDNPHMQYYASIYALSMAVMLILKAIRGVVFVKGTLRASSRLHDELFRRILRSPMKFFDTTPTGRILNRFSKDMDEVDVRLPFQAEMFIQNVILVFFCVGMIAGVFPWFLVAVGPLVILFSVLHIVSRVLIRELKRLDNITQSPFLSHITSSIQGLATIHAYNKGQEFLHRYQELLDDNQAPFFLFTCAMRWLAVRLDLISIALITTTGLMIVLMHGQIPPAYAGLAISYAVQLTGLFQFTVRLASETEARFTSVERINHYIKTLSLEAPARIKNKAPSPDWPQEGEVTFENAEMRYRENLPLVLKKVSFTIKPKEKIGIVGRTGSGKSSLGMALFRLVELSGGCIKIDGVRISDIGLADLRSKLSIIPQEPVLFSGTVRSNLDPFNQYTEDQIWDALERTHMKECIAQLPLKLESEVMENGDNFSVGERQLLCIARALLRHCKILILDEATAAMDTETDLLIQETIREAFADCTMLTIAHRLHTVLGSDRIMVLAQGQVVEFDTPSVLLSNDSSRFYAMFAAAENKVAVKG Human Antiproliferative effect Formate dehydrogenase–coupled PDF assay, Thymidine incorporation assay HL60 Leukemia IC50 ± SD : 9.3 ± 2.9 μM
dbacp01252 Aurein 3.1 GLFDIVKKIAGHIAGSI Southern bell frog, Australia Cell membrane disruption Not specified Leukemia tumor cell line Leukemia cancer LC50 : 10 µM
dbacp01261 Aurein 3.1 GLFDIVKKIAGHIAGSI Southern bell frog, Australia Cell membrane disruption Not specified Leukemia tumor cell line Leukemia cancer LC50 : 10 µM
dbacp01271 Aurein 3.2 GLFDIVKKIAGHIASSI Southern bell frog, Australia Cell membrane disruption Not specified Leukemia tumor cell line Leukemia cancer LC50 : 10 µM
dbacp01281 Aurein 3.3 GLFDIVKKIAGHIVSSI Southern bell frog, Australia Cell membrane disruption Not specified Leukemia tumor cell line Leukemia cancer LC50 : 10-100 µM
dbacp01292 Aurein-1.3 GLFDIIKKIAESF Southern bell frog Cell membrane disintegration One-dose and five-dose assay MOLT-4 Leukemia IC50 : 4-5 μM
dbacp01329 Aurein-2.5 GLFDIVKKVVGAFGSL Green and golden bell frog Cell membrane disintegration One-dose and five-dose assay K-562 Leukemia IC50 : 4-5 μM
dbacp01347 Aurein-2.7 GLFDIAKKVIGVIGSL Southern bell frog Cell membrane disintegration One-dose and five-dose assay RPMI-8226 Leukemia IC50 : 4-5 μM
dbacp01356 Aurein-2.7 GLFDIVKKIAGHIVSSI Southern bell frog Cell membrane disintegration One-dose and five-dose assay SR Leukemia IC50 : 4-5 μM
dbacp01358 Aurein-3.1 [Cleaved into: Aurein-3.1.1; Aurein-3.1.2] GLFDIVKKIAGHIAGSI Southern bell frog Cell membrane disintegration One-dose and five-dose assay CCRF-CEM Leukemia IC50 : 4-5 μM
dbacp01371 Aurein-3.2 GLFDIVKKIAGHIASSI Southern bell frog Cell membrane disintegration One-dose and five-dose assay HL-60(TB) Leukemia IC50 : 4-5 μM
dbacp01406 Aurein1.2 GLFDIIKKIAESF Southern bell frog Cell membrane disruption Not specified Leukemia tumor cell line Leukemia cancer LC50 : 10-100 µM
dbacp01415 Aurein2.5 GLFDIVKKVVGAFGSL Southern bell frog Cell membrane disruption Not specified Leukemia tumor cell line Leukemia cancer LC50 : 10-100 µM
dbacp01424 Aurein2.6 GLFDIAKKVIGVIGSL Southern bell frog Cell membrane disruption Not specified Leukemia tumor cell line Leukemia cancer LC50 : 10-100 µM
dbacp01605 BIM RPEIWIAQELRRIGDEFNAYYAR BH3-only, Direct activators, BIM analogues Inducing apoptosis Not specified Not found Leukemia Not found
dbacp01712 BIM FA1 RPEIWIAQELRRAGDVLNAYYAR BH3-only, Direct activators, BIM analogues Inducing apoptosis Not specified Not found Leukemia Not found
dbacp01714 BIM FD1 RPEIWLAQYLRRLGDQINAYYAR BH3-only, Direct activators, BIM analogues Inducing apoptosis Not specified Not found Leukemia Not found
dbacp01716 BIM FD2 RPEIWMAQVLRRFGDLLNAYYAR BH3-only, Direct activators, BIM analogues Inducing apoptosis Not specified Not found Leukemia Not found
dbacp01718 BIM FW1 RPEIWIAQGLRRIGDTWNAYYAR BH3-only, Direct activators, BIM analogues Inducing apoptosis Not specified Not found Leukemia Not found
dbacp01834 Bim-BH3W89Y DMRPEIYIAQELRRIGDEFNAY BH3-only, Direct activators, BIM analogues Inducing apoptosis Not specified Jurkat Leukemia Not found
dbacp01835 Bim-BH3W89Y DMRPEIYIAQELRRIGDEFNAY BH3-only, Direct activators, BIM analogues Inducing apoptosis Not specified Namalwa Leukemia Not found
dbacp01836 Bim-BH3W89Y DMRPEIYIAQELRRIGDEFNAY BH3-only, Direct activators, BIM analogues Inducing apoptosis Not specified U937 Leukemia Not found
dbacp01837 Bim-BH3YA2Aib DMRPEIYI(Aib)QELRRIGDAFN(Aib)Y BH3-only, Direct activators, BIM analogues Inducing apoptosis Not specified Jurkat Leukemia Not found
dbacp01838 Bim-BH3YA2Aib DMRPEIYI(Aib)QELRRIGDAFN(Aib)Y BH3-only, Direct activators, BIM analogues Inducing apoptosis Not specified Namalwa Leukemia Not found
dbacp01839 Bim-BH3YA2Aib DMRPEIYI(Aib)QELRRIGDAFN(Aib)Y BH3-only, Direct activators, BIM analogues Inducing apoptosis Not specified U937 Leukemia Not found
dbacp01840 BIRD-2 (Bcl-2 IP3R disrupter 2) RKKRRQRRRGGNVYTEIKCNSLLPLAAIVRV Not found Inducing apoptosis MTT assay DLBCL Leukemia Not found
dbacp01841 BIRD-2 (Bcl-2 IP3R disrupter 2) RKKRRQRRRGGNVYTEIKCNSLLPLAAIVRV Not found Inducing apoptosis MTT assay CLL Leukemia Not found
dbacp01913 BpirLAAO-I ADDKNPLEEFRETNYEVFLEIAKNGLKATSNPKRVVIVGAGMAGLSAAY Venom base Inducing apoptosis MTT assay Jurkat Acute T cell Leukemia Not found
dbacp01959 Brevinin-2R KLKNFAKGVAQSLLNKASCKLSGQC Skin, Marsh frog, Europe Activates the lysosomal-mitochondrial death pathway; Involves autophagy-like cell death MTT-assay Jurkat T-cell Leukemia LD50 : 10 – 15 μg/ml
dbacp01960 Brevinin-2R KLKNFAKGVAQSLLNKASCKLSGQC Skin, Marsh frog, Europe Activates the lysosomal-mitochondrial death pathway; Involves autophagy-like cell death MTT-assay Jurkat T-cell Leukemia LD50 : 20 – 25 μg/ml
dbacp01961 Brevinin-2R KLKNFAKGVAQSLLNKASCKLSGQC Skin, Marsh frog, Europe Activates the lysosomal-mitochondrial death pathway; Involves autophagy-like cell death MTT-assay Jurkat T-cell Leukemia LD50 : 30 – 40 μg/ml
dbacp01980 Brevinin-2R KLKNFAKGVAQSLLNKASCKLSGQC Skin, Marsh frog, Europe Activates the lysosomal-mitochondrial death pathway; Involves autophagy-like cell death MTT-assay Jurkat T-cell Leukemia LD50 : 20 – 25 µg/mll
dbacp01989 Buforin IIb RAGLQFPVGRLLRRLLRRLLR Histone H2A Inducing mitochondria-dependent apoptosis MTT/MTS assay CCRF-CEM Leukemia cancer IC50 : 14.7 µg/ml
dbacp01990 Buforin IIb RAGLQFPVGRLLRRLLRRLLR Histone H2A Inducing mitochondria-dependent apoptosis MTT/MTS assay HL-60 Leukemia cancer IC50 : 11.3 µg/ml
dbacp01991 Buforin IIb RAGLQFPVGRLLRRLLRRLLR Histone H2A Inducing mitochondria-dependent apoptosis MTT/MTS assay K-562 Leukemia cancer IC50 : 8.2 µg/ml
dbacp01992 Buforin IIb RAGLQFPVGRLLRRLLRRLLR Histone H2A Inducing mitochondria-dependent apoptosis MTT/MTS assay MOLT-4 Leukemia cancer IC50 : 17 µg/ml
dbacp01993 Buforin IIb RAGLQFPVGRLLRRLLRRLLR Histone H2A Inducing mitochondria-dependent apoptosis MTT/MTS assay RPMI-8226 Leukemia cancer IC50 : 10.5 µg/ml
dbacp01994 Buforin IIb RAGLQFPVGRLLRRLLRRLLR Histone H2A Inducing mitochondria-dependent apoptosis MTT/MTS assay SR Leukemia cancer IC50 : 20.2 µg/ml
dbacp02115 C-1 KWKLFKKIPFLHLAKKF Ceropin A Cell membrane disintegration MTT/MTS assay K-562 Leukemia cancer IC50 : 31 µM
dbacp02118 C-10 KWKLFKKIPKFLH Ceropin A Cell membrane disintegration MTT/MTS assay K-562 Leukemia cancer IC50 : <100 µM
dbacp02121 C-2 KWKLFKKIPKFLHLAKK Ceropin A Cell membrane disintegration MTT/MTS assay K-562 Leukemia cancer IC50 : 23 µM
