dbACP: A Comprehensive Database of Anti-Cancer Peptides

1782 result(s) have been found!

Accession Name Sequence Source/Organism Mechanism Assay Type Cell Line Cancer Type Activity
dbacp00303 Temporin-SHf FFFLSRIF* Sahara frog Apoptosis inducing MTT assay A549 Not specified IC50 : 24.03 ± 0.945 µM
dbacp00304 Temporin-SHf FFFLSRIF* Sahara frog Apoptosis inducing MTT assay MCF-7 Not specified IC50 : 32.76 ± 1.528 µM
dbacp00305 Temporin-SHf FFFLSRIF* Sahara frog Apoptosis inducing MTT assay HepG2 Not specified IC50 : 32.64 ± 1.350 µM
dbacp00306 Temporin-SHf FFFLSRIF* Sahara frog Apoptosis inducing MTT assay PC3 Not specified IC50 : 36.67 ± 0.729 µM
dbacp00309 (Bl- LAAO) L-amino acid oxidases (L-AAO) ADDRNPLEECFRETDYEEFLEIAKNGLSTT Venom base Apoptosis inducing MTT assay MKN-45 Stomach cancer Not found
dbacp00310 (Bl- LAAO) L-amino acid oxidases (L-AAO) ADDRNPLEECFRETDYEEFLEIAKNGLSTT Venom base Apoptosis inducing MTT assay HUTU Adenocarcinoma Not found
dbacp00311 (Bl- LAAO) L-amino acid oxidases (L-AAO) ADDRNPLEECFRETDYEEFLEIAKNGLSTT Venom base Apoptosis inducing MTT assay RKO Colorectal cancer Not found
dbacp00402 [D-Ala]- nocardiotide A Ac-cyclo(FSRM)-NH2 ​ Marine sponge Cell membrane permeation MTT assay HeLa Not specified IC50 : 52 μM
dbacp00720 5-FU NA Not found Cell membrane penetrating MTT assay UM-UC-5 Not specified IC50 : 4.21μM
dbacp00721 5-FU NA Not found Cell membrane penetrating MTT assay A549 Not specified IC50 : 2.42 μM
dbacp00817 AaeAP1 FLFSLIPSVIAGLVSAIRN Aeneas fattailed scorpion Not specified MTT assay H460 Prostate cancer Not found
dbacp00818 AaeAP1 FLFSLIPSVIAGLVSAIRN Aeneas fattailed scorpion Not specified MTT assay MB435s Prostate cancer Not found
dbacp00819 AaeAP1 FLFSLIPSVIAGLVSAIRN Aeneas fattailed scorpion Not specified MTT assay MCF-7 Prostate cancer Not found
dbacp00820 AaeAP1 FLFSLIPSVIAGLVSAIRN Aeneas fattailed scorpion Not specified MTT assay PC3 Prostate cancer Not found
dbacp00821 AaeAP1 FLFSLIPSVIAGLVSAIRN Venom, Aeneas fattailed scorpion, Africa Membrane lysis MTT assay NCI-H460 Human lung adenocarcinoma MIC : 10−4 to 10−9 M
dbacp00822 AaeAP1 FLFSLIPSVIAGLVSAIRN Venom, Aeneas fattailed scorpion, Africa Membrane lysis MTT assay MB435s Human breast carcinoma MIC : 10−4 to 10−9 M
dbacp00823 AaeAP1 FLFSLIPSVIAGLVSAIRN Venom, Aeneas fattailed scorpion, Africa Membrane lysis MTT assay MCF-7 Non-tumourigenic mammary gland cancer MIC : 10−4 to 10−9 M
dbacp00824 AaeAP1 FLFSLIPSVIAGLVSAIRN Venom, Aeneas fattailed scorpion, Africa Membrane lysis MTT assay PC-3 Human prostate carcinoma MIC : 10−4 to 10−9 M
dbacp00825 AaeAP2 FLFSLIPSAIAGLVSAIRN Aeneas fattailed scorpion Not specified MTT assay H460 Prostate cancer Not found
dbacp00826 AaeAP2 FLFSLIPSAIAGLVSAIRN Aeneas fattailed scorpion Not specified MTT assay MB435s Prostate cancer Not found
dbacp00827 AaeAP2 FLFSLIPSAIAGLVSAIRN Aeneas fattailed scorpion Not specified MTT assay MCF-7 Prostate cancer Not found
dbacp00828 AaeAP2 FLFSLIPSAIAGLVSAIRN Aeneas fattailed scorpion Not specified MTT assay PC3 Prostate cancer Not found
dbacp00829 AaeAP2 FLFSLIPSAIAGLVSAIRN Venom, Aeneas fattailed scorpion, Africa Membrane lysis MTT assay NCI-H460 Human lung adenocarcinoma MIC : 10−4 to 10−9 M
dbacp00830 AaeAP2 FLFSLIPSAIAGLVSAIRN Venom, Aeneas fattailed scorpion, Africa Membrane lysis MTT assay MB435s Human breast carcinoma MIC : 10−4 to 10−9 M
dbacp00831 AaeAP2 FLFSLIPSAIAGLVSAIRN Venom, Aeneas fattailed scorpion, Africa Membrane lysis MTT assay MCF-7 Non-tumourigenic mammary gland cancer MIC : 10−4 to 10−9 M
dbacp00832 AaeAP2 FLFSLIPSAIAGLVSAIRN Venom, Aeneas fattailed scorpion, Africa Membrane lysis MTT assay PC-3 Human prostate carcinoma MIC : 10−4 to 10−9 M
dbacp00833 AAP-H YVPGP Marine invertebrates Apoptosis inducing MTT assay DU-145 Prostate cancer IC50 : 9.605 mM
dbacp00834 AAP-H YVPGP Marine invertebrates Apoptosis inducing MTT assay DU-146 Prostate cancer IC50 : 7.910 mM
dbacp00835 AAP-H YVPGP Marine invertebrates Apoptosis inducing MTT assay DU-147 Prostate cancer IC50 : 2.298 mM
dbacp00951 ABP-dHC-Cecropin A RWKIFKKIERVGQNVRDGIIKAGPAIQVLGTAKALGK Synthetic construct Apoptosis inducing MTT assay K562 cells Leukemia IC50 : 349.5 μM
dbacp00952 ABP-dHC-Cecropin A RWKIFKKIERVGQNVRDGIIKAGPAIQVLGTAKALGK Synthetic construct Apoptosis inducing MTT assay U937 cells Leukemia IC50 : 303.2 μM
dbacp00953 ABP-dHC-Cecropin A RWKIFKKIERVGQNVRDGIIKAGPAIQVLGTAKALGK Synthetic construct Apoptosis inducing MTT assay THP-1 cells Leukemia IC50 : 228.5 μM
dbacp00954 ABP-dHC-Cecropin A-K RWKIFKKIERVGQNVRDGIIKAGKAIQVLGTAKALGK Synthetic construct Apoptosis inducing MTT assay K562 cells Leukemia IC50 : 349.5 μM
dbacp00955 ABP-dHC-Cecropin A-K RWKIFKKIERVGQNVRDGIIKAGKAIQVLGTAKALGK Synthetic construct Apoptosis inducing MTT assay U937 cells Leukemia IC50 : 303.2 μM
dbacp00956 ABP-dHC-Cecropin A-K RWKIFKKIERVGQNVRDGIIKAGKAIQVLGTAKALGK Synthetic construct Apoptosis inducing MTT assay THP-1 cells Leukemia IC50 : 228.5 μM
dbacp01193 ATAP-iRGD peptide-Parental KFEPKSGWMTFLEVTGKIAEMLSLLKQYCRGDKGPDC Anti apoptotic (MCL-1, BFL1) Inducing apoptosis MTT assay DU-145 Prostate cancer IC50 : 1.6 μM
dbacp01194 ATAP-iRGD-M1 AFEPKSGWMTFLEVTGKIAEMLSLLKQYCRGDKGPDC Anti apoptotic (MCL-1, BFL1) Inducing apoptosis MTT assay DU-145 Prostate cancer IC50 : 36 μM
dbacp01195 ATAP-iRGD-M2 LFEPKSGWMTFLEVTGKIAEMLSLLKQYCRGDKGPDC Anti apoptotic (MCL-1, BFL1) Inducing apoptosis MTT assay DU-145 Prostate cancer IC50 : 68 μM
dbacp01196 ATAP-iRGD-M3 KFEPLSGWMTFLEVTGKIAEMLSLLKQYCRGDKGPDC Anti apoptotic (MCL-1, BFL1) Inducing apoptosis MTT assay DU-145 Prostate cancer IC50 : 25 μM
dbacp01197 ATAP-iRGD-M5 KFEPKSGWETFLEVTGKIAEMLSLLKQYCRGDKGPDC Anti apoptotic (MCL-1, BFL1) Inducing apoptosis MTT assay DU-145 Prostate cancer IC50 : 6 μM
dbacp01198 ATAP-iRGD-M6 KKFEPKSGWMTFLEVTGKIAEMLSLLKQYCRGDKGPDC Anti apoptotic (MCL-1, BFL1) Inducing apoptosis MTT assay DU-145 Prostate cancer IC50 : 3.1 μM
dbacp01199 ATAP-iRGD-M7 KFEPKSGWMTFLEVTGKIAEMLSLLKQYCRGDKGPDC Anti apoptotic (MCL-1, BFL1) Inducing apoptosis MTT assay DU-145 Prostate cancer IC50 : 2.1 μM
dbacp01200 ATAP-iRGD-M8 KKFEPKSGWMTFLEVTGKIAEMLSLLKQYCRGDKGPDC Anti apoptotic (MCL-1, BFL1) Inducing apoptosis MTT assay DU-145 Prostate cancer IC50 : 2.1 μM
dbacp01432 B1AW FLPLLAGLAANFLPQIICKIARKC Wuyi torrent frog Cell membrane penetration MTT assay PC-3 Human prostatic cancer IC50 : 33.46 μM
dbacp01433 B1AW FLPLLAGLAANFLPQIICKIARKC Wuyi torrent frog Cell membrane penetration MTT assay H838 Non-small lung cancer IC50 : 32.15 μM
dbacp01434 B1AW FLPLLAGLAANFLPQIICKIARKC Wuyi torrent frog Cell membrane penetration MTT assay U251MG Glioblastoma cancer IC50 : 33.56 μM
dbacp01435 B1AW FLPLLAGLAANFLPQIICKIARKC Wuyi torrent frog Cell membrane penetration MTT assay HMEC-1 Glioblastoma cancer IC50 : 32.96 μM
dbacp01436 B1AW FLPLLAGLAANFLPQIICKIARKC Wuyi torrent frog Cell membrane penetration MTT assay HaCaT Glioblastoma cancer IC50 : 44.09 μM
dbacp01437 B1AW-K FLPLLAGLAANFLPKIICKIARKC Wuyi torrent frog Cell membrane penetration MTT assay PC-3 Prostate cancer IC50 : 33.46 μM
dbacp01442 Baceridin cyclo(L-Trp-D-Ala-D-allo-Ile-L-Val-D-Leu-L-Leu-) Synthetic construct Apoptosis inducing MTT assay HCT116 Not specified Not found
dbacp01443 Baceridin cyclo(L-Trp-D-Ala-D-allo-Ile-L-Val-D-Leu-L-Leu-) Synthetic construct Apoptosis inducing MTT assay RKO Not specified Not found
dbacp01444 Baceridin cyclo(L-Trp-D-Ala-D-allo-Ile-L-Val-D-Leu-L-Leu-) Synthetic construct Apoptosis inducing MTT assay HeLa Not specified Not found
dbacp01445 Baceridin WAIVLL Plant-associated rod-shaped, Gram-positive bacteria Apoptosis inducing MTT assay HCT116 Not specified Not found
dbacp01446 Baceridin WAIVLL Plant-associated rod-shaped, Gram-positive bacteria Apoptosis inducing MTT assay RKO Not specified Not found
dbacp01447 Baceridin WAIVLL Plant-associated rod-shaped, Gram-positive bacteria Apoptosis inducing MTT assay HeLa Not specified Not found
dbacp01628 BIM BH3 (E158S) EIWIAQELRRIGDSFNAYYAR BH3-only, Direct activators, BIM analogues Inducing apoptosis MTT assay Not found Prostate cancer Not found
dbacp01629 BIM BH3 (I155R, E158A) EIWIAQELRRRGDAFNAYYAR BH3-only, Direct activators, BIM analogues Inducing apoptosis MTT assay Not found Prostate cancer Not found
dbacp01630 BIM BH3 (I155R, E158S) EIWIAQELRRRGDSFNAYYAR BH3-only, Direct activators, BIM analogues Inducing apoptosis MTT assay Not found Prostate cancer Not found
dbacp01631 BIM BH3 (R154S, I155R, E158S) EIWIAQELRSRGDSFNAYYAR BH3-only, Direct activators, BIM analogues Inducing apoptosis MTT assay Not found Prostate cancer Not found
dbacp01815 BIM XXA1 RPEIWYAQGLKRFGDEFNAYYAR BH3-only, Direct activators, BIM analogues Inducing apoptosis MTT assay Not found Prostate cancer Not found
dbacp01840 BIRD-2 (Bcl-2 IP3R disrupter 2) RKKRRQRRRGGNVYTEIKCNSLLPLAAIVRV Not found Inducing apoptosis MTT assay DLBCL Leukemia Not found
dbacp01841 BIRD-2 (Bcl-2 IP3R disrupter 2) RKKRRQRRRGGNVYTEIKCNSLLPLAAIVRV Not found Inducing apoptosis MTT assay CLL Leukemia Not found
dbacp01843 BLP-7 GIGGALLSAGKSALKGLAKGLAEHFAN Oriental Fire-bellied Toad Cell membrane Permeabilization MTT assay Hep G2 Human hepatoma IC50 : 2.83 μM
dbacp01844 BLP-7 GIGGALLSAGKSALKGLAKGLAEHFAN Oriental Fire-bellied Toad Cell membrane Permeabilization MTT assay SK-HEP-1 Human hepatoma IC50 : 0.61μM
dbacp01845 BLP-7 GIGGALLSAGKSALKGLAKGLAEHFAN Oriental Fire-bellied Toad Cell membrane Permeabilization MTT assay Huh7 Human hepatoma IC50 : 3.87 μM
dbacp01851 Bombina orientalis Bombinin H-BO1 IIGPVLGLVGKALGGLL Oriental Fire-bellied Toad Bombinin H-BO1 Anti-proliferative effects MTT assay Hep G2 Human hepatoma IC50 : 3.61 μM
dbacp01852 Bombina orientalis Bombinin H-BO1 IIGPVLGLVGKALGGLL Oriental Fire-bellied Toad Bombinin H-BO1 Anti-proliferative effects MTT assay SK-HEP-1 Human hepatoma IC50 : 8.08 μM
dbacp01853 Bombina orientalis Bombinin H-BO2 IIGPVLGLVGKALGGLL Oriental Fire-bellied Toad Bombinin H-BO1 Anti-proliferative effects MTT assay Huh7 Human hepatoma IC50 : 8.42 μM
dbacp01854 Bombina orientalis Bombinin H-BO3 GIGSAILSAGKSIIKGLAKGLAEHF Oriental Fire-bellied Toad Bombinin H-BO1 Anti-proliferative effects MTT assay Hep G2 Human hepatoma IC50 : 3.61 μM
dbacp01855 Bombina orientalis Bombinin H-BO4 GIGSAILSAGKSIIKGLAKGLAEHF Oriental Fire-bellied Toad Bombinin H-BO1 Anti-proliferative effects MTT assay SK-HEP-1 Human hepatoma IC50 : 8.08 μM
dbacp01856 Bombina orientalis Bombinin H-BO5 GIGSAILSAGKSIIKGLAKGLAEHF Oriental Fire-bellied Toad Bombinin H-BO1 Anti-proliferative effects MTT assay Huh7 Human hepatoma IC50 : 8.42 μM
dbacp01857 Bombinin H-BO IIGPVLGLIGKALGGLL Oriental Fire-bellied Toad Cell Membrane Permeabilization MTT assay Hep G2 Human hepatoma IC50 : 3.87μM
dbacp01858 Bombinin H-BO IIGPVLGLIGKALGGLL Oriental Fire-bellied Toad Cell Membrane Permeabilization MTT assay SK-HEP-1 Human hepatoma IC50 : 1.81 μM
dbacp01859 Bombinin H-BO IIGPVLGLIGKALGGLL Oriental Fire-bellied Toad Cell Membrane Permeabilization MTT assay Huh8 Human hepatoma IC50 : 1.81 μM
dbacp01860 Bombinin H-BO1 IIGPVLGLVGKALGGLL Oriental Fire-bellied Toad Anti-proliferative effects MTT assay Hep G2 Human hepatoma IC50 : 3.61 μM
dbacp01861 Bombinin H-BO1 IIGPVLGLVGKALGGLL Oriental Fire-bellied Toad Anti-proliferative effects MTT assay SK-HEP-1 Human hepatoma IC50 : 8.08 μM
dbacp01862 Bombinin H-BO1 IIGPVLGLVGKALGGLL Oriental Fire-bellied Toad Anti-proliferative effects MTT assay Huh8 Human hepatoma IC50 : 8.42 μM
dbacp01863 Bombinin H-BO1 IIGPVLGLVGKALGGLL Skin secretion, Oriental fire-bellied toad, China, Asia Anti-proliferative effects MTT assay Hep G2 Human hepatoma cancer IC50 : 3.61 μM
dbacp01864 Bombinin H-BO1 IIGPVLGLVGKALGGLL Skin secretion, Oriental fire-bellied toad, China, Asia Anti-proliferative effects MTT assay SK-HEP-1 Human hepatoma cancer IC50 : 8.08 μM
dbacp01865 Bombinin H-BO1 IIGPVLGLVGKALGGLL Skin secretion, Oriental fire-bellied toad, China, Asia Anti-proliferative effects MTT assay Huh7 Human hepatoma cancer IC50 : 8.42 μM
dbacp01867 Bombinin-BO1 GIGSAILSAGKSIIKGLAKGLAEHF Oriental Fire-bellied Toad Anti-proliferative effects MTT assay Hep G2 Human hepatoma IC50 : 3.61 μM
dbacp01868 Bombinin-BO1 GIGSAILSAGKSIIKGLAKGLAEHF Oriental Fire-bellied Toad Anti-proliferative effects MTT assay SK-HEP-1 Human hepatoma IC50 : 8.08 μM