dbacp02124 C-3 KWKLFKKIPLHLAKKF Ceropin A Cell membrane disintegration MTT/MTS assay K-562 Leukemia cancer IC50 : 62 µM
dbacp02127 C-4 KWKLFKKIPKFLHLAK Ceropin A Cell membrane disintegration MTT/MTS assay K-562 Leukemia cancer IC50 : 25 µM
dbacp02130 C-5 KWKLFKKIPHLAKKF Ceropin A Cell membrane disintegration MTT/MTS assay K-562 Leukemia cancer IC50 : 67 µM
dbacp02133 C-6 KWKLFKKIPKFLHLA Ceropin A Cell membrane disintegration MTT/MTS assay K-562 Leukemia cancer IC50 : 27 µM
dbacp02136 C-7 KWKLFKKIPLAKKF Ceropin A Cell membrane disintegration MTT/MTS assay K-562 Leukemia cancer IC50 : <100 µM
dbacp02139 C-8 KWKLFKKIPKFLHL Ceropin A Cell membrane disintegration MTT/MTS assay K-562 Leukemia cancer IC50 : 30 µM
dbacp02142 C-9 KWKLFKKIPLKKF Ceropin A Cell membrane disintegration MTT/MTS assay K-562 Leukemia cancer IC50 : <100 µM
dbacp02231 CA-MA KWKLFKKIGIGKFLHSAKKF Ceropin-African clawed frog hybrid peptides Cell membrane disintegration MTT/MTS assay K-562 Leukemia cancer IC50 : 65 µM
dbacp02240 CA-MA-P KWKLFKKIPKFLHSAKKF Ceropin A Cell membrane disintegration MTT/MTS assay K-562 Leukemia cancer IC50 : 25 µM
dbacp02241 CA-MA1 KWKLFKKIKFLHSAKKF Ceropin-African clawed frog hybrid peptides Cell membrane disintegration MTT/MTS assay K-562 Leukemia cancer IC50 : 85.3 µM
dbacp02245 CA-MA2 KWKLFKKIPKFLHSAKKF Ceropin-African clawed frog hybrid peptides Cell membrane disintegration MTT/MTS assay K-562 Leukemia cancer IC50 : 35.1 µM
dbacp02249 CA-MA3 KWKLFKKIGPGKFLHSAKKF Ceropin-African clawed frog hybrid peptides Cell membrane disintegration MTT/MTS assay K-562 Leukemia cancer IC50 : >100 µM
dbacp02310 Cathelicidin antimicrobial peptide MKTQRDGHSLGRWSLVLLLLGLVMPLAIIAQVLSYKEAVLRAIDGINQRSSDANLYRLLDLDPRPTMDGDPDTPKPVSFTVKETVCPRTTQQSPEDCDFKKDGLVKRCMGTVTLNQARGSFDISCDKDNKRFALLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES Human Antiproliferative effect Formate dehydrogenase–coupled PDF assay, Thymidine incorporation assay HL60 Leukemia cells IC50 ± SD : 9.3 ± 2.9μM
dbacp02323 Cecropin 2 GWLKKIGKKIERVGQHTRDATIQTIGVAQQAANVAATLK The Medfly, also housefly Cell membrane disintegration Not specified Not found Leukemia cancer Not found
dbacp02324 Cecropin 2 GWLKKIGKKIERVGQHTRDATIQTIGVAQQAANVAATLK Mediterranean fruit fly Not specified Not specified Not found Leukemia cancer Not found
dbacp02325 Cecropin 2 GWLKKIGKKIERVGQHTRDATIQTIGVAQQAANVAATLK The Medfly, also housefly Cell membrane disintegration Not specified Not found Leukemia cancer Not found
dbacp02357 Cecropin B KWKVFKKIEKMGRNIRNGIVKAGPAIAVLGEAKAL Silkmoth Pore formation at the cytoplasmic membrane MTT/MTS assay K-562 Leukemia cancer IC50 : 15.5 µM
dbacp02361 Cecropin B KWKVFKKIEKMGRNIRNGIVKAGPAIAVLGEAKAL Silkmoth Pore formation at the cytoplasmic membrane MTT/MTS assay WEHI-3B Leukemia cancer IC50 : 4.4 µM
dbacp02371 Cecropin P1 SWLSKTAKKLENSAKKRISEGIAIAIQGGPR Small Intestine of Pig Pore formation at the cytoplasmic membrane MTT/MTS assay K-562 Leukemia cancer IC50 : 93 µM
dbacp02377 Cepafungin complex I-C28H46N4O6,II-C27H44N4O6,III-C26H42N4O6 Culture broth of strain, common, free-living bacterium, **Pseudomonas sp.** Not specified Not specified P-388 Leukemia cancer Not found
dbacp02396 cGm (Derived from Gm) GCRRLCYKQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay CRL-1739 Chronic myeloid leukemia CC50 : 39.8 ± 1.0 μM
dbacp02401 cGm (Derived from Gm) GCRRLCYKQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay MM96L Chronic myeloid leukemia CC50 : 2.9 ± 0.1 μM
dbacp02406 cGm (Derived from Gm) GCRRLCYKQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay HFF-1 Chronic myeloid leukemia CC50 : 71.7 ± 9.2 μM
dbacp02411 cGm (Derived from Gm) GCRRLCYKQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay HeLa Chronic myeloid leukemia CC50 : > 64 μM
dbacp02416 cGm (Derived from Gm) GCRRLCYKQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay MCF-7 Chronic myeloid leukemia CC50 : 15.3 ± 1.4 μM
dbacp02421 cGm (Derived from Gm) GCRRLCYKQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay K-562 Chronic myeloid leukemia CC50 : 2.7 ± 0.1 μM
dbacp02426 cGm (Derived from Gm) GCRRLCYKQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay PBMCs Chronic myeloid leukemia CC50 : 12.7 ± 1.1 μM
dbacp02478 ChMAP-28 GRFKRFRKKLKRLWHKVGPFVGPILHY Domestic goat Cause cell membrane permeability; Induce necrotic death Cytotoxic Activity assay, Lactate dehydrogenase (LDH)-Releaseassay, MTT assay HL-60 Acute promyelocytic leukemia IC50 : 3.39 ± 0.15 μM
dbacp02488 Citropin 1.1 GLFDVIKKVASVIGGL Amphibian skin secretions Penetration and disruption of the membranes Sulforhodamine B assay Leukemia tumor cell line Leukemia cancer IC50 : 5 M
dbacp02499 Citropin 1.1D glfdvikkvasviggl Amphibian skin secretions Penetration and disruption of the membranes Sulforhodamine B assay Leukemia tumor cell line Leukemia cancer IC50 : 5 M
dbacp02564 CRAMP-18 E2K GKKLKKIGQKIKNFFQKL Synthetic Disrupt cell membrane structure MTT assay K-562 Chronic myelogenous Leukemia IC50 : 20–34 uM
dbacp02565 CRAMP-18 E2K GKKLKKIGQKIKNFFQKL Synthetic Disrupt cell membrane structure MTT assay Jurkat Acute T cell Leukemia IC50 : 20–34 uM
dbacp02566 CRAMP-18 E2K GKKLKKIGQKIKNFFQKL Synthetic Disrupt cell membrane structure MTT assay K-549 Acute T cell Leukemia IC50 : 20–34 uM
dbacp02594 Cyclic [W(RW)4 ]-Dox WRWRWRWRW Not found Inhibition of the cell proliferation MTT/MTS assay CCRF-CEM Leukemia cancer 62-73% inhibition of cell proliferation at 1 µM
dbacp02608 Cytotoxin drCT-1 LKCNKLVPLFYKTCPAGKNL Not found Inducing apoptosis MTT assay U937 Leukemia IC50 : 8.9 µg/ml
dbacp02609 Cytotoxin drCT-1 LKCNKLVPLFYKTCPAGKNL Not found Inducing apoptosis MTT assay K562 Leukemia IC50 : 6.7 µg/ml
dbacp02618 D-Antp-LP4 RQIKIWFQNRRMKWKKSWTWEKKLETAVNLAWTAGNSNKWTWK Not found Inducing apoptosis Not specified CLL Leukemia IC50 : 0.7 ± 0.4 µM
dbacp02619 D-Antp-LP4 RQIKIWFQNRRMKWKKSWTWEKKLETAVNLAWTAGNSNKWTWK Not found Inducing apoptosis Not specified MEC-1 Leukemia IC50 : 1.6 ± 0.3 µM
dbacp02623 D-MinAntp-LP4 KRRMKWKKSWTWEKKLETAVNLAWTAGNSNKWTWK Not found Inducing apoptosis Not specified CLL Leukemia IC50 : 0.6 ± 0.2 µM
dbacp02624 D-MinAntp-LP4 KRRMKWKKSWTWEKKLETAVNLAWTAGNSNKWTWK Not found Inducing apoptosis Not specified MEC-1 Leukemia IC50 : 1.4 ± 0.1 µM
dbacp02625 D-N-Ter-Antp MAVPPTYADLGKSARDVFTKGYGFGLRQIKIWFQNRRMKWKK VDAC1(voltage-dependent anion channel1) Inducing apoptosis Not specified CLL Leukemia IC50 : 1.5 ± 0.6 µM
dbacp02626 D-N-Ter-Antp MAVPPTYADLGKSARDVFTKGYGFGLRQIKIWFQNRRMKWKK VDAC1(voltage-dependent anion channel1) Inducing apoptosis Not specified MEC-1 Leukemia IC50 : 2.2 ± 1.6 µM
dbacp02645 Defensin-like protein (Sesquin) KTCENLADTY Yard-Long bean Anti-proliferative action MTT assay MCF-7 Leukemia MIC : 0.25 μg/ml
dbacp02805 Dolastatin 10 2-[[2-(dimethylamino)-3-methylbutanoyl]amino]-N-[3-methoxy-1-[2-[1-methoxy-2-methyl-3-oxo-3-[[2-phenyl-1-(1,3-thiazol-2-yl)ethyl]amino]propyl]pyrrolidin-1-yl]-5-methyl-1-oxoheptan-4-yl]-N,3-dimethylbutaNAmide Wedge sea hare Apoptosis inducing Cell viability assay SR Leukemia cancer IC50 : 0.0013 - 0.013 nM