dbacp01869 Bombinin-BO1 GIGSAILSAGKSIIKGLAKGLAEHF Oriental Fire-bellied Toad Anti-proliferative effects MTT assay Huh8 Human hepatoma IC50 : 8.42 μM
dbacp01870 Bombinin-BO1 GIGSAILSAGKSIIKGLAKGLAEHF Skin secretion, Oriental fire-bellied toad, China, Asia Anti-proliferative effects MTT assay Hep G2 Human hepatoma cancer IC50 : 0.76 μM
dbacp01871 Bombinin-BO1 GIGSAILSAGKSIIKGLAKGLAEHF Skin secretion, Oriental fire-bellied toad, China, Asia Anti-proliferative effects MTT assay SK-HEP-1 Human hepatoma cancer IC50 : 3.75 μM
dbacp01872 Bombinin-BO1 GIGSAILSAGKSIIKGLAKGLAEHF Skin secretion, Oriental fire-bellied toad, China, Asia Anti-proliferative effects MTT assay Huh7 Human hepatoma cancer IC50 : 3.91 μM
dbacp01874 Bombinins BLP-7 GH-2 [Cleaved into: Bombinin-like peptide 7 (BLP-7); Bombinin GH-2] MNFKYIVAVSFLIASTYARSVKNDEQSLSQRDVLEEESLREIRGIGGALLSAGKSALKGLAKGLAEHFANGKRTAEEHEVMKRLEAVMRDLDSLDYPEEASEMETRSFNQEEIANLFTKKEKRILGPVLDLVGRALRGLLKKIG Oriental fire-bellied toad Anti-proliferative action MTT assay SK-HEP-1 cells Human hepatoma IC50 : 0.61 μM
dbacp01875 Bombinins BLP-7 GH-2 [Cleaved into: Bombinin-like peptide 7 (BLP-7); Bombinin GH-2] MNFKYIVAVSFLIASTYARSVKNDEQSLSQRDVLEEESLREIRGIGGALLSAGKSALKGLAKGLAEHFANGKRTAEEHEVMKRLEAVMRDLDSLDYPEEASEMETRSFNQEEIANLFTKKEKRILGPVLDLVGRALRGLLKKIG Oriental fire-bellied toad Anti-proliferative action MTT assay SK-HEP-1 cells Human hepatoma IC50 : 0.99 μM
dbacp01876 Bombinins BLP-7 GH-2 [Cleaved into: Bombinin-like peptide 7 (BLP-7); Bombinin GH-2] MNFKYIVAVSFLIASTYARSVKNDEQSLSQRDVLEEESLREIRGIGGALLSAGKSALKGLAKGLAEHFANGKRTAEEHEVMKRLEAVMRDLDSLDYPEEASEMETRSFNQEEIANLFTKKEKRILGPVLDLVGRALRGLLKKIG Oriental fire-bellied toad Anti-proliferative action MTT assay Hep G2 cells Human hepatoma IC50 : 2.83 μM
dbacp01877 Bombinins BLP-7 GH-2 [Cleaved into: Bombinin-like peptide 7 (BLP-7); Bombinin GH-2] MNFKYIVAVSFLIASTYARSVKNDEQSLSQRDVLEEESLREIRGIGGALLSAGKSALKGLAKGLAEHFANGKRTAEEHEVMKRLEAVMRDLDSLDYPEEASEMETRSFNQEEIANLFTKKEKRILGPVLDLVGRALRGLLKKIG Oriental fire-bellied toad Anti-proliferative action MTT assay Hep G2 cells Human hepatoma IC50 : 2.88 μM
dbacp01878 Bombinins BLP-7 GH-2 [Cleaved into: Bombinin-like peptide 7 (BLP-7); Bombinin GH-2] MNFKYIVAVSFLIASTYARSVKNDEQSLSQRDVLEEESLREIRGIGGALLSAGKSALKGLAKGLAEHFANGKRTAEEHEVMKRLEAVMRDLDSLDYPEEASEMETRSFNQEEIANLFTKKEKRILGPVLDLVGRALRGLLKKIG Oriental fire-bellied toad Anti-proliferative action MTT assay Huh7 cells Human hepatoma IC50 : 3.87 μM
dbacp01879 Bombinins BLP-7 GH-2 [Cleaved into: Bombinin-like peptide 7 (BLP-7); Bombinin GH-2] MNFKYIVAVSFLIASTYARSVKNDEQSLSQRDVLEEESLREIRGIGGALLSAGKSALKGLAKGLAEHFANGKRTAEEHEVMKRLEAVMRDLDSLDYPEEASEMETRSFNQEEIANLFTKKEKRILGPVLDLVGRALRGLLKKIG Oriental fire-bellied toad Anti-proliferative action MTT assay Huh7 cells Human hepatoma IC50 : 1.81 μM
dbacp01880 Bombinins BLP-7 H-BO [Cleaved into: Bombinin-like peptide 7 (BLP-7); Bombinin H-BO] MNFKYIIAVSFLIASTYARSVKNDEQSLSQRDVLDEESLREIRGIGGALLSAGKSALKGLAKGLAEHFANGKRTAEEHEVMKRLEAVMRDLDSLDHPEEASEKETRGFNQEEIANLFTKKEKRIIGPVLGLIGKALGGLLG Oriental fire-bellied toad Not specified MTT assay SK-HEP-1 Human hepatoma IC50 : 0.61 μM
dbacp01881 Bombinins BLP-7 H-BO [Cleaved into: Bombinin-like peptide 7 (BLP-7); Bombinin H-BO] MNFKYIIAVSFLIASTYARSVKNDEQSLSQRDVLDEESLREIRGIGGALLSAGKSALKGLAKGLAEHFANGKRTAEEHEVMKRLEAVMRDLDSLDHPEEASEKETRGFNQEEIANLFTKKEKRIIGPVLGLIGKALGGLLG Oriental fire-bellied toad Not specified MTT assay SK-HEP-1 Human hepatoma IC50 : 0.99 μM
dbacp01882 Bombinins BLP-7 H-BO [Cleaved into: Bombinin-like peptide 7 (BLP-7); Bombinin H-BO] MNFKYIIAVSFLIASTYARSVKNDEQSLSQRDVLDEESLREIRGIGGALLSAGKSALKGLAKGLAEHFANGKRTAEEHEVMKRLEAVMRDLDSLDHPEEASEKETRGFNQEEIANLFTKKEKRIIGPVLGLIGKALGGLLG Oriental fire-bellied toad Not specified MTT assay Hep G2 Human hepatoma IC50 : 2.83μM
dbacp01883 Bombinins BLP-7 H-BO [Cleaved into: Bombinin-like peptide 7 (BLP-7); Bombinin H-BO] MNFKYIIAVSFLIASTYARSVKNDEQSLSQRDVLDEESLREIRGIGGALLSAGKSALKGLAKGLAEHFANGKRTAEEHEVMKRLEAVMRDLDSLDHPEEASEKETRGFNQEEIANLFTKKEKRIIGPVLGLIGKALGGLLG Oriental fire-bellied toad Not specified MTT assay Hep G2 Human hepatoma IC50 : 0.99 μM
dbacp01884 Bombinins BLP-7 H-BO [Cleaved into: Bombinin-like peptide 7 (BLP-7); Bombinin H-BO] MNFKYIIAVSFLIASTYARSVKNDEQSLSQRDVLDEESLREIRGIGGALLSAGKSALKGLAKGLAEHFANGKRTAEEHEVMKRLEAVMRDLDSLDHPEEASEKETRGFNQEEIANLFTKKEKRIIGPVLGLIGKALGGLLG Oriental fire-bellied toad Not specified MTT assay Huh7 Human hepatoma IC50 : 3.87μM
dbacp01885 Bombinins BLP-7 H-BO [Cleaved into: Bombinin-like peptide 7 (BLP-7); Bombinin H-BO] MNFKYIIAVSFLIASTYARSVKNDEQSLSQRDVLDEESLREIRGIGGALLSAGKSALKGLAKGLAEHFANGKRTAEEHEVMKRLEAVMRDLDSLDHPEEASEKETRGFNQEEIANLFTKKEKRIIGPVLGLIGKALGGLLG Oriental fire-bellied toad Not specified MTT assay Huh7 Human hepatoma IC50 : 1.81 μM
dbacp01892 BPC194 KKLKKFKKLQ Synthetic Peptide Inducing apoptosis MTT assay MDA-MB-231 Cervical cancer IC50 : 32.5 ± 0.5 μM
dbacp01893 BPC194 KKLKKFKKLQ Synthetic Peptide Inducing apoptosis MTT assay HeLa Cervical cancer IC50 : 29.5 ± 2 μM
dbacp01894 BPC194 KKLKKFKKLQ Synthetic Peptide Inducing apoptosis MTT assay HepG2 Cervical cancer IC50 : 46.0 ± 3 μM
dbacp01895 BPC194 KKLKKFKKLQ Synthetic Peptide Inducing apoptosis MTT assay A431 Cervical cancer IC50 : 50.0 ± 10 μM
dbacp01896 BPC194 KKLKKFKKLQ Synthetic Peptide Inducing apoptosis MTT assay Panc-1 Cervical cancer IC50 : 40.0 ± 3 Μm
dbacp01897 BPC88 KKLLKFKKLQ Synthetic Peptide Inducing apoptosis MTT assay MDA-MB-231 Cervical cancer IC50 : 31.2 ± 5 μM
dbacp01898 BPC88 KKLLKFKKLQ Synthetic Peptide Inducing apoptosis MTT assay HeLa Cervical cancer IC50 : 22.5 ± 0 μM
dbacp01899 BPC88 KKLLKFKKLQ Synthetic Peptide Inducing apoptosis MTT assay HepG2 Cervical cancer IC50 : 32.5 ± 4 μM
dbacp01900 BPC88 KKLLKFKKLQ Synthetic Peptide Inducing apoptosis MTT assay A431 Cervical cancer IC50 : 28.0 ± 3 μM
dbacp01901 BPC88 KKLLKFKKLQ Synthetic Peptide Inducing apoptosis MTT assay Panc-1 Cervical cancer IC50 : 32.5 ± 11 μM
dbacp01902 BPC96 LKLKKFKKLQ Synthetic Peptide Inducing apoptosis MTT assay MDA-MB-231 Cervical cancer IC50 : 40.0 ± 7 μM
dbacp01903 BPC96 LKLKKFKKLQ Synthetic Peptide Inducing apoptosis MTT assay HeLa Cervical cancer IC50 : 24.5 ± 0.7 μM
dbacp01904 BPC96 LKLKKFKKLQ Synthetic Peptide Inducing apoptosis MTT assay HepG2 Cervical cancer IC50 : 34.5 ± 2 μM
dbacp01905 BPC96 LKLKKFKKLQ Synthetic Peptide Inducing apoptosis MTT assay A431 Cervical cancer IC50 : 35.0 ± 7 μM
dbacp01906 BPC96 LKLKKFKKLQ Synthetic Peptide Inducing apoptosis MTT assay Panc-1 Cervical cancer IC50 : 51.0 ± 6 Μm
dbacp01907 BPC98 LLKKKFKKLQ Synthetic Peptide Inducing apoptosis MTT assay MDA-MB-231 Cervical cancer IC50 : 40.7 ± 3 μM
dbacp01908 BPC98 LLKKKFKKLQ Synthetic Peptide Inducing apoptosis MTT assay HeLa Cervical cancer IC50 : 38.5 ± 4 μM
dbacp01909 BPC98 LLKKKFKKLQ Synthetic Peptide Inducing apoptosis MTT assay HepG2 Cervical cancer IC50 : 44.0 ± 3 μM
dbacp01910 BPC98 LLKKKFKKLQ Synthetic Peptide Inducing apoptosis MTT assay A431 Cervical cancer IC50 : 47.5 ± 4 μM
dbacp01911 BPC98 LLKKKFKKLQ Synthetic Peptide Inducing apoptosis MTT assay Panc-1 Cervical cancer IC50 : 44.5 ± 0.7 Μm
dbacp01912 BpirLAAO-I ADDKNPLEEFRETNYEVFLEIAKNGLKATSNPKRVVIVGAGMAGLSAAY Venom base Inducing apoptosis MTT assay SKBR-3 Breast cancer Not found
dbacp01913 BpirLAAO-I ADDKNPLEEFRETNYEVFLEIAKNGLKATSNPKRVVIVGAGMAGLSAAY Venom base Inducing apoptosis MTT assay Jurkat Acute T cell Leukemia Not found
dbacp01914 BpirLAAO-I ADDKNPLEEFRETNYEVFLEIAKNGLKATSNPKRVVIVGAGMAGLSAAY Venom base Inducing apoptosis MTT assay EAT Erlich ascitic tumor Not found
dbacp01915 BpirLAAO-I ADDKNPLEEFRETNYEVFLEIAKNGLKATSNPKRVVIVGAGMAGLSAAY Venom base Inducing apoptosis MTT assay S180 Tumor Not found
dbacp01923 Brevinin-1-AW FLPLLAGLAANFLPQIICKIARKC Skin secretion, the Wuyi torrent frog, China, Asia Cell membrane penetration MTT assay PC-3 Prostate cancer IC50 : 33.46 μM
dbacp01941 Brevinin-1H FALGAVTKVLPKLFCLITRKC Hainan Torrent Frog Membrane disruption MTT assay H157 Lung cancer IC50 : 3.37 to 5.87 µM
dbacp01942 Brevinin-1H FALGAVTKVLPKLFCLITRKC Hainan Torrent Frog Membrane disruption MTT assay PC-3 Prostate cancer IC50 : 3.37 to 5.87 µM
dbacp01943 Brevinin-1H FALGAVTKVLPKLFCLITRKC Hainan Torrent Frog Membrane disruption MTT assay HCT116 Human colorectal cancer IC50 : 3.37 to 5.87 µM
dbacp01944 Brevinin-1H FALGAVTKVLPKLFCLITRKC Hainan Torrent Frog Membrane disruption MTT assay U251MG Human glioblastoma astrocytoma IC50 : 3.37 to 5.87 µM
dbacp01958 Brevinin-2KP GVITDALKGAAKTVAAELLKKAHCKLTNSC Skin, the banded bullfrog, common Asian frog, Asia Membranolytic mechanism MTT assay Not found Not found IC50 : 3.27 - 59.75 μM
dbacp02106 Buthus Occitanus RK1 IDCSKVNLTAECSS Common yellow scorpion RK1 Reduce cell proliferation and migration MTT assay, Cell proliferation assay U87 EpCAM-expressing cells MIC 50 : approx. 2 µM
dbacp02107 Buthus Occitanus RK1 IDCSKVNLTAECSS Common yellow scorpion RK1 Reduce cell proliferation and migration MTT assay, Cell proliferation assay IGR39 EpCAM-expressing cells MIC 50 : approx. 2 µM
dbacp02108 cMastoparan-C(cMP-C) CLNLKALLAVAKKILC Synthetic construct Apoptosis MTT assay H157 Non-small cell Lung cancer IC50 : 7.02 μM
dbacp02109 cMastoparan-C(cMP-C) CLNLKALLAVAKKILC Synthetic construct Apoptosis MTT assay MBD-MB-435S Melanocyte IC50 : 13.87 μM
dbacp02110 cMastoparan-C(cMP-C) CLNLKALLAVAKKILC Synthetic construct Apoptosis MTT assay PC-3 Human prostate carcinoma IC50 : 13.87 μM
dbacp02111 cMastoparan-C(cMP-C) CLNLKALLAVAKKILC Synthetic construct Apoptosis MTT assay U251-MG Human glioblastoma astrocytoma IC50 : 8.56 μM
dbacp02112 cMastoparan-C(cMP-C) CLNLKALLAVAKKILC Synthetic construct Apoptosis MTT assay MCF-7 Human breast cancer IC50 : 13.66 μM
dbacp02274 CAMP1 HVLFFFFNH2 Synthetic Cell membrane penetrating MTT assay UM-UC-5 Not specified IC50 : >100 μM
dbacp02275 CAMP1 HVLFFFFNH2 Synthetic Cell membrane penetrating MTT assay A549 Not specified IC50 : 12.39 μM
dbacp02276 CAMP2 HVLLFFFFNH2 Synthetic Cell membrane penetrating MTT assay UM-UC-5 Not specified IC50 : 21.61 μM
dbacp02277 CAMP2 HVLLFFFFNH2 Synthetic Cell membrane penetrating MTT assay A549 Not specified IC50 : 5.77μM
dbacp02278 CAMP3 HVLFFFFLFFNH2 Synthetic Cell membrane penetrating MTT assay UM-UC-5 Not specified IC50 : >100 μM
dbacp02279 CAMP3 HVLFFFFLFFNH2 Synthetic Cell membrane penetrating MTT assay A549 Not specified IC50 : 17.63μM
dbacp02280 CAMP5 HVLLLLLLLFNH2 Synthetic Cell membrane penetrating MTT assay UM-UC-5 Not specified IC50 : >100 μM
dbacp02281 CAMP5 HVLLLLLLLFNH2 Synthetic Cell membrane penetrating MTT assay A549 Not specified IC50 : 19.65 μM
dbacp02282 CAMP7 HVLLLLFFFFNH2 Synthetic Cell membrane penetrating MTT assay UM-UC-5 Not specified IC50 : >100 μM
dbacp02283 CAMP7 HVLLLLFFFFNH2 Synthetic Cell membrane penetrating MTT assay A549 Not specified IC50 : >100 μM
dbacp02431 ChaC1 (Chassatide C1; Plant defensin) GDACGETCFTGICFTAGCSCNPWPTCTRN Beras-beras Not specified MTT assay HeLa cells Not found IC50 : 9.8 µM
dbacp02433 ChaC10 (Chassatide C10; Plant defensin) GEYCGESCYLIPCFTPGCYCVSRQCVNKN Beras-beras Not specified MTT assay HeLa cells Not found IC50 : 5.0 µM
dbacp02437 ChaC2 (Chassatide C2; Plant defensin) GIPCAESCVWIPPCTITALMGCSCKNNVCYNN Beras-beras Not specified MTT assay HeLa cells Not found IC50 : 2.4 µM
dbacp02439 ChaC4 (Chassatide C4; Plant defensin) GASCGETCFTGICFTAGCSCNPWPTCTRN Beras-beras Not specified MTT assay HeLa cells Not found IC50 : 9.8 µM
dbacp02458 Chartergellus-CP1 peptide IIGTILGLLKSLNH2 Social wasp Apoptosis inducing MTT assay A375 Human melanoma IC50 : 40.5 µg/mL
dbacp02459 Chartergellus-CP1 peptide IIGTILGLLKSLNH2 Social wasp Apoptosis inducing; Intracellular ROS formation MTT assay MNT-1 Human melanoma IC50 : 51.6 µg/mL
dbacp02478 ChMAP-28 GRFKRFRKKLKRLWHKVGPFVGPILHY Domestic goat Cause cell membrane permeability; Induce necrotic death Cytotoxic Activity assay, Lactate dehydrogenase (LDH)-Releaseassay, MTT assay HL-60 Acute promyelocytic leukemia IC50 : 3.39 ± 0.15 μM
dbacp02479 ChMAP-28 GRFKRFRKKLKRLWHKVGPFVGPILHY Domestic goat Cause cell membrane permeability; Induce necrotic death Cytotoxic Activity assay, Lactate dehydrogenase (LDH)-Releaseassay, MTT assay A431 Human epidermoid carcinoma IC50 : 6.49 ± 0.09 μM
dbacp02480 ChMAP-28 GRFKRFRKKLKRLWHKVGPFVGPILHY Domestic goat Cause cell membrane permeability; Induce necrotic death Cytotoxic Activity assay, Lactate dehydrogenase (LDH)-Releaseassay, MTT assay B16F1 Murine melanoma IC50 : 4.82 ± 1.01μM
dbacp02481 ChMAP-28 GRFKRFRKKLKRLWHKVGPFVGPILHY Domestic goat Cause cell membrane permeability; Induce necrotic death Cytotoxic Activity assay, Lactate dehydrogenase (LDH)-Releaseassay, MTT assay SKBR-3 Human breast adenocarcinoma IC50 : 5.63 ± 1.05μM
dbacp02517 Cliotide T1 (cT1; Plant defensin) GIPCGESCVFIPCITAAIGCSCKSKVCYRN Butterfly pea Not specified MTT assay HeLa cells Not found IC50 : 0.6 µM
dbacp02523 Cliotide T2 (cT2; Plant defensin) GEFLKCGESCVQGECYTPGCSCDWPICKKN Butterfly pea Not specified MTT assay HeLa cells Not found IC50 : 8.0 µM
dbacp02526 Cliotide T3 (cT3; Plant defensin) GLPTCGETCTLGTCYVPDCSCSWPICMKN Butterfly pea Not specified MTT assay HeLa cells Not found IC50 : 2.0 µM
dbacp02529 Cliotide T4 (cT4; Plant defensin) GIPCGESCVFIPCITGAIGCSCKSKVCYRN Butterfly pea Not specified MTT assay HeLa cells Not found IC50 : 0.6 µM
dbacp02541 Conotoxin Cl14.1a (Conotoxin Cal14.1a) MNVTAMFIVLLLTMPLTDGFNIRAINGGELFGLVQRDAGNALDHGFYRRGDCPPWCVGARCRAEKC California cone Apoptosis MTT assay H1299 Non-small cell Lung cancer Not found
dbacp02542 Conotoxin Cl14.1a (Conotoxin Cal14.1a) MNVTAMFIVLLLTMPLTDGFNIRAINGGELFGLVQRDAGNALDHGFYRRGDCPPWCVGARCRAEKC California cone Apoptosis MTT assay H1437 Non-small cell Lung cancer Not found
dbacp02543 Conotoxin Cl14.1a (Conotoxin Cal14.1a) MNVTAMFIVLLLTMPLTDGFNIRAINGGELFGLVQRDAGNALDHGFYRRGDCPPWCVGARCRAEKC California cone Apoptosis MTT assay H1975 Non-small cell Lung cancer Not found
dbacp02544 Conotoxin Cl14.1a (Conotoxin Cal14.1a) MNVTAMFIVLLLTMPLTDGFNIRAINGGELFGLVQRDAGNALDHGFYRRGDCPPWCVGARCRAEKC California cone Apoptosis MTT assay H661 Non-small cell Lung cancer Not found
dbacp02556 CPP2 HVRRRRRRRNH2 Synthetic Cell membrane penetrating MTT assay UM-UC-A Not specified IC50 : 5.47 μM
dbacp02557 CPP2 HVRRRRRRRNH2 Synthetic Cell membrane penetrating MTT assay A549 Not specified IC50 : >100 μM
dbacp02558 CPP4 HVRRRRRRRRNH2 Synthetic Cell membrane penetrating MTT assay UM-UC-5 Not specified IC50 : >100 μM
dbacp02559 CPP4 HVRRRRRRRRNH2 Synthetic Cell membrane penetrating MTT assay A549 Not specified IC50 : >100 μM
dbacp02560 Cr-AcACP1 AW(Ac)KLFDDGV Not found Inducing apoptosis MTT assay Not found Colon carcinoma Not found
dbacp02562 Cr-ACP1 AWKLFDDGV Not found Inducing apoptosis MTT assay Hep2 Human epidermoid cancer IC50 : 1.5 mM
dbacp02564 CRAMP-18 E2K GKKLKKIGQKIKNFFQKL Synthetic Disrupt cell membrane structure MTT assay K-562 Chronic myelogenous Leukemia IC50 : 20–34 uM
dbacp02565 CRAMP-18 E2K GKKLKKIGQKIKNFFQKL Synthetic Disrupt cell membrane structure MTT assay Jurkat Acute T cell Leukemia IC50 : 20–34 uM
dbacp02566 CRAMP-18 E2K GKKLKKIGQKIKNFFQKL Synthetic Disrupt cell membrane structure MTT assay K-549 Acute T cell Leukemia IC50 : 20–34 uM
dbacp02577 Crotamine MKILYLLFAFLFLAFLSEPGNAYKQCHKKGGHCFPKEKICLPPSSDFGKMDCRWRWKCCKKGSGK South American rattlesnake Cell membrane penetration and lysis MTT assay CHO-K1 Not specified IC50 : 5 μM
dbacp02608 Cytotoxin drCT-1 LKCNKLVPLFYKTCPAGKNL Not found Inducing apoptosis MTT assay U937 Leukemia IC50 : 8.9 µg/ml
dbacp02609 Cytotoxin drCT-1 LKCNKLVPLFYKTCPAGKNL Not found Inducing apoptosis MTT assay K562 Leukemia IC50 : 6.7 µg/ml
dbacp02637 Decoralin SLLSLIRKLI Solitary eumenine wasp Mediate necrosis MTT assay MCF-7 Breast cancer IC50 : 12.5 μmolL−1
dbacp02644 Defensin-like protein (Sesquin) KTCENLADTY Yard-Long bean Anti-proliferative action MTT assay M1 Breast cancer MIC : 0.125 μg/ml
dbacp02645 Defensin-like protein (Sesquin) KTCENLADTY Yard-Long bean Anti-proliferative action MTT assay MCF-7 Leukemia MIC : 0.25 μg/ml
dbacp02651 Dermaseptin PS4 MDILKKSIFLVLFLGLVSLSICEEEKRENEDEEKQEDDEQSEEKRALWKTLLKHVGKAAGKAALNAVTDMVNQGEQ Sauvage's leaf frog Membrane disruption Lactate dehydrogenase (LDH) cytotoxicity assay, MTT assay MDA-MB-435S Lung cancer MIC : 10−9 to 10−4 M
dbacp02652 Dermaseptin PS4 MDILKKSIFLVLFLGLVSLSICEEEKRENEDEEKQEDDEQSEEKRALWKTLLKHVGKAAGKAALNAVTDMVNQGEQ Sauvage's leaf frog Membrane disruption Lactate dehydrogenase (LDH) cytotoxicity assay, MTT assay H157 Glioma MIC : 10−9 to 10−4 M
dbacp02653 Dermaseptin PS4 MDILKKSIFLVLFLGLVSLSICEEEKRENEDEEKQEDDEQSEEKRALWKTLLKHVGKAAGKAALNAVTDMVNQGEQ Sauvage's leaf frog Membrane disruption Lactate dehydrogenase (LDH) cytotoxicity assay, MTT assay PC-3 Prostate cancer MIC : 10−9 to 10−4 M
dbacp02654 Dermaseptin PS4 MDILKKSIFLVLFLGLVSLSICEEEKRENEDEEKQEDDEQSEEKRALWKTLLKHVGKAAGKAALNAVTDMVNQGEQ Sauvage's leaf frog Membrane disruption Lactate dehydrogenase (LDH) cytotoxicity assay, MTT assay MCF-7 Breast cancer MIC : 10−9 to 10−4 M
dbacp02666 Dermaseptin-PD-1 GMWSKIKETAMAAAKEAAKAAGKTISDMIKQ Skin Secretion, Mexican leaf frog, Mexico, North America Destroy plasma membrane MTT assay H157 Human non-small cell Lung cancer IC50 : 10-4 and 10-9 M
dbacp02667 Dermaseptin-PD-1 GMWSKIKETAMAAAKEAAKAAGKTISDMIKQ Skin Secretion, Mexican leaf frog, Mexico, North America Destroy plasma membrane MTT assay PC-3 Human prostate carcinoma IC50 : 10-4 and 10-9 M
dbacp02668 Dermaseptin-PD-1 GMWSKIKETAMAAAKEAAKAAGKTISDMIKQ Skin Secretion, Mexican leaf frog, Mexico, North America Destroy plasma membrane MTT assay U251MG Human neuronal glioblastoma IC50 : 15.08 μM
dbacp02669 Dermaseptin-PD-2 GMWSKIKNAGKAAAKAAAKAAGKAALDAVSEAI Skin Secretion, Mexican leaf frog, Mexico, North America Destroy plasma membrane MTT assay H157 Human non-small cell lung cancer IC50 : 6.43 μM
dbacp02670 Dermaseptin-PD-2 GMWSKIKNAGKAAAKAAAKAAGKAALDAVSEAI Skin Secretion, Mexican leaf frog, Mexico, North America Destroy plasma membrane MTT assay PC-3 Human prostate carcinoma IC50 : 3.17 μM
dbacp02671 Dermaseptin-PD-2 GMWSKIKNAGKAAAKAAAKAAGKAALDAVSEAI Skin Secretion, Mexican leaf frog, Mexico, North America Destroy plasma membrane MTT assay U251MG Human neuronal glioblastoma IC50 : 13.43 μM
dbacp02672 Dermaseptin-PD1 GMWSKIKETAMAAAKEAAKAAGKTISDMIKQ Mexican leaf frog Destroy plasma membrane MTT assay H157 Neuronal glioblastoma IC50 : 6.43 μM
dbacp02673 Dermaseptin-PD1 GMWSKIKETAMAAAKEAAKAAGKTISDMIKQ Mexican leaf frog Destroy plasma membrane MTT assay PC-3 Prostate carcinoma IC50 : 3.17 μM
dbacp02674 Dermaseptin-PD1 GMWSKIKETAMAAAKEAAKAAGKTISDMIKQ Mexican leaf frog Destroy plasma membrane MTT assay U251MG Breast cancer IC50 : 13.43 μM
dbacp02675 Dermaseptin-PD2 GMWSKIKNAGKAAAKAAAKAAGKAALDAVSEAI Mexican leaf frog Destroy plasma membrane MTT assay H157 Neuronal glioblastoma IC50 : 6.43 μM
dbacp02676 Dermaseptin-PD2 GMWSKIKNAGKAAAKAAAKAAGKAALDAVSEAI Mexican leaf frog Destroy plasma membrane MTT assay PC-3 Prostate carcinoma IC50 : 3.17 μM
dbacp02677 Dermaseptin-PD2 GMWSKIKNAGKAAAKAAAKAAGKAALDAVSEAI Mexican leaf frog Destroy plasma membrane MTT assay U251MG Breast cancer IC50 : 13.43 μM
dbacp02688 Dermaseptin-PH MDILKKSLFLILFLGVVSLSICEEEKRENEEEMEQDDEQSEMKRALWKEVLKNAGKAALNEINNLVQGGQ Northern orange-legged leaf frog Disruption of cell membranes MTT assay, Lactate dehydrogenase (LDH) assay U251MG Neuronal glioblastoma IC50 : 17.44 - 49.51 μM
dbacp02689 Dermaseptin-PH MDILKKSLFLILFLGVVSLSICEEEKRENEEEMEQDDEQSEMKRALWKEVLKNAGKAALNEINNLVQGGQ Northern orange-legged leaf frog Disruption of cell membranes MTT assay, Lactate dehydrogenase (LDH) assay MCF-7 Breast cancer IC50 : 17.44 - 49.51 μM
dbacp02690 Dermaseptin-PH MDILKKSLFLILFLGVVSLSICEEEKRENEEEMEQDDEQSEMKRALWKEVLKNAGKAALNEINNLVQGGQ Northern orange-legged leaf frog Disruption of cell membranes MTT assay, Lactate dehydrogenase (LDH) assay PANC-1 Pancreatic cancer IC50 : 17.44 - 49.51 μM
dbacp02691 Dermaseptin-PH MDILKKSLFLILFLGVVSLSICEEEKRENEEEMEQDDEQSEMKRALWKEVLKNAGKAALNEINNLVQGGQ Northern orange-legged leaf frog Disruption of cell membranes MTT assay, Lactate dehydrogenase (LDH) assay NCl-H157 Lung cancer IC50 : 17.44 - 49.51 μM
dbacp02692 Dermaseptin-PH MDILKKSLFLILFLGVVSLSICEEEKRENEEEMEQDDEQSEMKRALWKEVLKNAGKAALNEINNLVQGGQ Northern orange-legged leaf frog Disruption of cell membranes MTT assay, Lactate dehydrogenase (LDH) assay PC-3 Prostate carcinoma IC50 : 17.44 - 49.51 μM
dbacp02693 Dermaseptin-PH (DRS-PH) MDILKKSLFLILFLGVVSLSICEEEKRENEEEMEQDDEQSEMKRALWKEVLKNAGKAALNEINNLVQGGQ Northern orange-legged leaf frog Disruption of cell membranes MTT assay MCF-7 Brain tumor IC50 : 7.44 μM
dbacp02694 Dermaseptin-PH (DRS-PH) MDILKKSLFLILFLGVVSLSICEEEKRENEEEMEQDDEQSEMKRALWKEVLKNAGKAALNEINNLVQGGQ Northern orange-legged leaf frog Disruption of cell membranes MTT assay MCF-7 Breast cancer IC50 : 7.44 μM
dbacp02695 Dermaseptin-PH (DRS-PH) MDILKKSLFLILFLGVVSLSICEEEKRENEEEMEQDDEQSEMKRALWKEVLKNAGKAALNEINNLVQGGQ Northern orange-legged leaf frog Disruption of cell membranes MTT assay MCF-7 pancreatic cancer IC50 : 7.44 μM
dbacp02696 Dermaseptin-PH (DRS-PH) MDILKKSLFLILFLGVVSLSICEEEKRENEEEMEQDDEQSEMKRALWKEVLKNAGKAALNEINNLVQGGQ Northern orange-legged leaf frog Disruption of cell membranes MTT assay MCF-7 Lung cancer IC50 : 7.44 μM
dbacp02697 Dermaseptin-PH (DRS-PH) MDILKKSLFLILFLGVVSLSICEEEKRENEEEMEQDDEQSEMKRALWKEVLKNAGKAALNEINNLVQGGQ Northern orange-legged leaf frog Disruption of cell membranes MTT assay MCF-7 Prostate cancer IC50 : 7.44 μM
dbacp02698 Dermaseptin-PH (DRS-PH) MDILKKSLFLILFLGVVSLSICEEEKRENEEEMEQDDEQSEMKRALWKEVLKNAGKAALNEINNLVQGGQ Northern orange-legged leaf frog Disruption of cell membranes MTT assay U251MG Brain tumor IC50 : 49.51 μM
dbacp02699 Dermaseptin-PH (DRS-PH) MDILKKSLFLILFLGVVSLSICEEEKRENEEEMEQDDEQSEMKRALWKEVLKNAGKAALNEINNLVQGGQ Northern orange-legged leaf frog Disruption of cell membranes MTT assay U251MG Breast cancer IC50 : 49.51 μM
dbacp02700 Dermaseptin-PH (DRS-PH) MDILKKSLFLILFLGVVSLSICEEEKRENEEEMEQDDEQSEMKRALWKEVLKNAGKAALNEINNLVQGGQ Northern orange-legged leaf frog Disruption of cell membranes MTT assay U251MG Pancreatic cancer IC50 : 49.51 μM
dbacp02701 Dermaseptin-PH (DRS-PH) MDILKKSLFLILFLGVVSLSICEEEKRENEEEMEQDDEQSEMKRALWKEVLKNAGKAALNEINNLVQGGQ Northern orange-legged leaf frog Disruption of cell membranes MTT assay U251MG Lung cancer IC50 : 49.51 μM
dbacp02702 Dermaseptin-PH (DRS-PH) MDILKKSLFLILFLGVVSLSICEEEKRENEEEMEQDDEQSEMKRALWKEVLKNAGKAALNEINNLVQGGQ Northern orange-legged leaf frog Disruption of cell membranes MTT assay U251MG Prostate cancer IC50 : 49.51 μM
dbacp02703 Dermaseptin-PH (DRS-PH) MDILKKSLFLILFLGVVSLSICEEEKRENEEEMEQDDEQSEMKRALWKEVLKNAGKAALNEINNLVQGGQ Northern orange-legged leaf frog Disruption of cell membranes MTT assay H157 Brain tumor IC50 : 25.51 μM
dbacp02704 Dermaseptin-PH (DRS-PH) MDILKKSLFLILFLGVVSLSICEEEKRENEEEMEQDDEQSEMKRALWKEVLKNAGKAALNEINNLVQGGQ Northern orange-legged leaf frog Disruption of cell membranes MTT assay H157 Breast cancer IC50 : 25.51 μM
dbacp02705 Dermaseptin-PH (DRS-PH) MDILKKSLFLILFLGVVSLSICEEEKRENEEEMEQDDEQSEMKRALWKEVLKNAGKAALNEINNLVQGGQ Northern orange-legged leaf frog Disruption of cell membranes MTT assay H157 Pancreatic cancer IC50 : 25.51 μM
dbacp02706 Dermaseptin-PH (DRS-PH) MDILKKSLFLILFLGVVSLSICEEEKRENEEEMEQDDEQSEMKRALWKEVLKNAGKAALNEINNLVQGGQ Northern orange-legged leaf frog Disruption of cell membranes MTT assay H157 Lung cancer IC50 : 25.51 μM
dbacp02707 Dermaseptin-PH (DRS-PH) MDILKKSLFLILFLGVVSLSICEEEKRENEEEMEQDDEQSEMKRALWKEVLKNAGKAALNEINNLVQGGQ Northern orange-legged leaf frog Disruption of cell membranes MTT assay H157 Prostate cancer IC50 : 25.51 μM
dbacp02708 Dermaseptin-PH (DRS-PH) MDILKKSLFLILFLGVVSLSICEEEKRENEEEMEQDDEQSEMKRALWKEVLKNAGKAALNEINNLVQGGQ Northern orange-legged leaf frog Disruption of cell membranes MTT assay PC-3 Brain tumor IC50 : 21.78 μM
dbacp02709 Dermaseptin-PH (DRS-PH) MDILKKSLFLILFLGVVSLSICEEEKRENEEEMEQDDEQSEMKRALWKEVLKNAGKAALNEINNLVQGGQ Northern orange-legged leaf frog Disruption of cell membranes MTT assay PC-3 Breast cancer IC50 : 21.78 μM
dbacp02710 Dermaseptin-PH (DRS-PH) MDILKKSLFLILFLGVVSLSICEEEKRENEEEMEQDDEQSEMKRALWKEVLKNAGKAALNEINNLVQGGQ Northern orange-legged leaf frog Disruption of cell membranes MTT assay PC-3 Pancreatic cancer IC50 : 21.78 μM
dbacp02711 Dermaseptin-PH (DRS-PH) MDILKKSLFLILFLGVVSLSICEEEKRENEEEMEQDDEQSEMKRALWKEVLKNAGKAALNEINNLVQGGQ Northern orange-legged leaf frog Disruption of cell membranes MTT assay PC-3 Lung cancer IC50 : 21.78 μM
dbacp02712 Dermaseptin-PH (DRS-PH) MDILKKSLFLILFLGVVSLSICEEEKRENEEEMEQDDEQSEMKRALWKEVLKNAGKAALNEINNLVQGGQ Northern orange-legged leaf frog Disruption of cell membranes MTT assay PC-3 Prostate cancer IC50 : 21.78 μM