dbacp02809 Dolastatin 15 VV-nMe-VPP-2hydroxyisovaleryl-2-oxo-4-methoxy-5-benzyl-3-pyrroline Wedge sea hare Apoptosis inducing Cell viability assay SR Leukemia cancer IC50 : 0.0013 - 0.013 nM
dbacp02871 Epinecidin-1 GFIFHIIKGLFHAGKMIHGLV Not found Inducing apoptosis MTT assay U937 Leukemia Not found
dbacp02930 Figainin 1 FIGTLIPLALGALTKLFK Chaco tree frog Membrane disruption and cell lysis MTT/MTS assay B16F10 Leukemia IC50 : 10.5 µM
dbacp02946 Figainin 1 FIGTLIPLALGALTKLFK Skin secretions, Chaco tree frog, South America Membrane disruption MTT/MTS assay B16F10 Leukemia IC50 : 10.5 µM
dbacp03126 Gomesin ZCRRLCYKQRCVTYCRGR Tarantula spider sp. Target and destroy tumor cell membranes Fluorescence-based assay using a Fluorescence Imaging Plate Reader K-562 Chronic myeloid leukemia CC50 : 3.8 ± 0.3 μM
dbacp03130 Gomesin ZCRRLCYKQRCVTYCRGR Tarantula spider sp. Target and destroy tumor cell membranes Cell viability assay K-562 Chronic myeloid leukemia CC50 : 3.8 ± 0.3 μM
dbacp03135 Gomesin ZCRRLCYKQRCVTYCRGR Tarantula spider sp. Target and destroy tumor cell membranes Cell viability assay CRL-1739 Chronic myeloid leukemia CC50 : 67.0 ± 5.0 μM
dbacp03140 Gomesin ZCRRLCYKQRCVTYCRGR Tarantula spider sp. Target and destroy tumor cell membranes Cell viability assay MM96L Chronic myeloid leukemia CC50 : 3.7 ± 0.2 μM
dbacp03145 Gomesin ZCRRLCYKQRCVTYCRGR Tarantula spider sp. Target and destroy tumor cell membranes Cell viability assay HFF-1 Chronic myeloid leukemia CC50 : 49.9 ±16.6 μM
dbacp03150 Gomesin ZCRRLCYKQRCVTYCRGR Tarantula spider sp. Target and destroy tumor cell membranes Cell viability assay HeLa Chronic myeloid leukemia CC50 : 54.1 ± 5.0 μM
dbacp03191 HAL-1 GMWSKILGHLIR Sweat bees and their analogs Cell membrane damage MTT/MTS assay CCRF-CEM Leukemia cancer IC50 : 49 ± 9 µM
dbacp03194 HAL-1/10 GMWKKILGKLIR Sweat bees and their analogs Cell membrane damage MTT/MTS assay CCRF-CEM Leukemia cancer Not found
dbacp03197 HAL-1/12 GKWSKILGHLIR Sweat bees and their analogs Cell membrane damage MTT/MTS assay CCRF-CEM Leukemia cancer IC50 : > 40 µM
dbacp03200 HAL-1/15 GMWSKLLGHLLR Sweat bees and their analogs Cell membrane damage MTT/MTS assay CCRF-CEM Leukemia cancer IC50 : > 40 µM
dbacp03203 HAL-1/17 KMWSKILGHLIR Sweat bees and their analogs Cell membrane damage MTT/MTS assay CCRF-CEM Leukemia cancer Not found
dbacp03206 HAL-1/18 GMWSKILKHLIR Sweat bees and their analogs Cell membrane damage MTT/MTS assay CCRF-CEM Leukemia cancer Not found
dbacp03209 HAL-1/19 GKWKKILGHLIR Sweat bees and their analogs Cell membrane damage MTT/MTS assay CCRF-CEM Leukemia cancer Not found
dbacp03212 HAL-1/20 GKWSKILGKLIR Sweat bees and their analogs Cell membrane damage MTT/MTS assay CCRF-CEM Leukemia cancer IC50 : > 40 µM
dbacp03215 HAL-1/21 GKWKKILGKLIR Sweat bees and their analogs Cell membrane damage MTT/MTS assay CCRF-CEM Leukemia cancer Not found
dbacp03218 HAL-1/22 gmwskilghlir Sweat bees and their analogs Cell membrane damage MTT/MTS assay CCRF-CEM Leukemia cancer Not found
dbacp03221 HAL-1/29 GMWSKILGHLIR Sweat bees and their analogs Cell membrane damage MTT/MTS assay CCRF-CEM Leukemia cancer Not found
dbacp03224 HAL-1/4 GMWSKILGHLKR Sweat bees and their analogs Cell membrane damage MTT/MTS assay CCRF-CEM Leukemia cancer Not found
dbacp03227 HAL-1/5 GMWKKILGHLIR Sweat bees and their analogs Cell membrane damage MTT/MTS assay CCRF-CEM Leukemia cancer IC50 : > 40 µM
dbacp03230 HAL-1/6 GMWSKILGHLIK Sweat bees and their analogs Cell membrane damage MTT/MTS assay CCRF-CEM Leukemia cancer Not found
dbacp03233 HAL-1/9 GMWSKILGKLIR Sweat bees and their analogs Cell membrane damage MTT/MTS assay CCRF-CEM Leukemia cancer IC50 : 30 ± 10 µM
dbacp03236 HAL-2 GKWMSLLKHILK Sweat bees and their analogs Cell membrane damage MTT/MTS assay CCRF-CEM Leukemia cancer IC50 : 34 µM
dbacp03239 HAL-2/1 GKWKSLLKHILK Sweat bees and their analogs Cell membrane damage MTT/MTS assay CCRF-CEM Leukemia cancer IC50 : > 40 µM
dbacp03242 HAL-2/11 GKWLSLLKHILK Sweat bees and their analogs Cell membrane damage MTT/MTS assay CCRF-CEM Leukemia cancer Not found
dbacp03245 HAL-2/13 GKWMTLLKHILK Sweat bees and their analogs Cell membrane damage MTT/MTS assay CCRF-CEM Leukemia cancer Not found
dbacp03248 HAL-2/18 GKWMSLLKHIWK Sweat bees and their analogs Cell membrane damage MTT/MTS assay CCRF-CEM Leukemia cancer Not found
dbacp03251 HAL-2/19 GKWMSLLKHWLK Sweat bees and their analogs Cell membrane damage MTT/MTS assay CCRF-CEM Leukemia cancer Not found
dbacp03254 HAL-2/2 GKWMKLLKHILK Sweat bees and their analogs Cell membrane damage MTT/MTS assay CCRF-CEM Leukemia cancer IC50 : > 40 µM
dbacp03257 HAL-2/20 GKWMSLWKHILK Sweat bees and their analogs Cell membrane damage MTT/MTS assay CCRF-CEM Leukemia cancer Not found
dbacp03260 HAL-2/22 gkwmsllkhilk Sweat bees and their analogs Cell membrane damage MTT/MTS assay CCRF-CEM Leukemia cancer Not found
dbacp03263 HAL-2/24 GKFMSLLKHILK Sweat bees and their analogs Cell membrane damage MTT/MTS assay CCRF-CEM Leukemia cancer Not found
dbacp03266 HAL-2/4 GKWMSLLKKILK Sweat bees and their analogs Cell membrane damage MTT/MTS assay CCRF-CEM Leukemia cancer Not found
dbacp03269 HAL-2/6 GKWMSFLKHILK Sweat bees and their analogs Cell membrane damage MTT/MTS assay CCRF-CEM Leukemia cancer Not found
dbacp03272 HAL-2/8 GKWMSLLKHILK Sweat bees and their analogs Cell membrane damage MTT/MTS assay CCRF-CEM Leukemia cancer Not found
dbacp03279 Harmoniasin IGGYCSELDL-NH Harlequin lady beetle Induce apoptotic and necrotic cell deaths MTS assay and LDH release assay U937 Human leukemia MIC : approx. 200 µg/ml
dbacp03280 Harmoniasin IGGYCSELDL-NH Harlequin lady beetle Induce apoptotic and necrotic cell deaths MTS assay and LDH release assay Jurkat Human leukemia MIC : approx. 200 µg/ml
dbacp03406 Interferon gamma (IFN-gamma) MNATHCILALQLFLMAVSGCYCHGTVIESLESLNNYFNSSGIDVEEKSLFLDIWRNWQKDGDMKILQSQIISFYLRLFEVLKDNQAISNNISVIESHLITTFFSNSKAKKDAFMSIAKFEVNNPQVQRQAFNELIRVVHQLLPESSLRKRKRSRC Mouse Anti-proliferative effect Formate dehydrogenase–coupled PDF assay, Thymidine incorporation assay HL60 Leukemia IC50 ± SD : 9.3 ± 2.9μM
dbacp03471 IP3R-derived peptide (IDP) NVYTEIKCNSLLPLDDIVRV Not found Inducing apoptosis Not specified CLL Leukemia Not found
dbacp03541 L-amino-acid oxidase (BatroxLAAO) (LAO) (EC 1.4.3.2) MNVFFTFSLLFLAALGSCADDRNPLEECFRETDYEEFLEIAKNGLSTTSNPKRVVIVGAGMSGLSAAYVLANAGHQVTVLEASERAGGRVKTYRNEKEGWYANLGPMRLPEKHRIVREYIRKFDLQLNEFSQENENAWYFIKNIRKRVGEVNKDPGVLEYPVKPSEVGKSAGQLYEESLQKAVEELRRTNCSYMLNKYDTYSTKEYLLKEGNLSPGAVDMIGDLLNEDSGYYVSFIESLKHDDIFAYEKRFDEIVGGMDKLPTSMYQAIQEKVHLNARVIKIQQDVKEVTVTYQTSEKETLSVTADYVIVCTTSRAARRIKFEPPLPPKKAHALRSVHYRSGTKIFLTCTKKFWEDDGIHGGKSTTDLPSRFIYYPNHNFPNGVGVIIAYGIGDDANYFQALDFEDCGDIVINDLSLIHQLPKEEIQAICRPSMIQRWSLDKYAMGGITTFTPYQFQHFSEALTAPVDRIYFAGEYTAQAHGWIDSTIKSGLRAARDVNRASEIKK Common lancehead Inducing apoptosis MTT assay Jurkat Acute T-cell Leukemia Not found