dbacp02713 Dermaseptin-PH (DRS-PH) MDILKKSLFLILFLGVVSLSICEEEKRENEEEMEQDDEQSEMKRALWKEVLKNAGKAALNEINNLVQGGQ Northern orange-legged leaf frog Disruption of cell membranes MTT assay PANC-1 Brain tumor IC50 : 28.95 μM
dbacp02714 Dermaseptin-PH (DRS-PH) MDILKKSLFLILFLGVVSLSICEEEKRENEEEMEQDDEQSEMKRALWKEVLKNAGKAALNEINNLVQGGQ Northern orange-legged leaf frog Disruption of cell membranes MTT assay PANC-1 Breast cancer IC50 : 28.95 μM
dbacp02715 Dermaseptin-PH (DRS-PH) MDILKKSLFLILFLGVVSLSICEEEKRENEEEMEQDDEQSEMKRALWKEVLKNAGKAALNEINNLVQGGQ Northern orange-legged leaf frog Disruption of cell membranes MTT assay PANC-1 Pancreatic cancer IC50 : 28.95 μM
dbacp02716 Dermaseptin-PH (DRS-PH) MDILKKSLFLILFLGVVSLSICEEEKRENEEEMEQDDEQSEMKRALWKEVLKNAGKAALNEINNLVQGGQ Northern orange-legged leaf frog Disruption of cell membranes MTT assay PANC-1 Lung cancer IC50 : 28.95 μM
dbacp02717 Dermaseptin-PH (DRS-PH) MDILKKSLFLILFLGVVSLSICEEEKRENEEEMEQDDEQSEMKRALWKEVLKNAGKAALNEINNLVQGGQ Northern orange-legged leaf frog Disruption of cell membranes MTT assay PANC-1 Prostate cancer IC50 : 28.95 μM
dbacp02718 Dermaseptin-PH (DRS-PH) MDILKKSLFLILFLGVVSLSICEEEKRENEEEMEQDDEQSEMKRALWKEVLKNAGKAALNEINNLVQGGQ Northern orange-legged leaf frog Disruption of cell membranes MTT assay HMEC-1 Brain tumor IC50 : 51.04 μM
dbacp02719 Dermaseptin-PH (DRS-PH) MDILKKSLFLILFLGVVSLSICEEEKRENEEEMEQDDEQSEMKRALWKEVLKNAGKAALNEINNLVQGGQ Northern orange-legged leaf frog Disruption of cell membranes MTT assay HMEC-1 Breast cancer IC50 : 51.04 μM
dbacp02720 Dermaseptin-PH (DRS-PH) MDILKKSLFLILFLGVVSLSICEEEKRENEEEMEQDDEQSEMKRALWKEVLKNAGKAALNEINNLVQGGQ Northern orange-legged leaf frog Disruption of cell membranes MTT assay HMEC-1 Pancreatic cancer IC50 : 51.04 μM
dbacp02721 Dermaseptin-PH (DRS-PH) MDILKKSLFLILFLGVVSLSICEEEKRENEEEMEQDDEQSEMKRALWKEVLKNAGKAALNEINNLVQGGQ Northern orange-legged leaf frog Disruption of cell membranes MTT assay HMEC-1 Lung cancer IC50 : 51.04 μM
dbacp02722 Dermaseptin-PH (DRS-PH) MDILKKSLFLILFLGVVSLSICEEEKRENEEEMEQDDEQSEMKRALWKEVLKNAGKAALNEINNLVQGGQ Northern orange-legged leaf frog Disruption of cell membranes MTT assay HMEC-1 Prostate cancer IC50 : 51.04 μM
dbacp02725 Dermaseptin-PS3 ALWKDILKNAGKAALNEINQIVQ Skin, the waxy monkey tree frog, South America Membrane rupture MTT assay H157 Lung cancer IC50 : 15.67 μM
dbacp02726 Dermaseptin-PS3 ALWKDILKNAGKAALNEINQIVQ Skin, the waxy monkey tree frog, South America Membrane rupture MTT assay PC3 Human prostate carcinoma IC50 : 18.20 μM
dbacp02727 Dermaseptin-PS4 ALWKTLLKHVGKAAGKAALNAVTDMVNQ Waxy monkey tree frog Membrane disruption Lactate dehydrogenase (LDH) cytotoxicity assay, MTT assay MDA-MB-435S Lung cancer MIC : 10−9 to 10−4 M
dbacp02728 Dermaseptin-PS4 ALWKTLLKHVGKAAGKAALNAVTDMVNQ Waxy monkey tree frog Membrane disruption Lactate dehydrogenase (LDH) cytotoxicity assay, MTT assay H157 Glioma MIC : 10−9 to 10−4 M
dbacp02729 Dermaseptin-PS4 ALWKTLLKHVGKAAGKAALNAVTDMVNQ Waxy monkey tree frog Membrane disruption Lactate dehydrogenase (LDH) cytotoxicity assay, MTT assay PC-3 Prostate cancer MIC : 10−9 to 10−4 M
dbacp02730 Dermaseptin-PS4 ALWKTLLKHVGKAAGKAALNAVTDMVNQ Waxy monkey tree frog Membrane disruption Lactate dehydrogenase (LDH) cytotoxicity assay, MTT assay MCF-7 Breast cancer MIC : 10−9 to 10−4 M
dbacp02731 Dermaseptin-PT9 GLWSKIKDAAKTAGKAALGFVNEMV Brownbelly leaf frog Disruption of cell membranes MTT assay, Lactate dehydrogenase (LDH) assay U251MG Neuronal glioblastoma IC50 : 8.64 - 18.51 μM
dbacp02732 Dermaseptin-PT9 GLWSKIKDAAKTAGKAALGFVNEMV Brownbelly leaf frog Disruption of cell membranes MTT assay, Lactate dehydrogenase (LDH) assay MCF-7 Breast cancer IC50 : 8.64 - 18.51 μM
dbacp02733 Dermaseptin-PT9 GLWSKIKDAAKTAGKAALGFVNEMV Brownbelly leaf frog Disruption of cell membranes MTT assay, Lactate dehydrogenase (LDH) assay PANC-1 Pancreatic cancer IC50 : 8.64 - 18.51 μM
dbacp02734 Dermaseptin-PT9 GLWSKIKDAAKTAGKAALGFVNEMV Brownbelly leaf frog Disruption of cell membranes MTT assay, Lactate dehydrogenase (LDH) assay NCl-H157 Lung cancer IC50 : 8.64 - 18.51 μM
dbacp02735 Dermaseptin-PT9 GLWSKIKDAAKTAGKAALGFVNEMV Brownbelly leaf frog Disruption of cell membranes MTT assay, Lactate dehydrogenase (LDH) assay PC-3 Prostate carcinoma IC50 : 8.64 - 18.51 μM
dbacp02736 Dermaseptin-PT9 GLWSKIKDAAKTAGKAALGFVNEMV Skin secretion, Brownbelly leaf frog, Purchased in Peru, South America Disruption of cell membranes MTT assay, Lactate dehydrogenase (LDH) assay U251MG Neuronal glioblastoma IC50 : 8.64 - 18.51 μM
dbacp02737 Dermaseptin-PT9 GLWSKIKDAAKTAGKAALGFVNEMV Skin secretion, Brownbelly leaf frog, Purchased in Peru, South America Disruption of cell membranes MTT assay, Lactate dehydrogenase (LDH) assay MCF-7 Breast cancer IC50 : 8.64 - 18.51 μM
dbacp02738 Dermaseptin-PT9 GLWSKIKDAAKTAGKAALGFVNEMV Skin secretion, Brownbelly leaf frog, Purchased in Peru, South America Disruption of cell membranes MTT assay, Lactate dehydrogenase (LDH) assay PANC-1 Pancreatic cancer IC50 : 8.64 - 18.51 μM
dbacp02739 Dermaseptin-PT9 GLWSKIKDAAKTAGKAALGFVNEMV Skin secretion, Brownbelly leaf frog, Purchased in Peru, South America Disruption of cell membranes MTT assay, Lactate dehydrogenase (LDH) assay NCl-H157 Lung cancer IC50 : 8.64 - 18.51 μM
dbacp02740 Dermaseptin-PT9 GLWSKIKDAAKTAGKAALGFVNEMV Skin secretion, Brownbelly leaf frog, Purchased in Peru, South America Disruption of cell membranes MTT assay, Lactate dehydrogenase (LDH) assay PC-3 Prostate carcinoma IC50 : 8.64 - 18.51 μM
dbacp02836 Emericellipsin A PQAAIVASG **Emericellopsis alkaline** VKPM F1428, Alkalophile, extremophile Disrupt cell membrane structures; Apoptosis MTT assay HeLa Cervical cancer EC50 : < 0.5 µM
dbacp02837 Emericellipsin A PQAAIVASG **Emericellopsis alkaline** VKPM F1428, Alkalophile, extremophile Disrupt cell membrane structures; Apoptosis MTT assay Hep G2 Liver cancer EC50 : 2.8 µM
dbacp02871 Epinecidin-1 GFIFHIIKGLFHAGKMIHGLV Not found Inducing apoptosis MTT assay U937 Leukemia Not found
dbacp02962 FK-16 FKRIVQRIKDFLRNLV Not found Inducing apoptosis MTT assay LoVo, HCT116 Colon cancer Not found
dbacp03034 Galaxamide derivative (Compound 3) cyclo(WnMLLLnML) Marine invertebrates Inducing apoptosis MTT assay HepG2 Breast cancer IC50 : 3.98 ± 0.71 μg/mL
dbacp03035 Galaxamide derivative (Compound 3) cyclo(WnMLLLnML) Marine invertebrates Inducing apoptosis MTT assay MCF-7 Breast cancer IC50 : 1.72 ± 0.85 μg/mL
dbacp03036 Galaxamide derivative (Compound 3) cyclo(WnMLLLnML) Marine invertebrates Inducing apoptosis MTT assay HeLa Breast cancer IC50 : 5.32 ± 0.42 μg/mL
dbacp03037 Galaxamide derivative (Compound 3) cyclo(WnMLLLnML) Marine invertebrates Inducing apoptosis MTT assay MD-MBA-231 Breast cancer IC50 :3.51 ± 1.32 μg/Ml
dbacp03038 Galaxamide derivative Compound 1 cyclo(FnMLLLnML) Marine invertebrates Inducing apoptosis MTT assay HepG2 Breast cancer IC50 : 6.25 ± 1.03 μg/mL
dbacp03039 Galaxamide derivative Compound 1 cyclo(FnMLLLnML) Marine invertebrates Inducing apoptosis MTT assay MCF-7 Breast cancer IC50 : 4.76 ± 1.36 μg/mL
dbacp03040 Galaxamide derivative Compound 1 cyclo(FnMLLLnML) Marine invertebrates Inducing apoptosis MTT assay HeLa Breast cancer IC50 : 13.22 ± 1.12 μg/mL
dbacp03041 Galaxamide derivative Compound 1 cyclo(FnMLLLnML) Marine invertebrates Inducing apoptosis MTT assay MD-MBA-231 Breast cancer IC50 : 5.83 ± 0.45 μg/M
dbacp03042 Galaxamide derivative Compound 2 cyclo(NAl-nMLLLnML) Marine invertebrates Inducing apoptosis MTT assay HepG2 Breast cancer IC50 : 8.42 ± 1.82 μg/mL
dbacp03043 Galaxamide derivative Compound 2 cyclo(NAl-nMLLLnML) Marine invertebrates Inducing apoptosis MTT assay MCF-7 Breast cancer IC50 : 3.16 ± 0.92 μg/mL
dbacp03044 Galaxamide derivative Compound 2 cyclo(NAl-nMLLLnML) Marine invertebrates Inducing apoptosis MTT assay HeLa Breast cancer IC50 : 6.43 ± 1.20 μg/mL
dbacp03045 Galaxamide derivative Compound 2 cyclo(NAl-nMLLLnML) Marine invertebrates Inducing apoptosis MTT assay MD-MBA-231 Breast cancer IC50 : 4.48 ± 2.24 μg/mL
dbacp03105 GM15 GGTCVIRGCVPKKLM Not found Inducing apoptosis MTT assay KB Oral cancer Not found
dbacp03174 H-0, Hymenochirin-1B IKLSPETKDNLKKVLKGAIKGAIAVAKMV Congo dwarf clawed frog Inducing apoptosis MTT assay A549 Not found IC50 : 15.22 ± 0.21 μM
dbacp03175 H-0, Hymenochirin-1B IKLSPETKDNLKKVLKGAIKGAIAVAKMV Congo dwarf clawed frog Inducing apoptosis MTT assay HCT116 Not found IC50 : 12.76 ± 0.43 μM
dbacp03176 H-0, Hymenochirin-1B IKLSPETKDNLKKVLKGAIKGAIAVAKMV Congo dwarf clawed frog Inducing apoptosis MTT assay HepG2 Not found IC50 : 8.07 ± 0.21 μM
dbacp03177 H-11 IKLSPETKKNLKKVLKGAIKGAIAVAKMV Synthetic construct Inducing apoptosis MTT assay A549 Not found IC50 : 1.82 ± 0.23 μM
dbacp03178 H-11 IKLSPETKKNLKKVLKGAIKGAIAVAKMV Synthetic construct Inducing apoptosis MTT assay HCT116 Not found IC50 : 6.50 ± 0.32 μM
dbacp03179 H-11 IKLSPETKKNLKKVLKGAIKGAIAVAKMV Synthetic construct Inducing apoptosis MTT assay HepG2 Not found IC50 : 4.96 ± 0.43 μM
dbacp03180 H-12 IKLSKETKDNLKKVLKGAIKGAIAVAKMV Synthetic construct Inducing apoptosis MTT assay A549 Not found IC50 : 2.35 ± 0.31 μM
dbacp03181 H-12 IKLSKETKDNLKKVLKGAIKGAIAVAKMV Synthetic construct Inducing apoptosis MTT assay HCT116 Not found IC50 : 8.09 ± 0.40 μM
dbacp03182 H-12 IKLSKETKDNLKKVLKGAIKGAIAVAKMV Synthetic construct Inducing apoptosis MTT assay HepG2 Not found IC50 : 4.28 ± 0.38 μM
dbacp03183 H-13 IKLSKETKKNLKKVLKGAIKGAIAVAKMV Synthetic construct Inducing apoptosis MTT assay A549 Not found IC50 : 1.17 ± 0.23 μM
dbacp03184 H-13 IKLSKETKKNLKKVLKGAIKGAIAVAKMV Synthetic construct Inducing apoptosis MTT assay HCT116 Not found IC50 : 4.93 ± 0.51 μM
dbacp03185 H-13 IKLSKETKKNLKKVLKGAIKGAIAVAKMV Synthetic construct Inducing apoptosis MTT assay HepG2 Not found IC50 : 2.46 ± 0.32 μM
dbacp03186 H-14 IKLSKKTKKNLKKVLKGAIKGAIAVAKMV Synthetic construct Inducing apoptosis MTT assay A549 Not found IC50 : 0.98 ± 0.11 μM
dbacp03187 H-14 IKLSKKTKKNLKKVLKGAIKGAIAVAKMV Synthetic construct Inducing apoptosis MTT assay HCT116 Not found IC50 : 1.841 ± 0.34 μM
dbacp03188 H-14 IKLSKKTKKNLKKVLKGAIKGAIAVAKMV Synthetic construct Inducing apoptosis MTT assay HepG2 Not found IC50 : 4.54 ± 0.25 μM
dbacp03283 Hc-CATH KFFKRLLKSVRRAVKKFRKKPRLIGLSTLL Green paddy frog Not specified MTT assay HepG2 Liver cancer 4.70% cell death at 200 µg/ml
dbacp03284 Hc-CATH KFFKRLLKSVRRAVKKFRKKPRLIGLSTLL Green paddy frog Not specified MTT assay HepG2 Prostate cancer 4.70% cell death at 200 µg/ml
dbacp03285 Hc-CATH KFFKRLLKSVRRAVKKFRKKPRLIGLSTLL Green paddy frog Not specified MTT assay PC-3 Liver cancer 3.63% cell death at 200 µg/ml
dbacp03286 Hc-CATH KFFKRLLKSVRRAVKKFRKKPRLIGLSTLL Green paddy frog Not specified MTT assay PC-3 Prostate cancer 3.63% cell death at 200 µg/ml
dbacp03287 Hc-CATH KFFKRLLKSVRRAVKKFRKKPRLIGLSTLL Green paddy frog Not specified MTT assay L929 Liver cancer 1.30% cell death at 200 µg/ml
dbacp03288 Hc-CATH KFFKRLLKSVRRAVKKFRKKPRLIGLSTLL Green paddy frog Not specified MTT assay L929 Prostate cancer 1.30% cell death at 200 µg/ml
dbacp03329 Human A-defensin-1 (HNP1) ACYCRIPACIAGERRYGTCIYQGRLWAFCC Not found Inducing apoptosis MTT assay A549 Lung cancer Not found
dbacp03330 Human A-defensin-1 (HNP1) ACYCRIPACIAGERRYGTCIYQGRLWAFCC Not found Inducing apoptosis MTT assay COS-7 Lung cancer Not found
dbacp03356 Hymenochirin-1B IKLSPETKDNLKKVLKGAIKGAIAVAKMV-NH2 Zaire dwarf clawed frog Induce apoptosis and cell cycle arrest LDH release assay, MTT assay NCI-H1299 Lung cancer MIC : 0 - 50 μM
dbacp03357 Hymenochirin-1B IKLSPETKDNLKKVLKGAIKGAIAVAKMV-NH3 Zaire dwarf clawed frog Induce apoptosis and cell cycle arrest LDH release assay, MTT assay A549 Lung cancer MIC : 0 - 50 μM
dbacp03358 Hymenochirin-1B IKLSPETKDNLKKVLKGAIKGAIAVAKMV-NH4 Zaire dwarf clawed frog Induce apoptosis and cell cycle arrest LDH release assay, MTT assay H460 Lung cancer MIC : 0 - 50 μM
dbacp03359 Hymenochirin-1B IKLSPETKDNLKKVLKGAIKGAIAVAKMV-NH5 Zaire dwarf clawed frog Induce apoptosis and cell cycle arrest LDH release assay, MTT assay HepG2 Human hepatocellular carcinoma MIC : 0 - 50 μM
dbacp03360 Hymenochirin-1B IKLSPETKDNLKKVLKGAIKGAIAVAKMV-NH6 Zaire dwarf clawed frog Induce apoptosis and cell cycle arrest LDH release assay, MTT assay PLC Human hepatocellular carcinoma MIC : 0 - 50 μM
dbacp03367 Ichthyophthirius multifiliis (strain G5) B4 LKKLFKKILKYL White spot disease (strain G5) B4 Apoptosis inducing; Penetration of the cell membrane MTT assay MCF-7 Breast cancer MIC : 5 μM
dbacp03368 Ichthyophthirius multifiliis (strain G5) B4 LKKLFKKILKYL White spot disease (strain G5) B4 Apoptosis inducing; Penetration of the cell membrane MTT assay K562 Breast cancer MIC : 5 μM
dbacp03369 Ichthyophthirius multifiliis (strain G5) B8 LKKLFKKILKY White spot disease (strain G5) B8 Apoptosis inducing; Penetration of the cell membrane MTT assay MCF-7 Breast cancer MIC : 7 μM
dbacp03370 Ichthyophthirius multifiliis (strain G5) B8 LKKLFKKILKY White spot disease (strain G5) B8 Apoptosis inducing; Penetration of the cell membrane MTT assay K562 Breast cancer MIC : 7 μM
dbacp03371 Ichthyophthirius multifiliis BP100 KKLFKKILKYL White spot disease BP100 Apoptosis inducing; Penetration of the cell membrane MTT assay MCF-7 Breast cancer MIC : 25 μM
dbacp03372 Ichthyophthirius multifiliis BP100 KKLFKKILKYL White spot disease BP100 Apoptosis inducing; Penetration of the cell membrane MTT assay K562 Breast cancer MIC : 25 μM
dbacp03380 Imcroporin FFSLLPSLIGGLVSAIK Lesser brown scorpion Cell membrane disintegration MTT assay EK293T Not found MIC : 50 µg/ml
dbacp03381 Imcroporin FFSLLPSLIGGLVSAIK Lesser brown scorpion Cell membrane disintegration MTT assay SMMC-7721 Not found MIC : 100 µg/ml
dbacp03473 K4R2-Nal2-S1 Ac-KKKKRR-NAl-NAl-KKWRKWLAKK-NH2 Not found Necrosis or apoptosis MTT assay PC9 Human lung cancer MIC : 25 μM
dbacp03474 K4R2-Nal2-S1 Ac-KKKKRR-NAl-NAl-KKWRKWLAKK-NH2 Not found Necrosis or apoptosis MTT assay PC9-G Oral cancer MIC : 25 μM
dbacp03475 K4R2-Nal2-S1 Ac-KKKKRR-NAl-NAl-KKWRKWLAKK-NH2 Not found Necrosis or apoptosis MTT assay A549 Human lung cancer MIC : 25 μM
dbacp03476 K4R2-Nal2-S1 Ac-KKKKRR-NAl-NAl-KKWRKWLAKK-NH2 Not found Necrosis or apoptosis MTT assay C9 Oral cancer MIC : 25 μM
dbacp03477 K4R2-Nal2-S1 Ac-KKKKRR-NAl-NAl-KKWRKWLAKK-NH2 Not found Necrosis or apoptosis MTT assay OECM-1 Human lung cancer MIC : 25 μM
dbacp03478 K4R2-Nal2-S1 Ac-KKKKRR-NAl-NAl-KKWRKWLAKK-NH2 Not found Necrosis or apoptosis MTT assay SAS Oral cancer MIC : 25 μM
dbacp03479 K6-Nal2-S1 Ac-KKKKKK-NAl-NAl-KKWRKWLAKK-NH2 Not found Necrosis or apoptosis MTT assay PC9 Human lung cancer MIC : 3.1 μM
dbacp03480 K6-Nal2-S1 Ac-KKKKKK-NAl-NAl-KKWRKWLAKK-NH2 Not found Necrosis or apoptosis MTT assay PC9-G Oral cancer MIC : 3.1 μM
dbacp03481 K6-Nal2-S1 Ac-KKKKKK-NAl-NAl-KKWRKWLAKK-NH2 Not found Necrosis or apoptosis MTT assay A549 Human lung cancer MIC : 3.1 μM
dbacp03482 K6-Nal2-S1 Ac-KKKKKK-NAl-NAl-KKWRKWLAKK-NH2 Not found Necrosis or apoptosis MTT assay C9 Oral cancer MIC : 3.1 μM
dbacp03483 K6-Nal2-S1 Ac-KKKKKK-NAl-NAl-KKWRKWLAKK-NH2 Not found Necrosis or apoptosis MTT assay OECM-1 Human lung cancer MIC : 3.1 μM
dbacp03484 K6-Nal2-S1 Ac-KKKKKK-NAl-NAl-KKWRKWLAKK-NH2 Not found Necrosis or apoptosis MTT assay SAS Oral cancer MIC : 3.1 μM
dbacp03485 K8, 23-DPT9 MDILKKSKFLILFLGVVSLSICKEEKRENEEEMEQDDEQSEMKRALWKEVLKNAGKAALNEINNLVQGGQ Northern orange-legged leaf frog Disruption of cell membranes MTT assay MCF-7 Brain tumor IC50 : 8.64μM
dbacp03486 K8, 23-DPT9 MDILKKSKFLILFLGVVSLSICKEEKRENEEEMEQDDEQSEMKRALWKEVLKNAGKAALNEINNLVQGGQ Northern orange-legged leaf frog Disruption of cell membranes MTT assay MCF-7 Breast cancer IC50 : 8.64μM
dbacp03487 K8, 23-DPT9 MDILKKSKFLILFLGVVSLSICKEEKRENEEEMEQDDEQSEMKRALWKEVLKNAGKAALNEINNLVQGGQ Northern orange-legged leaf frog Disruption of cell membranes MTT assay MCF-7 Pancreatic cancer IC50 : 8.64μM
dbacp03488 K8, 23-DPT9 MDILKKSKFLILFLGVVSLSICKEEKRENEEEMEQDDEQSEMKRALWKEVLKNAGKAALNEINNLVQGGQ Northern orange-legged leaf frog Disruption of cell membranes MTT assay MCF-7 Lung cancer IC50 : 8.64μM
dbacp03489 K8, 23-DPT9 MDILKKSKFLILFLGVVSLSICKEEKRENEEEMEQDDEQSEMKRALWKEVLKNAGKAALNEINNLVQGGQ Northern orange-legged leaf frog Disruption of cell membranes MTT assay MCF-7 Prostate cancer IC50 : 8.64μM
dbacp03490 K8, 23-DPT9 MDILKKSKFLILFLGVVSLSICKEEKRENEEEMEQDDEQSEMKRALWKEVLKNAGKAALNEINNLVQGGQ Northern orange-legged leaf frog Disruption of cell membranes MTT assay U251MG Brain tumor IC50 : 18.51μM
dbacp03491 K8, 23-DPT9 MDILKKSKFLILFLGVVSLSICKEEKRENEEEMEQDDEQSEMKRALWKEVLKNAGKAALNEINNLVQGGQ Northern orange-legged leaf frog Disruption of cell membranes MTT assay U251MG Breast cancer IC50 : 18.51μM
dbacp03492 K8, 23-DPT9 MDILKKSKFLILFLGVVSLSICKEEKRENEEEMEQDDEQSEMKRALWKEVLKNAGKAALNEINNLVQGGQ Northern orange-legged leaf frog Disruption of cell membranes MTT assay U251MG Pancreatic cancer IC50 : 18.51μM
dbacp03493 K8, 23-DPT9 MDILKKSKFLILFLGVVSLSICKEEKRENEEEMEQDDEQSEMKRALWKEVLKNAGKAALNEINNLVQGGQ Northern orange-legged leaf frog Disruption of cell membranes MTT assay U251MG Lung cancer IC50 : 18.51μM
dbacp03494 K8, 23-DPT9 MDILKKSKFLILFLGVVSLSICKEEKRENEEEMEQDDEQSEMKRALWKEVLKNAGKAALNEINNLVQGGQ Northern orange-legged leaf frog Disruption of cell membranes MTT assay U251MG Prostate cancer IC50 : 18.51μM
dbacp03495 K8, 23-DPT9 MDILKKSKFLILFLGVVSLSICKEEKRENEEEMEQDDEQSEMKRALWKEVLKNAGKAALNEINNLVQGGQ Northern orange-legged leaf frog Disruption of cell membranes MTT assay H157 Brain tumor IC50 : 9.88μM
dbacp03496 K8, 23-DPT9 MDILKKSKFLILFLGVVSLSICKEEKRENEEEMEQDDEQSEMKRALWKEVLKNAGKAALNEINNLVQGGQ Northern orange-legged leaf frog Disruption of cell membranes MTT assay H157 Breast cancer IC50 : 9.88μM
dbacp03497 K8, 23-DPT9 MDILKKSKFLILFLGVVSLSICKEEKRENEEEMEQDDEQSEMKRALWKEVLKNAGKAALNEINNLVQGGQ Northern orange-legged leaf frog Disruption of cell membranes MTT assay H157 Pancreatic cancer IC50 : 9.88μM
dbacp03498 K8, 23-DPT9 MDILKKSKFLILFLGVVSLSICKEEKRENEEEMEQDDEQSEMKRALWKEVLKNAGKAALNEINNLVQGGQ Northern orange-legged leaf frog Disruption of cell membranes MTT assay H157 Lung cancer IC50 : 9.88μM
dbacp03499 K8, 23-DPT9 MDILKKSKFLILFLGVVSLSICKEEKRENEEEMEQDDEQSEMKRALWKEVLKNAGKAALNEINNLVQGGQ Northern orange-legged leaf frog Disruption of cell membranes MTT assay H157 Prostate cancer IC50 : 9.88μM
dbacp03500 K8, 23-DPT9 MDILKKSKFLILFLGVVSLSICKEEKRENEEEMEQDDEQSEMKRALWKEVLKNAGKAALNEINNLVQGGQ Northern orange-legged leaf frog Disruption of cell membranes MTT assay PC-3 Brain tumor IC50 : 9.97μM
dbacp03501 K8, 23-DPT9 MDILKKSKFLILFLGVVSLSICKEEKRENEEEMEQDDEQSEMKRALWKEVLKNAGKAALNEINNLVQGGQ Northern orange-legged leaf frog Disruption of cell membranes MTT assay PC-3 Breast cancer IC50 : 9.97μM
dbacp03502 K8, 23-DPT9 MDILKKSKFLILFLGVVSLSICKEEKRENEEEMEQDDEQSEMKRALWKEVLKNAGKAALNEINNLVQGGQ Northern orange-legged leaf frog Disruption of cell membranes MTT assay PC-3 Pancreatic cancer IC50 : 9.97μM
dbacp03503 K8, 23-DPT9 MDILKKSKFLILFLGVVSLSICKEEKRENEEEMEQDDEQSEMKRALWKEVLKNAGKAALNEINNLVQGGQ Northern orange-legged leaf frog Disruption of cell membranes MTT assay PC-3 Lung cancer IC50 : 9.97μM
dbacp03504 K8, 23-DPT9 MDILKKSKFLILFLGVVSLSICKEEKRENEEEMEQDDEQSEMKRALWKEVLKNAGKAALNEINNLVQGGQ Northern orange-legged leaf frog Disruption of cell membranes MTT assay PC-3 Prostate cancer IC50 : 9.97μM
dbacp03505 K8, 23-DPT9 MDILKKSKFLILFLGVVSLSICKEEKRENEEEMEQDDEQSEMKRALWKEVLKNAGKAALNEINNLVQGGQ Northern orange-legged leaf frog Disruption of cell membranes MTT assay PANC-1 Brain tumor IC50 : 11.17μM
dbacp03506 K8, 23-DPT9 MDILKKSKFLILFLGVVSLSICKEEKRENEEEMEQDDEQSEMKRALWKEVLKNAGKAALNEINNLVQGGQ Northern orange-legged leaf frog Disruption of cell membranes MTT assay PANC-1 Breast cancer IC50 : 11.17μM
dbacp03507 K8, 23-DPT9 MDILKKSKFLILFLGVVSLSICKEEKRENEEEMEQDDEQSEMKRALWKEVLKNAGKAALNEINNLVQGGQ Northern orange-legged leaf frog Disruption of cell membranes MTT assay PANC-1 Pancreatic cancer IC50 : 11.17μM
dbacp03508 K8, 23-DPT9 MDILKKSKFLILFLGVVSLSICKEEKRENEEEMEQDDEQSEMKRALWKEVLKNAGKAALNEINNLVQGGQ Northern orange-legged leaf frog Disruption of cell membranes MTT assay PANC-1 Lung cancer IC50 : 11.17μM
dbacp03509 K8, 23-DPT9 MDILKKSKFLILFLGVVSLSICKEEKRENEEEMEQDDEQSEMKRALWKEVLKNAGKAALNEINNLVQGGQ Northern orange-legged leaf frog Disruption of cell membranes MTT assay PANC-1 Prostate cancer IC50 : 11.17μM
dbacp03510 K8, 23-DPT9 MDILKKSKFLILFLGVVSLSICKEEKRENEEEMEQDDEQSEMKRALWKEVLKNAGKAALNEINNLVQGGQ Northern orange-legged leaf frog Disruption of cell membranes MTT assay HMEC-1 Brain tumor IC50 : 48.80μM
dbacp03511 K8, 23-DPT9 MDILKKSKFLILFLGVVSLSICKEEKRENEEEMEQDDEQSEMKRALWKEVLKNAGKAALNEINNLVQGGQ Northern orange-legged leaf frog Disruption of cell membranes MTT assay HMEC-1 Breast cancer IC50 : 48.80μM
dbacp03512 K8, 23-DPT9 MDILKKSKFLILFLGVVSLSICKEEKRENEEEMEQDDEQSEMKRALWKEVLKNAGKAALNEINNLVQGGQ Northern orange-legged leaf frog Disruption of cell membranes MTT assay HMEC-1 Pancreatic cancer IC50 : 48.80μM
dbacp03513 K8, 23-DPT9 MDILKKSKFLILFLGVVSLSICKEEKRENEEEMEQDDEQSEMKRALWKEVLKNAGKAALNEINNLVQGGQ Northern orange-legged leaf frog Disruption of cell membranes MTT assay HMEC-1 Lung cancer IC50 : 48.80μM
dbacp03514 K8, 23-DPT9 MDILKKSKFLILFLGVVSLSICKEEKRENEEEMEQDDEQSEMKRALWKEVLKNAGKAALNEINNLVQGGQ Northern orange-legged leaf frog Disruption of cell membranes MTT assay HMEC-1 Prostate cancer IC50 : 48.80μM
dbacp03516 Kassiniatuerin-3 FIQHLIPLIPHAIQGIKDIF Senegal running frog, Africa Membranolytic mechanism MTT assay NCI-H23 Non-small cell Lung cancer IC50 : 4.52 µM
dbacp03517 Kassiniatuerin-3 FIQHLIPLIPHAIQGIKDIF Senegal running frog, Africa Membranolytic mechanism MTT assay NCI-H157 Non-small cell Lung cancer IC50 : 21.54 µM
dbacp03518 Kassiniatuerin-3 FIQHLIPLIPHAIQGIKDIF Senegal running frog, Africa Membranolytic mechanism MTT assay NCI-H460 Non-small cell Lung cancer IC50 : 1.67 µM
dbacp03519 Kassiniatuerin-3 FIQHLIPLIPHAIQGIKDIF Senegal running frog, Africa Membranolytic mechanism MTT assay NCI-H838 Non-small cell Lung cancer IC50 : 10.03 µM
dbacp03520 Kassiniatuerin-3 FIQHLIPLIPHAIQGIKDIF Senegal running frog, Africa Membranolytic mechanism MTT assay LNCaP Non-small cell Lung cancer IC50 : 3.79 µM
dbacp03521 Kassiniatuerin-3 FIQHLIPLIPHAIQGIKDIF Senegal running frog, Africa Membranolytic mechanism MTT assay U-251 MG Glioblastoma (astrocytoma) IC50 : 13.20 µM
dbacp03531 L-amino acid oxidase (CC-LAAO) (LAO) (EC 1.4.3.2) MNVFFMFSLLFLAALESCADDKNPLEEEFFEADYEEFLLIAKNGLQQTSNPKRVVIVGAGMSGLSAAYVLAKTGHEVILLEASERVGGRVSTYRNDQEGWYANLGPMRLPERHRIVREYIRKFGLQLNEFSQENENAWYFIKNIRKRVGEVNKDPGVLEYPVKPSEKGKSAPQLYRDSLQKIIEEYGRSNCSYILNKYDTYSTKDYLIKEGNLSPGAVDMVGDLLNEDSGYYVSFIESLKPDDIFAYENRFDEIVGGFDKLPTSMYQAIQEKVRLNVRVIKIQQDVKEVTVTYQTPAKNLSYVTADYVIVCTTSGAARRIKFEPPLPLKKAHALRSVHYRSGTKIFLTCTKKFWEDDGIHGGKSITDRPSRLIHYPNHNFPNGIGVLVIFTIADDADFFLALDNKTIADIVIHDLSLIHQLPKEKIRDLCYVSMIQKWSLDKYAMGGITTFTPYQFQHFSEALTAPVDRIYFAGEYTAQAHGWIDSTIKSGLTAARDVNRASENPSGIHLSNDNEL Horned desert vip Cytotoxic effects MTT assay B16F10 Not found IC50 : 2 µg/mL
dbacp03532 L-amino acid oxidase (CC-LAAO) (LAO) (EC 1.4.3.2) MNVFFMFSLLFLAALESCADDKNPLEEEFFEADYEEFLLIAKNGLQQTSNPKRVVIVGAGMSGLSAAYVLAKTGHEVILLEASERVGGRVSTYRNDQEGWYANLGPMRLPERHRIVREYIRKFGLQLNEFSQENENAWYFIKNIRKRVGEVNKDPGVLEYPVKPSEKGKSAPQLYRDSLQKIIEEYGRSNCSYILNKYDTYSTKDYLIKEGNLSPGAVDMVGDLLNEDSGYYVSFIESLKPDDIFAYENRFDEIVGGFDKLPTSMYQAIQEKVRLNVRVIKIQQDVKEVTVTYQTPAKNLSYVTADYVIVCTTSGAARRIKFEPPLPLKKAHALRSVHYRSGTKIFLTCTKKFWEDDGIHGGKSITDRPSRLIHYPNHNFPNGIGVLVIFTIADDADFFLALDNKTIADIVIHDLSLIHQLPKEKIRDLCYVSMIQKWSLDKYAMGGITTFTPYQFQHFSEALTAPVDRIYFAGEYTAQAHGWIDSTIKSGLTAARDVNRASENPSGIHLSNDNEL Horned desert vip Cytotoxic effects MTT assay PC12 Not found IC50 : 3.5 µg/mL
dbacp03533 L-amino acid oxidase (CC-LAAO) (LAO) (EC 1.4.3.2) MNVFFMFSLLFLAALESCADDKNPLEEEFFEADYEEFLLIAKNGLQQTSNPKRVVIVGAGMSGLSAAYVLAKTGHEVILLEASERVGGRVSTYRNDQEGWYANLGPMRLPERHRIVREYIRKFGLQLNEFSQENENAWYFIKNIRKRVGEVNKDPGVLEYPVKPSEKGKSAPQLYRDSLQKIIEEYGRSNCSYILNKYDTYSTKDYLIKEGNLSPGAVDMVGDLLNEDSGYYVSFIESLKPDDIFAYENRFDEIVGGFDKLPTSMYQAIQEKVRLNVRVIKIQQDVKEVTVTYQTPAKNLSYVTADYVIVCTTSGAARRIKFEPPLPLKKAHALRSVHYRSGTKIFLTCTKKFWEDDGIHGGKSITDRPSRLIHYPNHNFPNGIGVLVIFTIADDADFFLALDNKTIADIVIHDLSLIHQLPKEKIRDLCYVSMIQKWSLDKYAMGGITTFTPYQFQHFSEALTAPVDRIYFAGEYTAQAHGWIDSTIKSGLTAARDVNRASENPSGIHLSNDNEL Horned desert vip Cytotoxic effects MTT assay MCF-7 Not found IC50 : 4 µg/mL