dbacp03709 Laxaphycin A Aoc-Hse-E-Dhb-Hyp-Hse-FLIILG Terrestrial blue-green alga or the marine cyanobacterium Not specified Cell viability assay CEM-WT Leukemia cancer No inhibition at 4 µM
dbacp03710 Laxaphycin A Aoc-Hse-E-Dhb-Hyp-Hse-FLIILG Terrestrial blue-green alga or the marine cyanobacterium Not specified Cell viability assay CEM-VLB Leukemia cancer No inhibition at 4 µM
dbacp03711 Laxaphycin A Aoc-Hse-E-Dhb-Hyp-Hse-FLIILG Terrestrial blue-green alga or the marine cyanobacterium Not specified Cell viability assay CEM-VM1 Leukemia cancer No inhibition at 4 µM
dbacp03712 Laxaphycin B A-Hleu-QN-MeIle-Hasn-TPLT-Ade-V-Hleu Terrestrial blue-green alga or the marine cyanobacterium Not specified Cell viability assay CEM-WT Leukemia cancer 50% inhibition at 1 µM
dbacp03713 Laxaphycin B A-Hleu-QN-MeIle-Hasn-TPLT-Ade-V-Hleu Terrestrial blue-green alga or the marine cyanobacterium Not specified Cell viability assay CEM-WT Leukemia cancer 44% inhibition at 1 µM
dbacp03714 Laxaphycin B A-Hleu-QN-MeIle-Hasn-TPLT-Ade-V-Hleu Terrestrial blue-green alga or the marine cyanobacterium Not specified Cell viability assay CEM-VM1 Leukemia cancer 44% inhibition at 1 µM
dbacp03715 Laxaphycin B A-Hleu-QN-MeIle-Hasn-TPLT-Ade-V-Hleu Terrestrial blue-green alga or the marine cyanobacterium Not specified Cell viability assay CEM-VLB Leukemia cancer 44% inhibition at 1 µM
dbacp03716 Laxaphycin B A-Hleu-QN-MeIle-Hasn-TPLT-Ade-V-Hleu Terrestrial blue-green alga or the marine cyanobacterium Not specified Cell viability assay CEM-WT Leukemia cancer 40% inhibition at 1 µM
dbacp03717 Laxaphycin B A-Hleu-QN-MeIle-Hasn-TPLT-Ade-V-Hleu Terrestrial blue-green alga or the marine cyanobacterium Not specified Cell viability assay CEM-VM1 Leukemia cancer 40% inhibition at 1 µM
dbacp03718 Laxaphycin B A-Hleu-QN-MeIle-Hasn-TPLT-Ade-V-Hleu Terrestrial blue-green alga or the marine cyanobacterium Not specified Cell viability assay CEM-VLB Leukemia cancer 40% inhibition at 1 µM
dbacp03741 LfcinB (Bovine lactoferricin) FKCRRWQWRM Not found Inducing apoptosis MTT assay Jurkat Leukemia Not found
dbacp03742 LfcinB (Bovine lactoferricin) FKCRRWQWRM Not found Inducing apoptosis MTT assay MCF-7 Leukemia Not found
dbacp03743 LfcinB (Bovine lactoferricin) FKCRRWQWRM Not found Inducing apoptosis MTT assay Colo-35 Leukemia Not found
dbacp03744 LfcinB (Bovine lactoferricin) FKCRRWQWRM Not found Inducing apoptosis MTT assay MDA-MB-435 Leukemia Not found
dbacp03745 LfcinB (Bovine lactoferricin) FKCRRWQWRM Not found Inducing apoptosis MTT assay SKov3 Leukemia Not found
dbacp03746 LfcinB (Bovine lactoferricin) FKCRRWQWRM Not found Inducing apoptosis MTT assay CAov3 Leukemia Not found
dbacp03747 LfcinB (Bovine lactoferricin) FKCRRWQWRM Not found Inducing apoptosis MTT assay HT-29 Leukemia Not found
dbacp03748 LfcinB (Bovine lactoferricin) FKCRRWQWRM Not found Inducing apoptosis MTT assay T-47D Leukemia Not found
dbacp03749 LfcinB (Bovine lactoferricin) FKCRRWQWRM Not found Inducing apoptosis MTT assay CCRF-CEM Leukemia Not found
dbacp03750 LfcinB (Bovine lactoferricin) FKCRRWQWRM Not found Inducing apoptosis MTT assay K562 Leukemia Not found
dbacp03751 LfcinB (Bovine lactoferricin) FKCRRWQWRM Not found Inducing apoptosis MTT assay Raji Leukemia Not found
dbacp04103 linear (RW)4-Dox RWRWRWRW Doxorubicin (Dox) is a well-known anthracycline which has been conjugated to a CPP Inhibition of the cell proliferation MTT/MTS assay CCRF-CEM Leukemia cancer 46-69% anti-proliferative activity at 1 µM
dbacp04182 LL-III VNWKKILGKIIKVVK Lasioglossin III and its analogs Cell membrane damage MTT/MTS assay CCRF-CEM Leukemia cancer IC50 : 5 ± 3 µM
dbacp04185 LL-III/1 VNWKKILAKIIKVVK Lasioglossin III and its analogs Cell membrane damage MTT/MTS assay CCRF-CEM Leukemia cancer IC50 : 3 ± 1 µM
dbacp04188 LL-III/10 KNWKKILGKIIKVVK Lasioglossin III and its analogs Cell membrane damage MTT/MTS assay CCRF-CEM Leukemia cancer IC50 : 9 µM
dbacp04191 LL-III/11 VNWKKIILGKIIKVVK Lasioglossin III and its analogs Cell membrane damage MTT/MTS assay CCRF-CEM Leukemia cancer IC50 : 4 ± 1 µM
dbacp04194 LL-III/12 vnwkkilgkiikvvk Lasioglossin III and its analogs Cell membrane damage MTT/MTS assay CCRF-CEM Leukemia cancer IC50 : 5 ± 2 µM
dbacp04197 LL-III/15 VNFKKLLGKLLKVVK Lasioglossin III and its analogs Cell membrane damage MTT/MTS assay CCRF-CEM Leukemia cancer IC50 : 9 ± 3 µM
dbacp04200 LL-III/16 VN-NAl-KKLLGKLLKVVK Lasioglossin III and its analogs Cell membrane damage MTT/MTS assay CCRF-CEM Leukemia cancer Not found
dbacp04203 LL-III/17 VNWRRILGRIIRVVR Lasioglossin III and its analogs Cell membrane damage MTT/MTS assay CCRF-CEM Leukemia cancer Not found
dbacp04206 LL-III/18 KNWKKILKKIIKVVK Lasioglossin III and its analogs Cell membrane damage MTT/MTS assay CCRF-CEM Leukemia cancer IC50 : 7 ± 2 µM
dbacp04209 LL-III/19 VNWKK-Aib-LGK-Aib-IK-Aib-VK Lasioglossin III and its analogs Cell membrane damage MTT/MTS assay CCRF-CEM Leukemia cancer IC50 : 8 ± 2 µM
dbacp04212 LL-III/2 NVWKKILGKIIKVVK Lasioglossin III and its analogs Cell membrane damage MTT/MTS assay CCRF-CEM Leukemia cancer IC50 : 7 ± 2 µM
dbacp04215 LL-III/22 KNWKK-Aib-LKK-Aib-IK-Aib-VK Lasioglossin III and its analogs Cell membrane damage MTT/MTS assay CCRF-CEM Leukemia cancer IC50 : 25 ± 4 µM
dbacp04218 LL-III/23 VNWKKLLGKLLKVVK Lasioglossin III and its analogs Cell membrane damage MTT/MTS assay CCRF-CEM Leukemia cancer IC50 : 6 µM
dbacp04221 LL-III/24 VNWOOILGOIIOVVO Lasioglossin III and its analogs Cell membrane damage MTT/MTS assay CCRF-CEM Leukemia cancer IC50 : 5 ± 2 µM
dbacp04224 LL-III/25 vnwkkllgkllkvvk Lasioglossin III and its analogs Cell membrane damage MTT/MTS assay CCRF-CEM Leukemia cancer IC50 : 4 µM
dbacp04227 LL-III/26 VYWKKILGKIIKVVK Lasioglossin III and its analogs Cell membrane damage MTT/MTS assay CCRF-CEM Leukemia cancer IC50 : 6 µM
dbacp04230 LL-III/27 VNWKKVLGKVVKVVK Lasioglossin III and its analogs Cell membrane damage MTT/MTS assay CCRF-CEM Leukemia cancer IC50 : 18 µM
dbacp04233 LL-III/3 VNWKKILKKIIKVVK Lasioglossin III and its analogs Cell membrane damage MTT/MTS assay CCRF-CEM Leukemia cancer Not found
dbacp04236 LL-III/34 NKWKKILGKIIKVVK Lasioglossin III and its analogs Cell membrane damage MTT/MTS assay CCRF-CEM Leukemia cancer IC50 : 5 ± 3 µM
dbacp04239 LL-III/36 VNWKKILAKIIKVVK Lasioglossin III and its analogs Cell membrane damage MTT/MTS assay CCRF-CEM Leukemia cancer Not found
dbacp04242 LL-III/37 VNWKKILGKIIKVVK Lasioglossin III and its analogs Cell membrane damage MTT/MTS assay CCRF-CEM Leukemia cancer IC50 : 4 ± 1 µM
dbacp04245 LL-III/4 VNWKKILGKIKKVVK Lasioglossin III and its analogs Cell membrane damage MTT/MTS assay CCRF-CEM Leukemia cancer IC50 : 18 µM
dbacp04248 LL-III/6 VNWKKILPKIIKVVK Lasioglossin III and its analogs Cell membrane damage MTT/MTS assay CCRF-CEM Leukemia cancer IC50 : 6 ± 3 µM