dbacp03534 L-amino acid oxidase (CC-LAAO) (LAO) (EC 1.4.3.2) MNVFFMFSLLFLAALESCADDKNPLEEEFFEADYEEFLLIAKNGLQQTSNPKRVVIVGAGMSGLSAAYVLAKTGHEVILLEASERVGGRVSTYRNDQEGWYANLGPMRLPERHRIVREYIRKFGLQLNEFSQENENAWYFIKNIRKRVGEVNKDPGVLEYPVKPSEKGKSAPQLYRDSLQKIIEEYGRSNCSYILNKYDTYSTKDYLIKEGNLSPGAVDMVGDLLNEDSGYYVSFIESLKPDDIFAYENRFDEIVGGFDKLPTSMYQAIQEKVRLNVRVIKIQQDVKEVTVTYQTPAKNLSYVTADYVIVCTTSGAARRIKFEPPLPLKKAHALRSVHYRSGTKIFLTCTKKFWEDDGIHGGKSITDRPSRLIHYPNHNFPNGIGVLVIFTIADDADFFLALDNKTIADIVIHDLSLIHQLPKEKIRDLCYVSMIQKWSLDKYAMGGITTFTPYQFQHFSEALTAPVDRIYFAGEYTAQAHGWIDSTIKSGLTAARDVNRASENPSGIHLSNDNEL Horned desert vip Cytotoxic effects MTT assay MDA-MB-231 Not found IC50 : 6 µg/mL
dbacp03538 L-amino-acid oxidase (BatroxLAAO) (LAO) (EC 1.4.3.2) MNVFFTFSLLFLAALGSCADDRNPLEECFRETDYEEFLEIAKNGLSTTSNPKRVVIVGAGMSGLSAAYVLANAGHQVTVLEASERAGGRVKTYRNEKEGWYANLGPMRLPEKHRIVREYIRKFDLQLNEFSQENENAWYFIKNIRKRVGEVNKDPGVLEYPVKPSEVGKSAGQLYEESLQKAVEELRRTNCSYMLNKYDTYSTKEYLLKEGNLSPGAVDMIGDLLNEDSGYYVSFIESLKHDDIFAYEKRFDEIVGGMDKLPTSMYQAIQEKVHLNARVIKIQQDVKEVTVTYQTSEKETLSVTADYVIVCTTSRAARRIKFEPPLPPKKAHALRSVHYRSGTKIFLTCTKKFWEDDGIHGGKSTTDLPSRFIYYPNHNFPNGVGVIIAYGIGDDANYFQALDFEDCGDIVINDLSLIHQLPKEEIQAICRPSMIQRWSLDKYAMGGITTFTPYQFQHFSEALTAPVDRIYFAGEYTAQAHGWIDSTIKSGLRAARDVNRASEIKK Common lancehead Inducing apoptosis MTT assay PC12 Not found Not found
dbacp03539 L-amino-acid oxidase (BatroxLAAO) (LAO) (EC 1.4.3.2) MNVFFTFSLLFLAALGSCADDRNPLEECFRETDYEEFLEIAKNGLSTTSNPKRVVIVGAGMSGLSAAYVLANAGHQVTVLEASERAGGRVKTYRNEKEGWYANLGPMRLPEKHRIVREYIRKFDLQLNEFSQENENAWYFIKNIRKRVGEVNKDPGVLEYPVKPSEVGKSAGQLYEESLQKAVEELRRTNCSYMLNKYDTYSTKEYLLKEGNLSPGAVDMIGDLLNEDSGYYVSFIESLKHDDIFAYEKRFDEIVGGMDKLPTSMYQAIQEKVHLNARVIKIQQDVKEVTVTYQTSEKETLSVTADYVIVCTTSRAARRIKFEPPLPPKKAHALRSVHYRSGTKIFLTCTKKFWEDDGIHGGKSTTDLPSRFIYYPNHNFPNGVGVIIAYGIGDDANYFQALDFEDCGDIVINDLSLIHQLPKEEIQAICRPSMIQRWSLDKYAMGGITTFTPYQFQHFSEALTAPVDRIYFAGEYTAQAHGWIDSTIKSGLRAARDVNRASEIKK Common lancehead Inducing apoptosis MTT assay B16F10 Not found Not found
dbacp03540 L-amino-acid oxidase (BatroxLAAO) (LAO) (EC 1.4.3.2) MNVFFTFSLLFLAALGSCADDRNPLEECFRETDYEEFLEIAKNGLSTTSNPKRVVIVGAGMSGLSAAYVLANAGHQVTVLEASERAGGRVKTYRNEKEGWYANLGPMRLPEKHRIVREYIRKFDLQLNEFSQENENAWYFIKNIRKRVGEVNKDPGVLEYPVKPSEVGKSAGQLYEESLQKAVEELRRTNCSYMLNKYDTYSTKEYLLKEGNLSPGAVDMIGDLLNEDSGYYVSFIESLKHDDIFAYEKRFDEIVGGMDKLPTSMYQAIQEKVHLNARVIKIQQDVKEVTVTYQTSEKETLSVTADYVIVCTTSRAARRIKFEPPLPPKKAHALRSVHYRSGTKIFLTCTKKFWEDDGIHGGKSTTDLPSRFIYYPNHNFPNGVGVIIAYGIGDDANYFQALDFEDCGDIVINDLSLIHQLPKEEIQAICRPSMIQRWSLDKYAMGGITTFTPYQFQHFSEALTAPVDRIYFAGEYTAQAHGWIDSTIKSGLRAARDVNRASEIKK Common lancehead Inducing apoptosis MTT assay HL-60 Not found Not found
dbacp03541 L-amino-acid oxidase (BatroxLAAO) (LAO) (EC 1.4.3.2) MNVFFTFSLLFLAALGSCADDRNPLEECFRETDYEEFLEIAKNGLSTTSNPKRVVIVGAGMSGLSAAYVLANAGHQVTVLEASERAGGRVKTYRNEKEGWYANLGPMRLPEKHRIVREYIRKFDLQLNEFSQENENAWYFIKNIRKRVGEVNKDPGVLEYPVKPSEVGKSAGQLYEESLQKAVEELRRTNCSYMLNKYDTYSTKEYLLKEGNLSPGAVDMIGDLLNEDSGYYVSFIESLKHDDIFAYEKRFDEIVGGMDKLPTSMYQAIQEKVHLNARVIKIQQDVKEVTVTYQTSEKETLSVTADYVIVCTTSRAARRIKFEPPLPPKKAHALRSVHYRSGTKIFLTCTKKFWEDDGIHGGKSTTDLPSRFIYYPNHNFPNGVGVIIAYGIGDDANYFQALDFEDCGDIVINDLSLIHQLPKEEIQAICRPSMIQRWSLDKYAMGGITTFTPYQFQHFSEALTAPVDRIYFAGEYTAQAHGWIDSTIKSGLRAARDVNRASEIKK Common lancehead Inducing apoptosis MTT assay Jurkat Acute T-cell Leukemia Not found
dbacp03544 L-amino-acid oxidase ACTX-8 ADDRNPLEEFRENNYEEFL Venom base Inducing apoptosis MTT assay HeLa Cervical cancer MIC : 20 μg/ml
dbacp03545 L-amino-acid oxidase ACTX-8 (LAAO) (LAO) (EC 1.4.3.2) ADDRNPLEEFRENNYEEFL Hundred-pace Snake Inducing apoptosis MTT assay HeLa Cervical cancer MIC : 20 μg/ml
dbacp03721 LFB GLFSVVKGVLKGVGKNVSGSLLDQLKCKISGGC The Fujian Large Headed Frog Cell Apoptosis MTT assay H460 Colon cancer IC50 : 3.47 μM
dbacp03722 LFB GLFSVVKGVLKGVGKNVSGSLLDQLKCKISGGC The Fujian Large Headed Frog Cell Apoptosis MTT assay MB435 Melanocyte IC50 : 18.99 μM
dbacp03723 LFB GLFSVVKGVLKGVGKNVSGSLLDQLKCKISGGC The Fujian Large Headed Frog Cell Apoptosis MTT assay U251MG Breast cancer IC50 : 2.32 μM
dbacp03724 LFB GLFSVVKGVLKGVGKNVSGSLLDQLKCKISGGC The Fujian Large Headed Frog Cell Apoptosis MTT assay HCT116 Lung cancer IC50 : 2.02 μM
dbacp03725 LFB GLFSVVKGVLKGVGKNVSGSLLDQLKCKISGGC The Fujian Large Headed Frog, China, Asia Cell Apoptosis MTT assay H460 Colon cancer IC50 : 3.47 μM
dbacp03726 LFB GLFSVVKGVLKGVGKNVSGSLLDQLKCKISGGC The Fujian Large Headed Frog, China, Asia Cell Apoptosis MTT assay MB435 Melanocyte IC50 : 18.99 μM
dbacp03727 LFB GLFSVVKGVLKGVGKNVSGSLLDQLKCKISGGC The Fujian Large Headed Frog, China, Asia Cell Apoptosis MTT assay U251MG Breast cancer IC50 : 2.32 μM
dbacp03728 LFB GLFSVVKGVLKGVGKNVSGSLLDQLKCKISGGC The Fujian Large Headed Frog, China, Asia Cell Apoptosis MTT assay HCT116 Lung cancer IC50 : 2.02 μM
dbacp03741 LfcinB (Bovine lactoferricin) FKCRRWQWRM Not found Inducing apoptosis MTT assay Jurkat Leukemia Not found
dbacp03742 LfcinB (Bovine lactoferricin) FKCRRWQWRM Not found Inducing apoptosis MTT assay MCF-7 Leukemia Not found
dbacp03743 LfcinB (Bovine lactoferricin) FKCRRWQWRM Not found Inducing apoptosis MTT assay Colo-35 Leukemia Not found
dbacp03744 LfcinB (Bovine lactoferricin) FKCRRWQWRM Not found Inducing apoptosis MTT assay MDA-MB-435 Leukemia Not found
dbacp03745 LfcinB (Bovine lactoferricin) FKCRRWQWRM Not found Inducing apoptosis MTT assay SKov3 Leukemia Not found
dbacp03746 LfcinB (Bovine lactoferricin) FKCRRWQWRM Not found Inducing apoptosis MTT assay CAov3 Leukemia Not found
dbacp03747 LfcinB (Bovine lactoferricin) FKCRRWQWRM Not found Inducing apoptosis MTT assay HT-29 Leukemia Not found
dbacp03748 LfcinB (Bovine lactoferricin) FKCRRWQWRM Not found Inducing apoptosis MTT assay T-47D Leukemia Not found
dbacp03749 LfcinB (Bovine lactoferricin) FKCRRWQWRM Not found Inducing apoptosis MTT assay CCRF-CEM Leukemia Not found
dbacp03750 LfcinB (Bovine lactoferricin) FKCRRWQWRM Not found Inducing apoptosis MTT assay K562 Leukemia Not found
dbacp03751 LfcinB (Bovine lactoferricin) FKCRRWQWRM Not found Inducing apoptosis MTT assay Raji Leukemia Not found
dbacp03752 LHRH–BH3 peptide luteinizing hormone-releasing hormone (LHRH) QHWSYGLRPGMGQVGRQLAIIGDDINRRY Effectors (BAK, BAX) Inducing apoptosis Cytotoxicity assay, MTT assay A2780 Ovarian carcinoma Not found
dbacp03753 LHRH–BH3 peptide luteinizing hormone-releasing hormone (LHRH) QHWSYGLRPGMGQVGRQLAIIGDDINRRY Effectors (BAK, BAX) Inducing apoptosis Cytotoxicity assay, MTT assay MCF-7 Human breast cancer Not found
dbacp03754 LHRH–BH3 peptide luteinizing hormone-releasing hormone (LHRH) QHWSYGLRPGMGQVGRQLAIIGDDINRRY Effectors (BAK, BAX) Inducing apoptosis Cytotoxicity assay, MTT assay PC-3 Prostate cancer Not found
dbacp03755 LHRH–BH3 peptide luteinizing hormone-releasing hormone (LHRH) QHWSYGLRPGMGQVGRQLAIIGDDINRRY Effectors (BAK, BAX) Inducing apoptosis Cytotoxicity assay, MTT assay SKOV-3 LHRH negative ovarian cancer Not found
dbacp04164 LL-37(13-37)(C-terminal fragment of LL-37; Human, mammals, animals) IGKEFKRIVQRIKDFLRNLVPRTES Human Not specified MTT assay KBv Tumor LC50 : 39 ± 0 μM
dbacp04165 LL-37(13-37)(C-terminal fragment of LL-37; Human, mammals, animals) IGKEFKRIVQRIKDFLRNLVPRTES Human Not specified MTT assay KB Oral cancer LC50 : 40 ± 0 μM
dbacp04166 LL-37(13-37)(C-terminal fragment of LL-37; Human, mammals, animals) IGKEFKRIVQRIKDFLRNLVPRTES Human Not specified MTT assay HBMEC Prostate cancer LC50 : 38 ± 3 μM
dbacp04171 LL-37(17-29)(C-terminal fragment of LL-37; Human, mammals, animals) FKRIVQRIKDFLRNLV Human Not specified MTT assay KBv Tumor LC50 : 60 ± 0 μM
dbacp04172 LL-37(17-29)(C-terminal fragment of LL-37; Human, mammals, animals) FKRIVQRIKDFLRNLV Human Not specified MTT assay KB Oral cancer LC50 : 57 ± 3 μM
dbacp04173 LL-37(17-29)(C-terminal fragment of LL-37; Human, mammals, animals) FKRIVQRIKDFLRNLV Human Not specified MTT assay HBMEC Prostate cancer LC50 : 55 ± 2 μM
dbacp04174 LL-37(17-32)(C-terminal fragment of LL-37; Human, mammals, animals) FKRIVQRIKDFLRNLV Human Not specified MTT assay KBv Tumor LC50 : 30 ± 0 μM
dbacp04175 LL-37(17-32)(C-terminal fragment of LL-37; Human, mammals, animals) FKRIVQRIKDFLRNLV Human Not specified MTT assay KB Oral cancer LC50 : 30 ± 1 μM
dbacp04176 LL-37(17-32)(C-terminal fragment of LL-37; Human, mammals, animals) FKRIVQRIKDFLRNLV Human Not specified MTT assay HBMEC Prostate cancer LC50 : 25 ± 1 μM
dbacp04309 Lunasin SKWQHQQDSCRKQLQGVNLTPCEKHIMEKIQGRDDDDDDDDDD Plant sources Inducing apoptosis MTT assay HCT116-derived spheres Colorectal cancer IC50 : 161.0 ± 2.4 μM
dbacp04310 Lunasin SKWQHQQDSCRKQLQGVNLTPCEKHIMEKIQGRDDDDDDDDDD Plant sources Inducing apoptosis MTT assay HCT-116 parentl Colorectal cancer IC50 : 107.5 ± 1.9 μM
dbacp04317 LvHemB1 DVNFLLHKIYGNIRY Marine invertebrates Inducing apoptosis MTT assay HeLa Cervical cancer Not found
dbacp04318 LvHemB1 DVNFLLHKIYGNIRY Marine invertebrates Inducing apoptosis MTT assay HeLa Esophageal cancer Not found
dbacp04319 LvHemB1 DVNFLLHKIYGNIRY Marine invertebrates Inducing apoptosis MTT assay HeLa Liver cancer Not found
dbacp04320 LvHemB1 DVNFLLHKIYGNIRY Marine invertebrates Inducing apoptosis MTT assay HeLa Bladder cancer Not found
dbacp04321 LvHemB1 DVNFLLHKIYGNIRY Marine invertebrates Inducing apoptosis MTT assay EC109 Cervical cancer Not found
dbacp04322 LvHemB1 DVNFLLHKIYGNIRY Marine invertebrates Inducing apoptosis MTT assay EC109 Esophageal cancer Not found
dbacp04323 LvHemB1 DVNFLLHKIYGNIRY Marine invertebrates Inducing apoptosis MTT assay EC109 Liver cancer Not found
dbacp04324 LvHemB1 DVNFLLHKIYGNIRY Marine invertebrates Inducing apoptosis MTT assay EC109 Bladder cancer Not found
dbacp04325 LvHemB1 DVNFLLHKIYGNIRY Marine invertebrates Inducing apoptosis MTT assay HepG2 Cervical cancer Not found
dbacp04326 LvHemB1 DVNFLLHKIYGNIRY Marine invertebrates Inducing apoptosis MTT assay HepG2 Esophageal cancer Not found
dbacp04327 LvHemB1 DVNFLLHKIYGNIRY Marine invertebrates Inducing apoptosis MTT assay HepG2 Liver cancer Not found
dbacp04328 LvHemB1 DVNFLLHKIYGNIRY Marine invertebrates Inducing apoptosis MTT assay HepG2 Bladder cancer Not found
dbacp04329 LvHemB1 DVNFLLHKIYGNIRY Marine invertebrates Inducing apoptosis MTT assay EJ Cervical cancer Not found
dbacp04330 LvHemB1 DVNFLLHKIYGNIRY Marine invertebrates Inducing apoptosis MTT assay EJ Esophageal cancer Not found
dbacp04331 LvHemB1 DVNFLLHKIYGNIRY Marine invertebrates Inducing apoptosis MTT assay EJ Liver cancer Not found
dbacp04332 LvHemB1 DVNFLLHKIYGNIRY Marine invertebrates Inducing apoptosis MTT assay EJ Bladder cancer Not found
dbacp04333 LvHemB1 DVNFLLHKIYGNIRY Marine invertebrates Inducing apoptosis MTT assay THLE-3 Cervical cancer Not found
dbacp04334 LvHemB1 DVNFLLHKIYGNIRY Marine invertebrates Inducing apoptosis MTT assay THLE-3 Esophageal cancer Not found
dbacp04335 LvHemB1 DVNFLLHKIYGNIRY Marine invertebrates Inducing apoptosis MTT assay THLE-3 Liver cancer Not found
dbacp04336 LvHemB1 DVNFLLHKIYGNIRY Marine invertebrates Inducing apoptosis MTT assay THLE-3 Bladder cancer Not found
dbacp04541 Malanin chain A DYPKLTFTTS Plant sources Inducing apoptosis MTT assay HeLa Cervical cancer IC50 : 0.15 ± 0.08 nM
dbacp04542 Malanin chain A DYPKLTFTTS Plant sources Inducing apoptosis MTT assay PC-12 Breast cancer IC50 : 7.71 ± 0.24 nM
dbacp04543 Malanin chain A DYPKLTFTTS Plant sources Inducing apoptosis MTT assay MCF-7 Leukemia IC50 : 11.20 ± 0.02 nM
dbacp04544 Malanin chain A DYPKLTFTTS Plant sources Inducing apoptosis MTT assay K562 Not found IC50 : 15.80 ± 0.09 nM
dbacp04545 Malanin chain A DYPKLTFTTS Plant sources Inducing apoptosis MTT assay Vero Not found IC50 : 2.79 ± 0.05 nM
dbacp04546 Malanin chain A DYPKLTFTTS Plant sources Inducing apoptosis MTT assay MDCK Not found IC50 : 3.92 ± 0.01 nM
dbacp04547 Malanin chain B DETCTDEEFN Plant sources Inducing apoptosis MTT assay HeLa Cervical cancer IC50 : 0.15 ± 0.08 nM
dbacp04548 Malanin chain B DETCTDEEFN Plant sources Inducing apoptosis MTT assay PC-12 Breast cancer IC50 : 7.71 ± 0.24 nM
dbacp04549 Malanin chain B DETCTDEEFN Plant sources Inducing apoptosis MTT assay MCF-7 Leukemia IC50 : 11.20 ± 0.02 nM
dbacp04550 Malanin chain B DETCTDEEFN Plant sources Inducing apoptosis MTT assay K562 Not found IC50 : 15.80 ± 0.09 nM
dbacp04551 Malanin chain B DETCTDEEFN Plant sources Inducing apoptosis MTT assay Vero Not found IC50 : 2.79 ± 0.05 nM
dbacp04552 Malanin chain B DETCTDEEFN Plant sources Inducing apoptosis MTT assay MDCK Not found IC50 : 3.92 ± 0.01 nM
dbacp04573 Mastoparan-C LNLKALLAVAKKIL European hornet Apoptosis MTT assay H157 Non-small cell Lung cancer IC50 : 13.57 μM