dbacp04251 LL-III/8 VNWKKILGKIIKVVK Lasioglossin III and its analogs Cell membrane damage MTT/MTS assay CCRF-CEM Leukemia cancer IC50 : 9 µM
dbacp04254 LL-III/9 VNWKKILGKIIKVVK Lasioglossin III and its analogs Cell membrane damage MTT/MTS assay CCRF-CEM Leukemia cancer Not found
dbacp04287 LP-4 peptide SWTWEKKLETAVNLAWTAGNSNKWTWK VDAC1(voltage-dependent anion channel1) Inducing apoptosis Not specified CLL Leukemia Not found
dbacp04288 LP-4 peptide SWTWEKKLETAVNLAWTAGNSNKWTWK VDAC1(voltage-dependent anion channel1) Inducing apoptosis Not specified MEC-1 Leukemia Not found
dbacp04378 MAC1 GFGMALKLLKKVL Wallabies and their analogs Cell membrane damage MTT/MTS assay CCRF-CEM Leukemia cancer IC50 : 12 ± 6 µM
dbacp04381 MAC1/1 gfgmalkllkkvl Wallabies and their analogs Cell membrane damage MTT/MTS assay CCRF-CEM Leukemia cancer IC50 : 11 µM
dbacp04384 MAC1/10 GFKMALKLLKKVL Wallabies and their analogs Cell membrane damage MTT/MTS assay CCRF-CEM Leukemia cancer IC50 : 16 µM
dbacp04387 MAC1/16 GFGMALKLLKKVL-NH2 Wallabies and their analogs Cell membrane damage MTT/MTS assay CCRF-CEM Leukemia cancer IC50 : 70 µM
dbacp04390 MAC1/19 GFGMALKLLKKVL-NH2 Wallabies and their analogs Cell membrane damage MTT/MTS assay CCRF-CEM Leukemia cancer IC50 : 43 ± 11 µM
dbacp04393 MAC1/2 AFGMALKLLKKVL Wallabies and their analogs Cell membrane damage MTT/MTS assay CCRF-CEM Leukemia cancer IC50 : 17 µM
dbacp04396 MAC1/20 GFGMALOLLOOVL Wallabies and their analogs Cell membrane damage MTT/MTS assay CCRF-CEM Leukemia cancer IC50 : 25 ± 3 µM
dbacp04399 MAC1/21 GFGMALRLLRRVL Wallabies and their analogs Cell membrane damage MTT/MTS assay CCRF-CEM Leukemia cancer IC50 : 22 ± 4 µM
dbacp04402 MAC1/24 GFGMALKL-(AC6C)-KKVL Wallabies and their analogs Cell membrane damage MTT/MTS assay CCRF-CEM Leukemia cancer IC50 : 11 µM
dbacp04405 MAC1/25 GFGMALK-(AC6C)-LKKVL Wallabies and their analogs Cell membrane damage MTT/MTS assay CCRF-CEM Leukemia cancer IC50 : 12 ± 2 µM
dbacp04408 MAC1/26 GFGMA-(AC6C)-KLLKKVL Wallabies and their analogs Cell membrane damage MTT/MTS assay CCRF-CEM Leukemia cancer IC50 : 9 ± 2 µM
dbacp04411 MAC1/3 LFGMALKLLKKVL Wallabies and their analogs Cell membrane damage MTT/MTS assay CCRF-CEM Leukemia cancer IC50 : 22 µM
dbacp04414 MAC1/4 GFGMALKLLKKVL-NH2 Wallabies and their analogs Cell membrane damage MTT/MTS assay CCRF-CEM Leukemia cancer IC50 : 29 µM
dbacp04417 MAC1/6 GFGMALKLLKKVL-NH2 Wallabies and their analogs Cell membrane damage MTT/MTS assay CCRF-CEM Leukemia cancer IC50 : 15 µM
dbacp04420 MAC1/9 GFKMALKLLKKVL-NH2 Wallabies and their analogs Cell membrane damage MTT/MTS assay CCRF-CEM Leukemia cancer IC50 : 14 ± 4 µM
dbacp04423 MAC2 GTGLPMSERRKIMLMMR Wallabies and their analogs Cell membrane damage MTT/MTS assay CCRF-CEM Leukemia cancer IC50 : 32 µM
dbacp04488 Magainin 2 GIGKFLHSAKKFGKAFVGEIMNS African clawed frog Dissipate ion gradients; Induce osmotic lysis; Membrane damage Trypan blue assay 8402 Leukemia cancer IC50 : >150 µg/ml
dbacp04491 Magainin 2 GIGKFLHSAKKFGKAFVGEIMNS African clawed frog Dissipate ion gradients; Induce osmotic lysis; Membrane damage Trypan blue assay MLA Leukemia cancer IC50 : >150 µg/ml
dbacp04493 Magainin 2 GIGKFLHSAKKFGKAFVGEIMNS African clawed frog Dissipate ion gradients; Induce osmotic lysis; Membrane damage Trypan blue assay K-562 Leukemia cancer IC50 : >150 µg/ml
dbacp04506 Magainin A AIGKFLHSAKKFGKAFVGEIMNS African clawed frog Dissipate ion gradients; Induce osmotic lysis; Membrane damage Trypan blue assay 8402 Leukemia cancer IC50 : 18 µg/ml
dbacp04509 Magainin A AIGKFLHSAKKFGKAFVGEIMNS African clawed frog Dissipate ion gradients; Induce osmotic lysis; Membrane damage Trypan blue assay MLA Leukemia cancer IC50 : 34 µg/ml
dbacp04511 Magainin A AIGKFLHSAKKFGKAFVGEIMNS African clawed frog Dissipate ion gradients; Induce osmotic lysis; Membrane damage Trypan blue assay K-562 Leukemia cancer IC50 : 40 µg/ml
dbacp04516 Magainin B GIGKFLHAAKKFAKAFVAEIMNS African clawed frog Dissipate ion gradients; Induce osmotic lysis; Membrane damage Trypan blue assay 8402 Leukemia cancer IC50 : 12 µg/ml
dbacp04519 Magainin B GIGKFLHAAKKFAKAFVAEIMNS African clawed frog Dissipate ion gradients; Induce osmotic lysis; Membrane damage Trypan blue assay MLA Leukemia cancer IC50 : 30 µg/ml
dbacp04521 Magainin B GIGKFLHAAKKFAKAFVAEIMNS African clawed frog Dissipate ion gradients; Induce osmotic lysis; Membrane damage Trypan blue assay K-562 Leukemia cancer IC50 : 32 µg/ml
dbacp04532 Magainin G GIGKFLHSAKKFAKAFVAEIMNS African clawed frog Dissipate ion gradients; Induce osmotic lysis; Membrane damage Trypan blue assay 8402 Leukemia cancer IC50 : 16 µg/ml
dbacp04535 Magainin G GIGKFLHSAKKFAKAFVAEIMNS African clawed frog Dissipate ion gradients; Induce osmotic lysis; Membrane damage Trypan blue assay MLA Leukemia cancer IC50 : 33 µg/ml
dbacp04537 Magainin G GIGKFLHSAKKFAKAFVAEIMNS African clawed frog Dissipate ion gradients; Induce osmotic lysis; Membrane damage Trypan blue assay K-562 Leukemia cancer IC50 :37 µg/ml
dbacp04543 Malanin chain A DYPKLTFTTS Plant sources Inducing apoptosis MTT assay MCF-7 Leukemia IC50 : 11.20 ± 0.02 nM
dbacp04549 Malanin chain B DETCTDEEFN Plant sources Inducing apoptosis MTT assay MCF-7 Leukemia IC50 : 11.20 ± 0.02 nM
dbacp04607 Maximin1 GIGTKILGGVKTALKGALKELASTYAN Yunnan firebelly toad Not specified MTT/MTS assay C8166 Leukemia cancer IC50 : 15.3 µg/ml
dbacp04608 Maximin1 GIGTKILGGVKTALKGALKELASTYAN Yunnan firebelly toad Not specified MTT/MTS assay MOLT-4 Leukemia cancer IC50 : 24.3 µg/ml
dbacp04611 Maximin3 GIGGKILSGLKTALKGAAKELASTYLH Yunnan firebelly toad Not specified MTT/MTS assay C8166 Leukemia cancer IC50 : 11.4 µg/ml
dbacp04612 Maximin3 GIGGKILSGLKTALKGAAKELASTYLH Yunnan firebelly toad Not specified MTT/MTS assay MOLT-4 Leukemia cancer IC50 : 25.2 µg/ml
dbacp04615 Maximin4 GIGVLLSAGKAALKGLAKVLAEKYAN Yunnan firebelly toad Not specified MTT/MTS assay C8166 Leukemia cancer IC50 : 24.2 µg/ml
dbacp04616 Maximin4 GIGVLLSAGKAALKGLAKVLAEKYAN Yunnan firebelly toad Not specified MTT/MTS assay MOLT-4 Leukemia cancer IC50 : 53.4 µg/ml
dbacp04619 Maximin5 SIGAKILGGVKTFFKGALKELASTYLQ Yunnan firebelly toad Not specified MTT/MTS assay C8166 Leukemia cancer IC50 : 34.4 µg/ml
dbacp04620 Maximin5 SIGAKILGGVKTFFKGALKELASTYLQ Yunnan firebelly toad Not specified MTT/MTS assay MOLT-4 Leukemia cancer IC50 : >50 µg/ml
dbacp04630 MCL-1, BH3 (208-228) KALETLRRVGDGVQRNHETAF Anti apoptotic (MCL-1, BFL1) Inducing apoptosis Not specified Not found Leukemia Not found
dbacp04683 Min-Antp-LP4 KRRMKWKKSWTWEKKLETAVNLAWTAGNSNKWTWK VDAC1(voltage-dependent anion channel1) Inducing apoptosis Not specified CLL Leukemia IC50 : 0.3 ± 0.1 µM
dbacp04684 Min-Antp-LP4 KRRMKWKKSWTWEKKLETAVNLAWTAGNSNKWTWK VDAC1(voltage-dependent anion channel1) Inducing apoptosis Not specified MEC-1 Leukemia IC50 : 1.7 ± 0.4 µM
dbacp04732 N-1 WKLFKKIPKFLHLAKKF Ceropin A Cell membrane disintegration MTT/MTS assay K-562 Leukemia cancer IC50 : 6 µM
dbacp04735 N-2 FKLFKKIPKFLHLAKKF Ceropin A Cell membrane disintegration MTT/MTS assay K-562 Leukemia cancer IC50 : 7 µM
dbacp04738 N-3 KWFKKIPKFLHLAKKF Ceropin A Cell membrane disintegration MTT/MTS assay K-562 Leukemia cancer IC50 : 11 µM
dbacp04741 N-3L KWFKKIPKFLHLLKKF Ceropin A Cell membrane disintegration MTT/MTS assay K-562 Leukemia cancer IC50 : 4.2 µM
dbacp04744 N-4 WFKKIPKFLHLAKKF Ceropin A Cell membrane disintegration MTT/MTS assay K-562 Leukemia cancer IC50 : 24 µM
dbacp04747 N-4L WFKKIPKFLHLLKKF Ceropin A Cell membrane disintegration MTT/MTS assay K-562 Leukemia cancer IC50 : 3 µM
dbacp04750 N-5 WKKIPKFLHLAKKF Ceropin A Cell membrane disintegration MTT/MTS assay K-562 Leukemia cancer IC50 : < 100 µM
dbacp04753 N-5L WKKIPKFLHLLKKF Ceropin A Cell membrane disintegration MTT/MTS assay K-562 Leukemia cancer IC50 :10 µM
dbacp04791 N-Ter-Antp N-Ter-RQIKIWFQNRRMKWKK VDAC1(voltage-dependent anion channel1) Inducing apoptosis Not specified CLL Leukemia IC50 : 3.2 ± 0.5 µM
dbacp04792 N-Ter-Antp N-Ter-RQIKIWFQNRRMKWKK VDAC1(voltage-dependent anion channel1) Inducing apoptosis Not specified MEC-1 Leukemia IC50 : 4.2 ± 0.2 µM
dbacp04867 NK-2 KILRGVCKKIMRTFLRRISKDILTGKK NK-lysin Cell membrane disintegration PI-uptake assay SW-480 Leukemia cancer LD50 : 1-4 µM
dbacp05050 P18 KWKFKKIPKFLHLAKKF Ceropin A Cell membrane disintegration MTT/MTS assay K-562 Leukemia cancer IC50 : 3.5 µM
dbacp05127 PaDef ATCETPSKHFNGLCIRSSNCASVCHGEHFTDGRCQGVRRRCMCLKPC Plant sources Inducing apoptosis MTT assay Jurkat Leukemia Not found
dbacp05130 Pal-pFL-N-Ter-TAT FPWWWPFLRDVFTKGYGFGLGRKKRRQRRRPQ VDAC1(voltage-dependent anion channel1) Inducing apoptosis MTT assay A375 Leukemia IC50 : 5.5 ± 1.1 μM
dbacp05246 Pep27 MRKEFHNVLSSGQLLADKRPARDYNRK Pneumococcus Apoptosis inducing MTT/MTS assay AML-2 Leukemia cancer Not found
dbacp05247 Pep27 MRKEFHNVLSSGQLLADKRPARDYNRK Pneumococcus Apoptosis inducing MTT/MTS assay HL-60 Leukemia cancer IC50 : > 70 µM
dbacp05251 Pep27 MRKEFHNVLSSGQLLADKRPARDYNRK Not found Inducing apoptosis MTT assay AML-2 Acute myelogenous leukemia IC50 : > 70 µM
dbacp05252 Pep27 MRKEFHNVLSSGQLLADKRPARDYNRK Not found Inducing apoptosis MTT assay HL-60 Acute promyelocytic leukemia IC50 : > 70 µM
dbacp05253 Pep27 MRKEFHNVLSSGQLLADKRPARDYNRK Not found Inducing apoptosis MTT assay Jurkat T-cell leukemia IC50 : > 70 µM
dbacp05257 Pep27 anal1 MWKWFHNVLSSWQLLADKRPARDYNRK Not found Inducing apoptosis MTT assay AML-2 Acute myelogenous leukemia IC50 : 50 µM
dbacp05258 Pep27 anal1 MWKWFHNVLSSWQLLADKRPARDYNRK Not found Inducing apoptosis MTT assay HL-60 Acute promyelocytic leukemia IC50 : 53 µM
dbacp05259 Pep27 anal1 MWKWFHNVLSSWQLLADKRPARDYNRK Not found Inducing apoptosis MTT assay Jurkat T-cell leukemia IC50 : 47 µM
dbacp05262 Pep27 anal2 MWKWFHNVLSWWWLLADKRPARDYNRK Not found Inducing apoptosis MTT assay AML-2 Acute myelogenous leukemia IC50 : 29 µM
dbacp05263 Pep27 anal2 MWKWFHNVLSWWWLLADKRPARDYNRK Not found Inducing apoptosis MTT assay HL-60 Acute promyelocytic leukemia IC50 : 20 µM
dbacp05264 Pep27 anal2 MWKWFHNVLSWWWLLADKRPARDYNRK Not found Inducing apoptosis MTT assay Jurkat T cell leukemia IC50 : 23 µM
dbacp05267 Pep27 anal3 MRKWFHNVLSSGQLLADKWPAWDYNRK Not found Inducing apoptosis MTT assay AML-2 Acute myelogenous leukemia IC50 : 67 µM
dbacp05268 Pep27 anal3 MRKWFHNVLSSGQLLADKWPAWDYNRK Not found Inducing apoptosis MTT assay HL-60 Acute promyelocytic leukemia IC50 : 52 µM
dbacp05269 Pep27 anal3 MRKWFHNVLSSGQLLADKWPAWDYNRK Not found Inducing apoptosis MTT assay Jurkat T cell leukemia IC50 : 50 µM
dbacp05272 Pep27 anal4 MWKEFHNVLSSGQLLADKRWARWYNRW Not found Inducing apoptosis MTT assay AML-2 Acute myelogenous leukemia IC50 : 50 µM
dbacp05273 Pep27 anal4 MWKEFHNVLSSGQLLADKRWARWYNRW Not found Inducing apoptosis MTT assay HL-60 Acute promyelocytic leukemia IC50 : 51 µM
dbacp05274 Pep27 anal4 MWKEFHNVLSSGQLLADKRWARWYNRW Not found Inducing apoptosis MTT assay Jurkat T-cell Leukemia IC50 : 46 µM
dbacp05277 Pep27 anal5 MWKWFHNVLSSGQLLADKWWAWWYNWW Not found Inducing apoptosis MTT assay AML-2 Acute myelogenous leukemia IC50 : > 70 µM
dbacp05278 Pep27 anal5 MWKWFHNVLSSGQLLADKWWAWWYNWW Not found Inducing apoptosis MTT assay HL-60 Acute promyelocytic leukemia IC50 : > 70 µM
dbacp05279 Pep27 anal5 MWKWFHNVLSSGQLLADKWWAWWYNWW Not found Inducing apoptosis MTT assay Jurkat T cell leukemia IC50 : > 70 µM
dbacp05282 Pep27anal1 MWKWFHNVLSSWQLLADKRPARDYNRK Pneumococcus Apoptosis inducing MTT/MTS assay AML-2 Leukemia cancer IC50 : 50 µM
dbacp05283 Pep27anal1 MWKWFHNVLSSWQLLADKRPARDYNRK Pneumococcus Apoptosis inducing MTT/MTS assay HL-60 Leukemia cancer IC50 : 53 µM
dbacp05287 Pep27anal2 MWKWFHNVLSWWWLLADKRPARDYNRK Pneumococcus Apoptosis inducing MTT/MTS assay AML-2 Leukemia cancer IC50 : 29 µM
dbacp05288 Pep27anal2 MWKWFHNVLSWWWLLADKRPARDYNRK Pneumococcus Apoptosis inducing MTT/MTS assay HL-60 Leukemia cancer IC50 : 20 µM
dbacp05292 Pep27anal3 MRKWFHNVLSSGQLLADKWPAWDYNRK Pneumococcus Apoptosis inducing MTT/MTS assay AML-2 Leukemia cancer IC50 : 67 µM
dbacp05293 Pep27anal3 MRKWFHNVLSSGQLLADKWPAWDYNRK Pneumococcus Apoptosis inducing MTT/MTS assay HL-60 Leukemia cancer IC50 : 52 µM
dbacp05297 Pep27anal4 MWKEFHNVLSSGQLLADKRWARWYNRW Pneumococcus Apoptosis inducing MTT/MTS assay AML-2 Leukemia cancer IC50 : 50 µM
dbacp05298 Pep27anal4 MWKEFHNVLSSGQLLADKRWARWYNRW Pneumococcus Apoptosis inducing MTT/MTS assay HL-60 Leukemia cancer IC50 : 51 µM
dbacp05302 Pep27anal5 MWKWFHNVLSSGQLLADKWWAWWYNWW Pneumococcus Apoptosis inducing MTT/MTS assay AML-2 Leukemia cancer IC50 : >70 µM
dbacp05303 Pep27anal5 MWKWFHNVLSSGQLLADKWWAWWYNWW Pneumococcus Apoptosis inducing MTT/MTS assay HL-60 Leukemia cancer IC50 : >70 µM
dbacp05322 Peptide 5 fCYwO-CyLeu-Pen-TKKrPKPfQwFwL-CyLeu-KKLMYPTYLKKfQWAV-Aib-HL Synthetic peptide of four designed analogs of vasoactive intestinal peptide, bombesin Not specified MTT/MTS assay MOLT-4 Leukemia cancer 10.4 % inhibition of cell proliferation at 1 nM
dbacp05323 Peptide 5 fCYwO-CyLeu-Pen-TKKrPKPfQwFwL-CyLeu-KKLMYPTYLKKfQWAV-Aib-HL Synthetic peptide of four designed analogs of vasoactive intestinal peptide, bombesin Not specified MTT/MTS assay MOLT-4 Leukemia cancer 18.7 % inhibition of cell proliferation at 10 nM
dbacp05324 Peptide 5 fCYwO-CyLeu-Pen-TKKrPKPfQwFwL-CyLeu-KKLMYPTYLKKfQWAV-Aib-HL Synthetic peptide of four designed analogs of vasoactive intestinal peptide, bombesin Not specified MTT/MTS assay MOLT-4 Leukemia cancer 34.7 % inhibition of cell proliferation at 100 nM
dbacp05325 Peptide 5 fCYwO-CyLeu-Pen-TKKrPKPfQwFwL-CyLeu-KKLMYPTYLKKfQWAV-Aib-HL Synthetic peptide of four designed analogs of vasoactive intestinal peptide, bombesin Not specified MTT/MTS assay MOLT-4 Leukemia cancer 54.3 % inhibition of cell proliferation at 1 µM
dbacp05326 Peptide 5 fCYwO-CyLeu-Pen-TKKrPKPfQwFwL-CyLeu-KKLMYPTYLKKfQWAV-Aib-HL Synthetic peptide of four designed analogs of vasoactive intestinal peptide, bombesin Not specified MTT/MTS assay MOLT-4 Leukemia cancer 94.5 % inhibition of cell proliferation at 10 µM