dbacp04574 Mastoparan-C LNLKALLAVAKKIL European hornet Apoptosis MTT assay MBD-MB-435S Melanocyte IC50 : 1.4 μM
dbacp04575 Mastoparan-C LNLKALLAVAKKIL European hornet Apoptosis MTT assay PC-3 Human prostate carcinoma IC50 : 1.4 μM
dbacp04576 Mastoparan-C LNLKALLAVAKKIL European hornet Apoptosis MTT assay U251-MG Human glioblastoma astrocytoma IC50 : 1.4 μM
dbacp04577 Mastoparan-C LNLKALLAVAKKIL European hornet Apoptosis MTT assay MCF-7 Human Breast cancer IC50 : 1.4 μM
dbacp04592 Mauriporin MNKKTLLVIFFITMLIVDEVNSFKIGGFIKKLWRSKLAKKLRAKGRELLKDYANRVINGGPEEEAAVPAERRR Fat-tailed scorpion Induce cell apoptosis; Targets on the cell membranes and caused membrane lysis MTT assay, Lactate dehydrogenase (LDH) Release assay Hela Human cervical cancer IC50 : 27.9 μM - 283.3 μM
dbacp04593 Mauriporin MNKKTLLVIFFITMLIVDEVNSFKIGGFIKKLWRSKLAKKLRAKGRELLKDYANRVINGGPEEEAAVPAERRR Fat-tailed scorpion Induce cell apoptosis; Targets on the cell membranes and caused membrane lysis MTT assay, Lactate dehydrogenase (LDH) Release assay SACC-83 Human salivary adenoid cystic carcinoma IC50 : 27.9 μM - 283.3 μM
dbacp04594 Mauriporin MNKKTLLVIFFITMLIVDEVNSFKIGGFIKKLWRSKLAKKLRAKGRELLKDYANRVINGGPEEEAAVPAERRR Fat-tailed scorpion Induce cell apoptosis; Targets on the cell membranes and caused membrane lysis MTT assay, Lactate dehydrogenase (LDH) Release assay HepG2 Human liver cancer IC50 : 27.9 μM - 283.3 μM
dbacp04595 Mauriporin MNKKTLLVIFFITMLIVDEVNSFKIGGFIKKLWRSKLAKKLRAKGRELLKDYANRVINGGPEEEAAVPAERRR Fat-tailed scorpion Induce cell apoptosis; Targets on the cell membranes and caused membrane lysis MTT assay, Lactate dehydrogenase (LDH) Release assay PC-3 Human Prostate cancer IC50 : 27.9 μM - 283.3 μM
dbacp04603 Maximin H1 ILGPVISTIGGVLGGLLKNL Yunnan firebelly toad, China, Asia Not specified MTT assay C8166 Bladder cancer Not found
dbacp04604 Maximin H1 ILGPVISTIGGVLGGLLKNL Yunnan firebelly toad, China, Asia Not specified MTT assay BIU-87 Bladder cancer Not found
dbacp04605 Maximin H1 ILGPVISTIGGVLGGLLKNL Yunnan firebelly toad, China, Asia Not specified MTT assay T27 Bladder cancer Not found
dbacp04653 Melittin GIGAVLKVLTTGLPALISWIKRKRQQ Venom base Inducing apoptosis MTT assay SGC-7901 Gastric cancer Not found
dbacp04658 Melittin-N (MEL-N) (MLT) MKFLVNVALVFMVVYISYIYAAPEPEPAPEPEAEADAEADPEAGIGAVLKVLTTGLPALINWIKRKRQQG Indian honeybee Cytotoxic MTT assay SKOV-3 Ovarian cancer IC50 : 0.5 μM
dbacp04659 Melittin-N (MEL-N) (MLT) MKFLVNVALVFMVVYISYIYAAPEPEPAPEPEAEADAEADPEAGIGAVLKVLTTGLPALINWIKRKRQQG Indian honeybee Cytotoxic MTT assay SKOV-3 Ovarian cancer IC50 : 0.25 μM
dbacp04660 Melittin-N (MEL-N) (MLT) MKFLVNVALVFMVVYISYIYAAPEPEPAPEPEAEADAEADPEAGIGAVLKVLTTGLPALINWIKRKRQQG Indian honeybee Cytotoxic MTT assay PA-1 Ovarian cancer IC50 : 1 μM
dbacp04661 Melittin-N (MEL-N) (MLT) MKFLVNVALVFMVVYISYIYAAPEPEPAPEPEAEADAEADPEAGIGAVLKVLTTGLPALINWIKRKRQQG Indian honeybee Cytotoxic MTT assay PA-1 Ovarian cancer IC50 : 1 μM
dbacp04699 MP12 MDNHVCIPLCPP Not found Inducing apoptosis MTT assay Hep-2 Laryngeal cancer IC50 : 24.7 ± 0.34 Μm
dbacp04820 Nal2-S1 Ac-KKWRKWLAKK-NH2 Not found Necrosis; Apoptosis MTT assay PC9 Human Lung cancer MIC : 25 μM
dbacp04821 Nal2-S1 Ac-KKWRKWLAKK-NH2 Not found Necrosis; Apoptosis MTT assay PC9-G Oral cancer MIC : 25 μM
dbacp04822 Nal2-S1 Ac-KKWRKWLAKK-NH2 Not found Necrosis; Apoptosis MTT assay A549 Human Lung cancer MIC : 25 μM
dbacp04823 Nal2-S1 Ac-KKWRKWLAKK-NH2 Not found Necrosis; Apoptosis MTT assay C9 Oral cancer MIC : 25 μM
dbacp04824 Nal2-S1 Ac-KKWRKWLAKK-NH2 Not found Necrosis; Apoptosis MTT assay OECM-1 Human Lung cancer MIC : 25 μM
dbacp04825 Nal2-S1 Ac-KKWRKWLAKK-NH2 Not found Necrosis; Apoptosis MTT assay SAS Oral cancer MIC : 25 μM
dbacp04868 NK-2 (Mammals, Animals) KILRGVCKKIMRTFLRRISKDILTGKK Mammal Not specified MTT assay EJ Not found IC50 : 8.4 μM
dbacp04869 NK-2 (Mammals, Animals) KILRGVCKKIMRTFLRRISKDILTGKK Mammal Not specified MTT assay PC-3 Not found IC50 : 4.1 μM
dbacp04870 NK-2 (Mammals, Animals) KILRGVCKKIMRTFLRRISKDILTGKK Mammal Not specified MTT assay T24 Not found IC50 : 10.1 μM
dbacp04871 NK-2 (Mammals, Animals) KILRGVCKKIMRTFLRRISKDILTGKK Mammal Not specified MTT assay HL-60 Not found IC50 : 13.7 μM
dbacp04872 NK-dpro (Derived from NK-2) KILPGVCKKIMRPFLRRISKDILTGKK Synthetic construct Not specified MTT assay EJ Not found IC50 : 28.7 μM
dbacp04873 NK-dpro (Derived from NK-2) KILPGVCKKIMRPFLRRISKDILTGKK Synthetic construct Not specified MTT assay PC-3 Not found IC50 : 9.6 μM
dbacp04874 NK-dpro (Derived from NK-2) KILPGVCKKIMRPFLRRISKDILTGKK Synthetic construct Not specified MTT assay T24 Not found IC50 : 39.6 μM
dbacp04875 NK-dpro (Derived from NK-2) KILPGVCKKIMRPFLRRISKDILTGKK Synthetic construct Not specified MTT assay HL-60 Not found IC50 : 48.4 μM
dbacp04876 NK-pro (Derived from NK-2) KILRGVCKKIMRPFLRRISKDILTGKK Synthetic construct Not specified MTT assay EJ Not found IC50 : 23.3 μM
dbacp04877 NK-pro (Derived from NK-2) KILRGVCKKIMRPFLRRISKDILTGKK Synthetic construct Not specified MTT assay PC-3 Not found IC50 : 9.3 μM
dbacp04878 NK-pro (Derived from NK-2) KILRGVCKKIMRPFLRRISKDILTGKK Synthetic construct Not specified MTT assay T24 Not found IC50 : 33.0 μM
dbacp04879 NK-pro (Derived from NK-2) KILRGVCKKIMRPFLRRISKDILTGKK Synthetic construct Not specified MTT assay HL-60 Not found IC50 : 26.1 μM
dbacp05009 Okinawa Habu apoxin protein-1(OHAP-1) ADDRNPLEECFRETDYEEFLEIARNGLKKT Venom base Inducing apoptosis DNA gel electrophoresis assay,TUNEL assay, MTT assay RBR17T Glioma IC50 : 2.1 ± 0.58 µg/ml
dbacp05010 Okinawa Habu apoxin protein-1(OHAP-1) ADDRNPLEECFRETDYEEFLEIARNGLKKT Venom base Inducing apoptosis DNA gel electrophoresis assay,TUNEL assay, MTT assay OHAP-1 Glioma IC50 : 1.9 ± 0.31 µg/ml
dbacp05011 Okinawa Habu apoxin protein-1(OHAP-1) ADDRNPLEECFRETDYEEFLEIARNGLKKT Venom base Inducing apoptosis DNA gel electrophoresis assay,TUNEL assay, MTT assay C6 Glioma IC50 : 2.48 ± 0.26 µg/ml
dbacp05029 p-BIM BH3 (I155R, E158S) EIWIAQELRRRGDpSFNAYYAR‘pS’standsforthephosphorylatedserine BH3-only, Direct activators, BIM analogues Inducing apoptosis MTT assay Not found Prostate cancer Not found
dbacp05030 p-BIM BH3 (R154S, I155R, E158S) EIWIAQELRSRGDpSFNAYYAR‘pS’standsforthephosphorylatedserine BH3-only, Direct activators, BIM analogues Inducing apoptosis MTT assay Not found Prostate cancer Not found
dbacp05031 P04 IGEHTPSALAIMENANVLAR Aldolase A derived Apoptosis inducing MTT assay PDAC Pancreatic ductal adenocarcinoma MIC : 25 µg/mL
dbacp05089 P6 WYIRKIRRFFKWLKKKLKKK Marine invertebrates Inducing apoptosis MTT assay HT-29 Colorectal cancer Not found
dbacp05090 P6 WYIRKIRRFFKWLKKKLKKK Marine invertebrates Inducing apoptosis MTT assay DLD-1 Colorectal cancer Not found
dbacp05091 P6 WYIRKIRRFFKWLKKKLKKK Marine invertebrates Inducing apoptosis MTT assay HCT116 Colorectal cancer Not found
dbacp05092 P6 WYIRKIRRFFKWLKKKLKKK Marine invertebrates Inducing apoptosis MTT assay SW-620 Colorectal cancer Not found
dbacp05093 P6 WYIRKIRRFFKWLKKKLKKK Marine invertebrates Inducing apoptosis MTT assay L02 Colorectal cancer Not found
dbacp05127 PaDef ATCETPSKHFNGLCIRSSNCASVCHGEHFTDGRCQGVRRRCMCLKPC Plant sources Inducing apoptosis MTT assay Jurkat Leukemia Not found
dbacp05130 Pal-pFL-N-Ter-TAT FPWWWPFLRDVFTKGYGFGLGRKKRRQRRRPQ VDAC1(voltage-dependent anion channel1) Inducing apoptosis MTT assay A375 Leukemia IC50 : 5.5 ± 1.1 μM
dbacp05216 PD-L1ip3 GTRLKPLIICVQWPGL Not found Inducing apoptosis MTT assay CT26 Colon cacer Not found
dbacp05217 PE-BBI GALKGCWTKSIPPKPC Edible frog Cell membrane permeabilisation MTT assay DLD-1 Human colorectal cancer IC50 : 50.1 µM
dbacp05218 PE-BBI GALKGCWTKSIPPKPC Edible frog Cell membrane permeabilisation MTT assay DKS8 Human colorectal cancer IC50 : 9.8 µM
dbacp05219 PE-BBI GALKGCWTKSIPPKPC Edible frog Cell membrane permeabilisation MTT assay HCT116 Human colorectal cancer IC50 : 35.4 µM
dbacp05220 PE-BBI GALKGCWTKSIPPKPC Edible frog Cell membrane permeabilisation MTT assay HKE3 Human colorectal cancer IC50 : 50.2 µM
dbacp05222 Penaeidin-2 YRGGYTGPIPRPPPIGRPPLPRVVCACYRLSVSDARNCCIKFGSCCHLVK Pacific white shrimp Induction of apoptosis MTT assay HK-2 Kidney cancer MIC : 100 μg/mL
dbacp05223 Penaeidin-2 YRGGYTGPIPRPPPIGRPPLPRVVCACYRLSVSDARNCCIKFGSCCHLVK Pacific white shrimp Induction of apoptosis MTT assay ACHN Kidney cancer MIC : 100 μg/mL
dbacp05224 Penaeidin-2 YRGGYTGPIPRPPPIGRPPLPRVVCACYRLSVSDARNCCIKFGSCCHLVK Pacific white shrimp Induction of apoptosis MTT assay A498 Kidney cancer MIC : 100 μg/mL
dbacp05241 pentadactylin GLLDTLKGAAKNVVGSLASKVMEKL Not found Inducing apoptosis MTT assay B16F10 Melanoma IC50 : 25.7 µM
dbacp05242 pentadactylin GLLDTLKGAAKNVVGSLASKVMEKL Not found Inducing apoptosis MTT assay FHN Melanoma IC50 : 35.9 µM
dbacp05244 Pentapeptide (ILYMP) ILYMP Marine invertebrates Inducing apoptosis MTT assay DU-145 Prostate cancer IC50 :11.25 mM
dbacp05251 Pep27 MRKEFHNVLSSGQLLADKRPARDYNRK Not found Inducing apoptosis MTT assay AML-2 Acute myelogenous leukemia IC50 : > 70 µM
dbacp05252 Pep27 MRKEFHNVLSSGQLLADKRPARDYNRK Not found Inducing apoptosis MTT assay HL-60 Acute promyelocytic leukemia IC50 : > 70 µM
dbacp05253 Pep27 MRKEFHNVLSSGQLLADKRPARDYNRK Not found Inducing apoptosis MTT assay Jurkat T-cell leukemia IC50 : > 70 µM
dbacp05254 Pep27 MRKEFHNVLSSGQLLADKRPARDYNRK Not found Inducing apoptosis MTT assay SNU-601 Gastric cancer IC50 : > 70 µM
dbacp05255 Pep27 MRKEFHNVLSSGQLLADKRPARDYNRK Not found Inducing apoptosis MTT assay MCF-7 Breast cancer IC50 : > 70 µM
dbacp05257 Pep27 anal1 MWKWFHNVLSSWQLLADKRPARDYNRK Not found Inducing apoptosis MTT assay AML-2 Acute myelogenous leukemia IC50 : 50 µM
dbacp05258 Pep27 anal1 MWKWFHNVLSSWQLLADKRPARDYNRK Not found Inducing apoptosis MTT assay HL-60 Acute promyelocytic leukemia IC50 : 53 µM
dbacp05259 Pep27 anal1 MWKWFHNVLSSWQLLADKRPARDYNRK Not found Inducing apoptosis MTT assay Jurkat T-cell leukemia IC50 : 47 µM
dbacp05260 Pep27 anal1 MWKWFHNVLSSWQLLADKRPARDYNRK Not found Inducing apoptosis MTT assay SNU-601 Gastric cancer IC50 : 37 µM
dbacp05261 Pep27 anal1 MWKWFHNVLSSWQLLADKRPARDYNRK Not found Inducing apoptosis MTT assay MCF-7 Breast cancer IC50 : 55 µM
dbacp05262 Pep27 anal2 MWKWFHNVLSWWWLLADKRPARDYNRK Not found Inducing apoptosis MTT assay AML-2 Acute myelogenous leukemia IC50 : 29 µM
dbacp05263 Pep27 anal2 MWKWFHNVLSWWWLLADKRPARDYNRK Not found Inducing apoptosis MTT assay HL-60 Acute promyelocytic leukemia IC50 : 20 µM
dbacp05264 Pep27 anal2 MWKWFHNVLSWWWLLADKRPARDYNRK Not found Inducing apoptosis MTT assay Jurkat T cell leukemia IC50 : 23 µM
dbacp05265 Pep27 anal2 MWKWFHNVLSWWWLLADKRPARDYNRK Not found Inducing apoptosis MTT assay SNU-601 Gastric cancer IC50 : 25 µM
dbacp05266 Pep27 anal2 MWKWFHNVLSWWWLLADKRPARDYNRK Not found Inducing apoptosis MTT assay MCF-7 Breast cancer IC50 : < 10 µM
dbacp05267 Pep27 anal3 MRKWFHNVLSSGQLLADKWPAWDYNRK Not found Inducing apoptosis MTT assay AML-2 Acute myelogenous leukemia IC50 : 67 µM
dbacp05268 Pep27 anal3 MRKWFHNVLSSGQLLADKWPAWDYNRK Not found Inducing apoptosis MTT assay HL-60 Acute promyelocytic leukemia IC50 : 52 µM
dbacp05269 Pep27 anal3 MRKWFHNVLSSGQLLADKWPAWDYNRK Not found Inducing apoptosis MTT assay Jurkat T cell leukemia IC50 : 50 µM
dbacp05270 Pep27 anal3 MRKWFHNVLSSGQLLADKWPAWDYNRK Not found Inducing apoptosis MTT assay SNU-601 Gastric cancer IC50 : 50 µM
dbacp05271 Pep27 anal3 MRKWFHNVLSSGQLLADKWPAWDYNRK Not found Inducing apoptosis MTT assay MCF-7 Breast cancer IC50 : 38 µM
dbacp05272 Pep27 anal4 MWKEFHNVLSSGQLLADKRWARWYNRW Not found Inducing apoptosis MTT assay AML-2 Acute myelogenous leukemia IC50 : 50 µM
dbacp05273 Pep27 anal4 MWKEFHNVLSSGQLLADKRWARWYNRW Not found Inducing apoptosis MTT assay HL-60 Acute promyelocytic leukemia IC50 : 51 µM
dbacp05274 Pep27 anal4 MWKEFHNVLSSGQLLADKRWARWYNRW Not found Inducing apoptosis MTT assay Jurkat T-cell Leukemia IC50 : 46 µM
dbacp05275 Pep27 anal4 MWKEFHNVLSSGQLLADKRWARWYNRW Not found Inducing apoptosis MTT assay SNU-601 Gastric cancer IC50 : 46 µM
dbacp05276 Pep27 anal4 MWKEFHNVLSSGQLLADKRWARWYNRW Not found Inducing apoptosis MTT assay MCF-7 Breast cancer IC50 : 29 µM
dbacp05277 Pep27 anal5 MWKWFHNVLSSGQLLADKWWAWWYNWW Not found Inducing apoptosis MTT assay AML-2 Acute myelogenous leukemia IC50 : > 70 µM
dbacp05278 Pep27 anal5 MWKWFHNVLSSGQLLADKWWAWWYNWW Not found Inducing apoptosis MTT assay HL-60 Acute promyelocytic leukemia IC50 : > 70 µM