dbacp05330 Peptide 5 fCYwO-CyLeu-Pen-TKKrPKPfQwFwL-CyLeu-KKLMYPTYLKKfQWAV-Aib-HL Synthetic peptide of four designed analogs of vasoactive intestinal peptide, bombesin Not specified MTT/MTS assay MOLT-4 Leukemia cancer ED50 : 0.29 µM
dbacp05397 Peptide deformylase, mitochondrial MARLWGALSLWPLWAAVPWGGAAAVGVRACSSTAAPDGVEGPALRRSYWRHLRRLVLGPPEPPFSHVCQVGDPVLRGVAAPVERAQLGGPELQRLTQRLVQVMRRRRCVGLSAPQLGVPRQVLALELPEALCRECPPRQRALRQMEPFPLRVFVNPSLRVLDSRLVTFPEGCESVAGFLACVPRFQAVQISGLDPNGEQVVWQASGWAARIIQHEMDHLQGCLFIDKMDSRTFTNVYWMKVND Human Anti-proliferative effect Formate dehydrogenase–coupled PDF assay, Thymidine incorporation assay HL60 Leukemia IC50 ± SD : 9.3 ± 2.9 μM
dbacp05434 Peptide-1 IELLQARGGC-Pem Synthetic construct Cell membrane disintegration MTT/MTS assay HL-60 Leukemia cancer IC50 : 2.17 µM
dbacp05436 Peptide-2 IELLQARGGC-Pem-GGRRRRRRRR Synthetic construct Cell membrane disintegration MTT/MTS assay HL-60 Leukemia cancer IC50 : 2.64 µM
dbacp05438 Peptide-20 CSSRTMHHC Synthetic Peptide Inducing apoptosis MTT/MTS assay HL-60 Leukemia cancer At 100 µM 90% viablity
dbacp05445 Peptide-3 RRRRRRRRGGC-Pem Synthetic construct Cell membrane disintegration MTT/MTS assay HL-60 Leukemia cancer IC50 : 6.24 µM
dbacp05596 Polyphemusin II RRWCFRVCYKGFCYRKCR-NH2 Atlantic horseshoe crab Induce necrotic cell death Cell viability assay K562 Human erythroleukemia EC50 : 22 μM
dbacp05651 Protein farnesyltransferase subunit beta MASSSSFTYYCPPSSSPVWSEPLYSLRPEHARERLQDDSVETVTSIEQAKVEEKIQEVFSSYKFNHLVPRLVLQREKHFHYLKRGLRQLTDAYECLDASRPWLCYWILHSLELLDEPIPQIVATDVCQFLELCQSPDGGFGGGPGQYPHLAPTYAAVNALCIIGTEEAYNVINREKLLQYLYSLKQPDGSFLMHVGGEVDVRSAYCAASVASLTNIITPDLFEGTAEWIARCQNWEGGIGGVPGMEAHGGYTFCGLAALVILKKERSLNLKSLLQWVTSRQMRFEGGFQGRCNKLVDGCYSFWQAGLLPLLHRALHAQGDPALSMSHWMFHQQALQEYILMCCQCPAGGLLDKPGKSRDFYHTCYCLSGLSIAQHFGSGAMLHDVVMGVPENVLQPTHPVYNIGPDKVIQATTHFLQKPVPGFEECEDAVTSDPATD Rat Anti-proliferative effect Formate dehydrogenase–coupled PDF assay, Thymidine incorporation assay HL60 Leukemia IC50 : 9.3 ± 2.9 μM
dbacp05696 Psychrophilin D (1) lw Blue or green mold Not specified Cell viability assay P-388 Leukemia cancer ID50 : 10.1 µg/ml
dbacp05934 Retro LGGIVSAVKKIVDFLG Amphibian skin secretions Penetration and disruption of the membranes Sulforhodamine B assay Leukemia tumor cell line Leukemia cancer IC50 : 5 M
dbacp06033 Scolopendrasin VII FCTCNVKGFNAKNKRGIIYP Chinese red-headed centipede, Asia Necrotic cell death MTS assay U937 Leukemia Not found
dbacp06034 Scolopendrasin VII FCTCNVKGFNAKNKRGIIYP Chinese red-headed centipede, Asia Necrotic cell death MTS assay Jurkat Leukemia Not found
dbacp06075 Shiva-1 MPRWRLFRRIDRVGKQIKQGILRAGPAIALVGDARAVG African clawed frog Pore formation at the cytoplasmic membrane MTT/MTS assay K-562 Leukemia cancer IC50 : 28.7 µM
dbacp06082 Short α-helical peptide GIIKKIIKKI Alpha-helical proteins Cell membrane disruption; Cell apoptosis MTT/MTS assay HL-60 Leukemia cancer 100% Cytotoxicity at 4µM approx.
dbacp06083 Short α-helical peptide GIIKKIIKKIIKKI Alpha-helical proteins Cell membrane disruption; Cell apoptosis MTT/MTS assay HL-60 Leukemia cancer 90% Cytotoxicity at 4µM approx.
dbacp06084 Short α-helical peptide GIIKKIIKKIIKKIIKKI Alpha-helical proteins Cell membrane disruption; Cell apoptosis MTT/MTS assay HL-60 Leukemia cancer 70% Cytotoxicity at 5µM approx.
dbacp06123 SK84 SQLGDLGSGAGQGGGGGGSIRAAGGAFGKLEAAREEEFFYKKQKEQLERLKNDQIHQAEFHHQQIKEHEEAIQRHKDFLNNLHK Fruit fly Destroying the cell membranes Cell proliferation assay THP-1 Human Leukemia MIC : 4 – 8 mM
dbacp06301 Tf-D-LP4 HAIYPRHSWTWEKKLETAVNLAWTAGNSNKWTWK VDAC1(voltage-dependent anion channel1) Inducing apoptosis Not specified CLL Leukemia IC50 : 1.2 ± 0.1 µM
dbacp06302 Tf-D-LP4 HAIYPRHSWTWEKKLETAVNLAWTAGNSNKWTWK VDAC1(voltage-dependent anion channel1) Inducing apoptosis Not specified MEC-1 Leukemia IC50 : 1.8 ± 0.2 µM
dbacp06303 Tf-LP4 HAIYPRHSWTWEKKLETAVNLAWTAGNSNKWTWK VDAC1(voltage-dependent anion channel1) Inducing apoptosis Not specified CLL Leukemia IC50 : 1.7 ± 0.2 µM
dbacp06304 Tf-LP4 HAIYPRHSWTWEKKLETAVNLAWTAGNSNKWTWK VDAC1(voltage-dependent anion channel1) Inducing apoptosis Not specified MEC-1 Leukemia IC50 : 3.6 ± 0.2 µM
dbacp06464 Varv peptide B (Varv B; Plant defensin) GLPVCGETCFGGTCNTPGCSCDPWPMCSRN Field pansy Not specified Nonclonogenic fluorometric microculture cytotoxicity assay Not found Leukemia Not found
dbacp06465 Varv peptide C (Varv C; Plant defensin) GVPICGETCVGGTCNTPGCSCSWPVCTRN Field pansy Not specified Nonclonogenic fluorometric microculture cytotoxicity assay Not found Leukemia Not found
dbacp06466 Varv peptide D (Varv D; Plant defensin) GLPICGETCVGGSCNTPGCSCSWPVCTRN Field pansy Not specified Nonclonogenic fluorometric microculture cytotoxicity assay Not found Leukemia Not found
dbacp06475 Varv peptide F GVPICGETCTLGTCYTAGCSCSWPVCTRN Field pansy Cell membrane disintegration Not specified Not found Leukemia cancer Not found
dbacp06476 Varv peptide F GVPICGETCTLGTCYTAGCSCSWPVCTRN Field pansy Cell membrane disintegration Not specified Not found Leukemia cancer Not found
dbacp06482 Varv peptide G (Varv G; Plant defensin) GVPVCGETCFGGTCNTPGCSCDPWPVCSRN Field pansy Not specified Nonclonogenic fluorometric microculture cytotoxicity assay Not found Leukemia Not found
dbacp06483 Varv peptide H (Varv H; Plant defensin) GLPVCGETCFGGTCNTPGCSCETWPVCSRN Field pansy Not specified Nonclonogenic fluorometric microculture cytotoxicity assay U251 Leukemia IC50 : 44.70 µg/mL
dbacp06484 Varv peptide H (Varv H; Plant defensin) GLPVCGETCFGGTCNTPGCSCETWPVCSRN Field pansy Not specified Nonclonogenic fluorometric microculture cytotoxicity assay MDA-MB-231 Leukemia IC50 : >10 µg/mL
dbacp06485 Varv peptide H (Varv H; Plant defensin) GLPVCGETCFGGTCNTPGCSCETWPVCSRN Field pansy Not specified Nonclonogenic fluorometric microculture cytotoxicity assay A549 Leukemia IC50 : >10 µg/mL
dbacp06486 Varv peptide H (Varv H; Plant defensin) GLPVCGETCFGGTCNTPGCSCETWPVCSRN Field pansy Not specified Nonclonogenic fluorometric microculture cytotoxicity assay DU145 Leukemia IC50 : >10 µg/mL
dbacp06487 Varv peptide H (Varv H; Plant defensin) GLPVCGETCFGGTCNTPGCSCETWPVCSRN Field pansy Not specified Nonclonogenic fluorometric microculture cytotoxicity assay BEL-7402 Leukemia IC50 : >10 µg/mL
dbacp06494 Vibi E GIPCAESCVWIPCTVTALIGCGCSNKVCYN Alpine violet, Viola biflora Cell membrane disintegration Not specified Not found Leukemia cancer Not found
dbacp06532 VS-9 VKLRSLLCS Plant sources Inducing apoptosis MTT assay MOLT4 Leukemia Not found
dbacp06533 VS-9 VKLRSLLCS Plant sources Inducing apoptosis MTT assay K562 Leukemia Not found
dbacp06558 Z24 ALSKALSKALSKALSKALSKALSK African clawed frog Dissipate ion gradients; Induce osmotic lysis; Membrane damage Trypan blue assay 8402 Leukemia cancer IC50 : 83 µg/ml
dbacp06560 Z24 ALSKALSKALSKALSKALSKALSK African clawed frog Dissipate ion gradients; Induce osmotic lysis; Membrane damage Trypan blue assay Daudi Leukemia cancer IC50 : 143 µg/ml
dbacp06561 Z24 ALSKALSKALSKALSKALSKALSK African clawed frog Dissipate ion gradients; Induce osmotic lysis; Membrane damage Trypan blue assay MLA Leukemia cancer IC50 : 102 µg/ml
dbacp06563 Z24 ALSKALSKALSKALSKALSKALSK African clawed frog Dissipate ion gradients; Induce osmotic lysis; Membrane damage Trypan blue assay K-562 Leukemia cancer IC50 : 112 µg/ml
dbacp06574 Z44 ALSKALSKALSKALSKALSKALSK African clawed frog Dissipate ion gradients;Induce osmotic lysis; Membrane damage Trypan blue assay 8402 Leukemia cancer IC50 : 60 µg/ml
dbacp06577 Z44 ALSKALSKALSKALSKALSKALSK African clawed frog Dissipate ion gradients;Induce osmotic lysis; Membrane damage Trypan blue assay MLA Leukemia cancer IC50 : 80 µg/ml
dbacp06579 Z44 ALSKALSKALSKALSKALSKALSK African clawed frog Dissipate ion gradients;Induce osmotic lysis; Membrane damage Trypan blue assay K-562 Leukemia cancer IC50 : 98 µg/ml
dbacp06752 Salamandrin - I FAVWGCADYRGY Salamandra salamandra Pyroptosis mediated MTT assay HL-60 Leukemia Cancer IC50 = 27 µM
dbacp06753 Salamandrin - I FAVWGCADYRGY Salamandra salamandra Pyroptosis mediated LDH leakage assay HL-60 Leukemia Cancer Absorbance ~ 2 at 490 nm at 27 27 µM
dbacp06807 [C/U, G1K, L5Y, K8R]cGm KURRYUYRQRUVTYURGR Synthetic Analogue of Gomesin Cell membrane penetration Resazurin dye assay K-562 Leukemia Cancer CC50 = 6.4 ± 0.6 μM
dbacp06808 [C/U, G1K, L5Y, K8R]cGm KURRYUYRQRUVTYURGR Synthetic Analogue of Gomesin Cell membrane penetration Resazurin dye assay HL-60 Leukemia Cancer CC50 = 33.3 ±7.4μM
dbacp06813 [G1K, L5Y, K8R]cGm KCRRYCYRQRCVTYCRGR Synthetic Analogue of Gomesin Cell membrane penetration Resazurin dye assay K-562 Leukemia Cancer CC50 = 1.3 ± 0.1 μM
dbacp06814 [G1K, L5Y, K8R]cGm KCRRYCYRQRCVTYCRGR Synthetic Analogue of Gomesin Cell membrane penetration Resazurin dye assay HL-60 Leukemia Cancer CC50 = 15.7 ±1.1μM
dbacp06818 [D-P L-P]cGm GCRRLCYKQRCVTYCRGpPR Synthetic Analogue of Gomesin Cell membrane penetration Resazurin dye assay K-562 Leukemia Cancer CC50 = 3.9 ± 0.2 μM
dbacp06823 [C/U]cGm GURRLUYKQRUVTYURGR Synthetic Analogue of Gomesin Cell membrane penetration Resazurin dye assay K-562 Leukemia Cancer CC50 = 1.4 ± 0.2 μM
dbacp06824 [C/U]cGm GURRLUYKQRUVTYURGR Synthetic Analogue of Gomesin Cell membrane penetration Resazurin dye assay HL-60 Leukemia Cancer CC50 = 38.5 ± 4.8 μM
dbacp06829 [G1K, K8R]cGm KCRRLCYRQRCVTYCRGR Synthetic Analogue of Gomesin Cell membrane penetration Resazurin dye assay K-562 Leukemia Cancer CC50 = 2.1 ± 0.2 μM
dbacp06830 [G1K, K8R]cGm KCRRLCYRQRCVTYCRGR Synthetic Analogue of Gomesin Cell membrane penetration Resazurin dye assay HL-60 Leukemia Cancer CC50 = 9.0 ± 1.1μM
dbacp06835 [R4A, R18A]cGm GCRALCYKQRCVTYCRGA Synthetic Analogue of Gomesin Cell membrane penetration Resazurin dye assay K-562 Leukemia Cancer CC50 = 11.5 ± 0.6 μM
dbacp06836 [R4A, R18A]cGm GCRALCYKQRCVTYCRGA Synthetic Analogue of Gomesin Cell membrane penetration Resazurin dye assay HL-60 Leukemia Cancer CC50 = 34.1 ± 3.9 μM
dbacp06841 [Y7W, K8R, Y14W]cGm GCRRLCWRQRCVTWCRGR Synthetic Analogue of Gomesin Cell membrane penetration Resazurin dye assay K-562 Leukemia Cancer CC50 = 3.9 ± 0.1 μM
dbacp07807 cT1 KWCFRVCYRGICYRRCRG Synthetic Not Available Resazurin dye assay K-562 Leukemia Cancer CC50 = 2.0 ± 0.1 µM
dbacp07812 [R/K]cT1 KWCFKVCYKGICYKKCKG Synthetic Not Available Resazurin dye assay K-562 Leukemia Cancer CC50 = 2.5 ± 0.1 µM
dbacp07818 [W2S]cT1 KSCFRVCYRGICYRRCRG Synthetic Not Available Resazurin dye assay K-562 Leukemia Cancer CC50 = 2.7 ± 0.2 µM
dbacp07823 [Y8S-I11S]cT1 KWCFRVCSRGSCYRRCRG Synthetic Not Available Resazurin dye assay K-562 Leukemia Cancer CC50 = 13.2 ± 0.9 µM
dbacp07837 [R9S-R14S-R17S]cT1 KWCFRVCYSGICYSRCSG Synthetic Not Available Resazurin dye assay K-562 Leukemia Cancer CC50 = 4.8 ± 0.3 µM
dbacp07841 [G18K]cT1 KWCFRVCYRGICYRRCRK Synthetic Not Available Resazurin dye assay K-562 Leukemia Cancer CC50 = 1.7 ± 0.1 µM
dbacp07846 [I11F-G18K]cT1 KWCFRVCYRGFCYRRCRK Synthetic Not Available Resazurin dye assay K-562 Leukemia Cancer CC50 = 1.9 ± 0.1 µM
dbacp08089 B1 KKLFKKILKYLK Analogue of BP 100 Membrane disruption triggers apoptosis MTT assay K-562 Leukemia Cancer IC50 = 17.9 ± 1.4 μM
dbacp08092 B1 KKLFKKILKYLK Analogue of BP 100 Membrane disruption triggers apoptosis MTT assay K-562/ADM Leukemia Cancer IC50 = 19.1 ± 2.1 μM
dbacp08093 B2 KKLFKKILKYLKK Analogue of BP 100 Membrane disruption triggers apoptosis MTT assay K-562 Leukemia Cancer IC50 = 33.6 ± 4.2 μM
dbacp08096 B2 KKLFKKILKYLKK Analogue of BP 100 Membrane disruption triggers apoptosis MTT assay K-562/ADM Leukemia Cancer IC50 = 39.6 ± 5.7 μM
dbacp08097 B3 KKLFKKILKYLKKL Analogue of BP 100 Membrane disruption triggers apoptosis MTT assay K-562 Leukemia Cancer IC50 = 47.4 ± 12.5 μM
dbacp08100 B5 LKKLFKKILKYLK Analogue of BP 100 Membrane disruption triggers apoptosis MTT assay K-562 Leukemia Cancer IC50 = 26.5 ± 1.5 μM
dbacp08103 B5 LKKLFKKILKYLK Analogue of BP 100 Membrane disruption triggers apoptosis MTT assay K-562/ADM Leukemia Cancer IC50 = 28.3 ± 2.3 μM
dbacp08104 B6 LKKLFKKILKYLKK Analogue of BP 100 Membrane disruption triggers apoptosis MTT assay K-562 Leukemia Cancer IC50 = 19.2 ± 2.3 μM
dbacp08107 B6 LKKLFKKILKYLKK Analogue of BP 100 Membrane disruption triggers apoptosis MTT assay K-562/ADM Leukemia Cancer IC50 = 22.7 ± 2.3 μM
dbacp08108 B9 KLKKLFKKILKY Analogue of BP 100 Membrane disruption triggers apoptosis MTT assay K-562 Leukemia Cancer IC50 = 60.7 ± 5.4 μM
dbacp08111 B9 KLKKLFKKILKY Analogue of BP 100 Membrane disruption triggers apoptosis MTT assay K-562/ADM Leukemia Cancer IC50 = 83.7 ± 5.3 μM
dbacp08349 LPSBD-0 CQYSVNPKIKRFELYFKGRMW Synthetic Not Available Not Available THP-1 Leukemia Cancer Not Available
dbacp08350 LPSBD-2 CHYRVKPKIKRFEKYKGRMW Synthetic Not Available Not Available THP-1 Leukemia Cancer Not Available
dbacp08377 IDP-wtL05 RKRRNDLRSRFLALRDQ Synthetic Not Available MTT/Alamamar-Blue/Hexosaminidase activity test RPMI Leukemia Cancer EC50 ~ 10 μM
dbacp08378 IDP-LS05 RKRRNDLRSRFLALRDQ Synthetic Not Available MTT/Alamamar-Blue/Hexosaminidase activity test HL-60 Leukemia Cancer EC50 ~ 5 μM
dbacp08379 IDP-LS05 RKRRNDLRSRFLALRDQ Synthetic Not Available MTT/Alamamar-Blue/Hexosaminidase activity test RPMI Leukemia Cancer EC50 ~ 6 μM
dbacp08381 IDP-LS13 RKRRNDLRSRFLALRDQ Synthetic Not Available MTT/Alamamar-Blue/Hexosaminidase activity test HL-60 Leukemia Cancer EC50 ~ 7 μM
dbacp08382 IDP-LS13 RKRRNDLRSRFLALRDQ Synthetic Not Available MTT/Alamamar-Blue/Hexosaminidase activity test RPMI Leukemia Cancer EC50 ~ 9 μM
dbacp08384 IDP-LS15 RKRRNDLRSRFLALRDQ Synthetic Not Available MTT/Alamamar-Blue/Hexosaminidase activity test RPMI Leukemia Cancer EC50 ~ 7 μM
dbacp08386 IDP-LS16 APKVVILSKALEYLQA Synthetic Not Available MTT/Alamamar-Blue/Hexosaminidase activity test RPMI Leukemia Cancer EC50 ~ 15 μM
dbacp08388 IDP-LS17 APKVVILSKALEYLQA Synthetic Not Available MTT/Alamamar-Blue/Hexosaminidase activity test RPMI Leukemia Cancer EC50 ~ 10 μM