dbacp05279 Pep27 anal5 MWKWFHNVLSSGQLLADKWWAWWYNWW Not found Inducing apoptosis MTT assay Jurkat T cell leukemia IC50 : > 70 µM
dbacp05280 Pep27 anal5 MWKWFHNVLSSGQLLADKWWAWWYNWW Not found Inducing apoptosis MTT assay SNU-601 Gastric cancer IC50 : > 70 µM
dbacp05281 Pep27 anal5 MWKWFHNVLSSGQLLADKWWAWWYNWW Not found Inducing apoptosis MTT assay MCF-7 Breast cancer IC50 : > 70 µM
dbacp05400 Peptide from Lentinus Squarrosulus RYGFTEVAGNFQQHNFGRG Plant sources Inducing apoptosis MTT assay H460 Breast cancer Not found
dbacp05401 Peptide from Lentinus Squarrosulus RYGFTEVAGNFQQHNFGRG Plant sources Inducing apoptosis MTT assay DPCs Breast cancer Not found
dbacp05402 Peptide from Lentinus Squarrosulus RYGFTEVAGNFQQHNFGRG Plant sources Inducing apoptosis MTT assay HK-2 Breast cancer Not found
dbacp05502 PHP ITCPQVTQSLAPCVPYLISG Plant sources Inducing apoptosis MTT assay Eca-109 Not found IC50 : 0.7 µM
dbacp05503 PHP ITCPQVTQSLAPCVPYLISG Plant sources Inducing apoptosis MTT assay HeLa Not found IC50 : 2.74 µM
dbacp05504 PHP ITCPQVTQSLAPCVPYLISG Plant sources Inducing apoptosis MTT assay MGC-7 Not found IC50 : 3.13 µM
dbacp05505 PHP ITCPQVTQSLAPCVPYLISG Plant sources Inducing apoptosis MTT assay B16 Not found IC50 : 1.47 µM
dbacp05548 Phylloseptin-PHa FLSLIPAAISAVSALANHF Northern orange-legged leaf frog Disruption of the membrane MTT assay, Lactate dehydrogenase (LDH) assay MDA-MB-435 Melanocyte LD50 : < 5 µM
dbacp05549 Phylloseptin-PHa FLSLIPAAISAVSALANHF Northern orange-legged leaf frog Disruption of the membrane MTT assay, Lactate dehydrogenase (LDH) assay NCI-H157 Non-small-cell Lung cancer LD50 : < 5 µM
dbacp05550 Phylloseptin-PHa FLSLIPAAISAVSALANHF Northern orange-legged leaf frog Disruption of the membrane MTT assay, Lactate dehydrogenase (LDH) assay PC-3 Human prostate carcinoma LD50 : < 5 µM
dbacp05551 Phylloseptin-PHa FLSLIPAAISAVSALANHF Northern orange-legged leaf frog Disruption of the membrane MTT assay, Lactate dehydrogenase (LDH) assay HCT116 Human colon cancer LD50 : < 5 µM
dbacp05552 Phylloseptin-PHa FLSLIPAAISAVSALANHF Northern orange-legged leaf frog Disruption of the membrane MTT assay, Lactate dehydrogenase (LDH) assay MCF-7 Human breast cancer LD50 : < 5 µM
dbacp05553 Phylloseptin-PHa FLSLIPAAISAVSALANHF Northern orange-legged leaf frog Disruption of the membrane MTT assay, Lactate dehydrogenase (LDH) assay U251MG Human glioblastoma astrocytoma LD50 : < 5 µM
dbacp05576 Pleurocidin GWGSFFKKAAHVGKHVGKAALTHYL Winter flounder Apoptosis inducing; Anti-proliferative activity MTT assay J5 Hepatocellular carcinoma IC50 : 54.9 µM
dbacp05577 Pleurocidin GWGSFFKKAAHVGKHVGKAALTHYL Winter flounder Apoptosis inducing; Anti-proliferative activity MTT assay Hep3B Hepatocellular carcinoma IC50 : 340.9 µM
dbacp05578 Pleurocidin GWGSFFKKAAHVGKHVGKAALTHYL Winter flounder Apoptosis inducing; Anti-proliferative activity MTT assay A549 Non-small cell lung adenocarcinoma IC50 : 300.8 µM
dbacp05579 Pleurocidin GWGSFFKKAAHVGKHVGKAALTHYL Winter flounder Apoptosis inducing; Anti-proliferative activity MTT assay AGS Stomach adenocarcinoma IC50 : 186.5 µM
dbacp05580 Pleurocidin-a GWGSFFKKAAHVGKHVGKAALTHYL-NH2 Winter flounder Apoptosis inducing; Anti-proliferative activity MTT assay J5 Hepatocellular carcinoma IC50 :1 1 µM
dbacp05581 Pleurocidin-a GWGSFFKKAAHVGKHVGKAALTHYL-NH3 Winter flounder Apoptosis inducing; Anti-proliferative activity MTT assay Huh7 Hepatocellular carcinoma IC50 : 60 µM
dbacp05582 Pleurocidin-a GWGSFFKKAAHVGKHVGKAALTHYL-NH4 Winter flounder Apoptosis inducing; Anti-proliferative activity MTT assay Hep3B Hepatocellular carcinoma IC50 : 77.5 µM
dbacp05583 Pleurocidin-a GWGSFFKKAAHVGKHVGKAALTHYL-NH5 Winter flounder Apoptosis inducing; Anti-proliferative activity MTT assay A549 Non-small cell lung adenocarcinoma IC50 : 42.1 µM
dbacp05584 Pleurocidin-a GWGSFFKKAAHVGKHVGKAALTHYL-NH6 Winter flounder Apoptosis inducing; Anti-proliferative activity MTT assay AGS Stomach adenocarcinoma IC50 : 29.8 µM
dbacp05585 Pleurocidin-a GWGSFFKKAAHVGKHVGKAALTHYL-NH7 Winter flounder Apoptosis inducing; Anti-proliferative activity MTT assay WiDr Colon adenocarcinoma IC50 : 197.3 µM
dbacp05586 Pleurocidin-a GWGSFFKKAAHVGKHVGKAALTHYL-NH8 Winter flounder Apoptosis inducing; Anti-proliferative activity MTT assay NIH-3T3 Mouse fibroblast IC50 : 313 µM
dbacp05863 RA-V cyclopeptideRA-V-,cyclo(YAAYAY) Plant sources Inducing apoptosis MTT assay MCF-7 Breast cancer Not found
dbacp05864 RA-V cyclopeptideRA-V-,cyclo(YAAYAY) Plant sources Inducing apoptosis MTT assay MDA-MB-231 Breast cancer Not found
dbacp05865 RA-V cyclopeptideRA-V-,cyclo(YAAYAY) Plant sources Inducing apoptosis MTT assay 4T1 Breast cancer Not found
dbacp05873 Radical SAM domain protein MEAVLYVTRKCNLSCGHCIVDKEDNSDLPTDKVETLASDYPIDRTILSGGEPFLHDNFEELVALVPEPTVLSNGLVLSDEEYVGENSDMLEELNGIQLSVEGKEETTDARRGEGVWDRVMEAHQNLSEIGVESYLRSTYSREMMEEVGELMEFCDAEGISLVLFPEIGKPPLSPTENASFFDYAVEKGVVVATPDFHSYIGEGGECPAARTRISVDVNGEIYPCQFNWDYCLGEVGDEWGLIESRIERFDRTEPVPRTCSRCDFANKCRGCGVADTWSGCPIARGLSHSESPSRRPLKRVQETMNTLEDVGAPRGCHGC Uncultured archaeon Apoptosis inducing MTT assay MCF-7 Breast cancer MIC : 42% ± 8.1 μM
dbacp05874 Radical SAM domain protein MEAVLYVTRKCNLSCGHCIVDKEDNSDLPTDKVETLASDYPIDRTILSGGEPFLHDNFEELVALVPEPTVLSNGLVLSDEEYVGENSDMLEELNGIQLSVEGKEETTDARRGEGVWDRVMEAHQNLSEIGVESYLRSTYSREMMEEVGELMEFCDAEGISLVLFPEIGKPPLSPTENASFFDYAVEKGVVVATPDFHSYIGEGGECPAARTRISVDVNGEIYPCQFNWDYCLGEVGDEWGLIESRIERFDRTEPVPRTCSRCDFANKCRGCGVADTWSGCPIARGLSHSESPSRRPLKRVQETMNTLEDVGAPRGCHGC Uncultured archaeon Apoptosis inducing MTT assay U2OS Osteosarcoma No significant effect
dbacp05971 Ribosome-inactivating protein lyophyllin (EC 3.2.2.22) ITFQGCSPARQTVITNAITRARADVRAAVSALPTKAPVSTFSTWFGVYND Hon-shimeji Cytotoxicity MTT assay Hela Not found IC50 : 358.8 μM
dbacp05972 Ribosome-inactivating protein lyophyllin (EC 3.2.2.22) ITFQGCSPARQTVITNAITRARADVRAAVSALPTKAPVSTFSTWFGVYND Hon-shimeji Cytotoxicity MTT assay HepG2 Not found IC50 : 489.8 μM
dbacp05973 Ribosome-inactivating protein lyophyllin (EC 3.2.2.22) ITFQGCSPARQTVITNAITRARADVRAAVSALPTKAPVSTFSTWFGVYND Hon-shimeji Cytotoxicity MTT assay JAR Not found IC50 : 926.9 μM
dbacp06008 S1 (Ac-KKWRKWLAKK-NH2) Ac-NAl-NAl-KKWRKWLAKK-NH2 Not found Necrosis or apoptosis MTT assay PC9 Human Lung cancer Not found
dbacp06009 S1 (Ac-KKWRKWLAKK-NH2) Ac-NAl-NAl-KKWRKWLAKK-NH2 Not found Necrosis or apoptosis MTT assay PC9-G Oral cancer Not found
dbacp06010 S1 (Ac-KKWRKWLAKK-NH2) Ac-NAl-NAl-KKWRKWLAKK-NH2 Not found Necrosis or apoptosis MTT assay A549 Human lung cancer Not found
dbacp06011 S1 (Ac-KKWRKWLAKK-NH2) Ac-NAl-NAl-KKWRKWLAKK-NH2 Not found Necrosis or apoptosis MTT assay C9 Oral cancer Not found
dbacp06012 S1 (Ac-KKWRKWLAKK-NH2) Ac-NAl-NAl-KKWRKWLAKK-NH2 Not found Necrosis or apoptosis MTT assay OECM-1 Human lung cancer Not found
dbacp06013 S1 (Ac-KKWRKWLAKK-NH2) Ac-NAl-NAl-KKWRKWLAKK-NH2 Not found Necrosis or apoptosis MTT assay SAS Oral cancer Not found
dbacp06021 SALF Ac-ECKFTVKPYLKRFQVYYKGRMWCPNH2 Giant tiger prawn Regulate apoptosis related death receptor/NF-κB signaling pathway MTT assay HeLa Human lung cancer MIC : 100 µg/ml
dbacp06027 SCH-P10 DYVP Marine invertebrates Inducing apoptosis MTT assay DU-145 Prostate cancer IC50 : 1.21 mg/mL
dbacp06028 SCH-P10 DYVP Marine invertebrates Inducing apoptosis MTT assay PC-3 Prostate cancer IC50 : 1.09 mg/mL
dbacp06029 SCH-P9 LPGP Marine invertebrates Inducing apoptosis MTT assay DU-145 Prostate cancer IC50 : 1.21 mg/mL
dbacp06030 SCH-P9 LPGP Marine invertebrates Inducing apoptosis MTT assay PC-3 Prostate cancer IC50 : 1.09 mg/mL
dbacp06035 Scolopin-2 ILKKFMLHRGTKVYKMRTLSKRSH Chinese red-headed centipede Regulate caspase-related apoptosis pathways MTT assay Hela Cervical cancer IC50 : 35 μM
dbacp06063 Shepherdin KHSSGCAFL Not found Inducing apoptosis MTT assay HeLa Cervical carcinoma IC50 : 25–75 µM
dbacp06064 Shepherdin KHSSGCAFL Not found Inducing apoptosis MTT assay PC3 Prostate adenocarcinoma IC50 : 25–75 µM
dbacp06065 Shepherdin KHSSGCAFL Not found Inducing apoptosis MTT assay p53+/+ HCT116 Colorectal carcinoma IC50 : 25–75 µM
dbacp06066 Shepherdin KHSSGCAFL Not found Inducing apoptosis MTT assay p53+/+ HCT116 Colorectal carcinoma IC50 : 25–75 µM
dbacp06067 Shepherdin (ATP) RQIKIWFQNRRMKWKKKHSSGCAFL Not found Inducing apoptosis MTT assay HeLa Cervical carcinoma IC50 : 50–75 μM
dbacp06068 Shepherdin (ATP) RQIKIWFQNRRMKWKKKHSSGCAFL Not found Inducing apoptosis MTT assay PC3 Prostate adenocarcinoma IC50 : 50–75 μM
dbacp06069 Shepherdin (ATP) RQIKIWFQNRRMKWKKKHSSGCAFL Not found Inducing apoptosis MTT assay p53+/+ HCT116 Colorectal carcinoma IC50 : 50–75 μM
dbacp06070 Shepherdin (ATP) RQIKIWFQNRRMKWKKKHSSGCAFL Not found Inducing apoptosis MTT assay p53+/+ HCT116 Colorectal carcinoma IC50 : 50–75 μM
dbacp06071 Shepherdin (TAT) YGRKKRRQRRRKHSSGCAFL Not found Inducing apoptosis MTT assay HeLa Cervical carcinoma IC50 : 50–75 μM
dbacp06072 Shepherdin (TAT) YGRKKRRQRRRKHSSGCAFL Not found Inducing apoptosis MTT assay PC3 Prostate adenocarcinoma IC50 : 50–75 μM
dbacp06073 Shepherdin (TAT) YGRKKRRQRRRKHSSGCAFL Not found Inducing apoptosis MTT assay p53+/+ HCT116 Colorectal carcinoma IC50 : 50–75 μM
dbacp06074 Shepherdin (TAT) YGRKKRRQRRRKHSSGCAFL Not found Inducing apoptosis MTT assay p53+/+ HCT116 Colorectal carcinoma IC50 : 50–75 μM
dbacp06144 Ss-arasin MERTLLIVLLVCFLLLAVTAEA The Indian mud crab Membrane disruption by pore-formation or by permeating the membrane and acting on intracellular targets MTT assay HeLa Human cervical carcinoma IC 50 : 3.06 μM
dbacp06145 Ss-arasin MERTLLIVLLVCFLLLAVTAEA The Indian mud crab Membrane disruption by pore-formation or by permeating the membrane and acting on intracellular targets MTT assay HT-29 Colon carcinoma IC 50 : 2.90 μM
dbacp06146 Ss-arasin SPRVRRRYGRPFGGRPFVGGQFGGRPGCVCIRSPCPCANYG The Indian mud crab Membrane disruption by pore-formation or by permeating the membrane and acting on intracellular targets MTT assay HT-29 Human cervical carcinoma IC 50 : 2.90 μM
dbacp06147 Ss-arasin SPRVRRRYGRPFGGRPFVGGQFGGRPGCVCIRSPCPCANYG The Indian mud crab Membrane disruption by pore-formation or by permeating the membrane and acting on intracellular targets MTT assay HeLa Colon carcinoma IC 50 : 3.06 μM
dbacp06154 StigA16 FFKLIPKLVKGLISAF Amino acid substitution, amino acid truncation, animal-derived, natural derivative Disruption of cell membrane MTT assay 3T3 Renal cell adenocarcinoma IC 50 : 13.01 μM
dbacp06155 StigA16 FFKLIPKLVKGLISAF Amino acid substitution, amino acid truncation, animal-derived, natural derivative Disruption of cell membrane MTT assay HeLa Mouse melanoma IC 50 : 13.01 μM
dbacp06156 StigA16 FFKLIPKLVKGLISAF Amino acid substitution, amino acid truncation, animal-derived, natural derivative Disruption of cell membrane MTT assay 786-0 Human cervix adenocarcinoma IC 50 : 13.01 μM
dbacp06157 StigA16 FFKLIPKLVKGLISAF Amino acid substitution, amino acid truncation, animal-derived, natural derivative Disruption of cell membrane MTT assay B16 Human pancreas adenocarcinoma IC 50 : 13.01 μM
dbacp06158 StigA16 FFKLIPKLVKGLISAF Amino acid substitution, amino acid truncation, animal-derived, natural derivative Disruption of cell membrane MTT assay Panc Mouse fibroblast IC 50 : 13.01 μM
dbacp06159 StigA6 FFSLIPKLVKGLISAFK Amino acid substitution, animal-derived, natural derivative Disruption of cell membrane MTT assay 3T3 Renal cell adenocarcinoma IC 50 : 14.01 μM
dbacp06160 StigA6 FFSLIPKLVKGLISAFK Amino acid substitution, animal-derived, natural derivative Disruption of cell membrane MTT assay HeLa Mouse melanoma IC 50 : 14.01 μM
dbacp06161 StigA6 FFSLIPKLVKGLISAFK Amino acid substitution, animal-derived, natural derivative Disruption of cell membrane MTT assay 786-0 Human cervix adenocarcinoma IC 50 : 14.01 μM
dbacp06162 StigA6 FFSLIPKLVKGLISAFK Amino acid substitution, animal-derived, natural derivative Disruption of cell membrane MTT assay B16 Human pancreas adenocarcinoma IC 50 : 14.01 μM
dbacp06163 StigA6 FFSLIPKLVKGLISAFK Amino acid substitution, animal-derived, natural derivative Disruption of cell membrane MTT assay Panc Mouse fibroblast IC 50 : 14.01 μM
dbacp06164 Stigmurin FFSLIPSLVGGLISAFK Venom gland, Yellow scorpion of the Northeast Cell membrane degradation MTT assay SiHa cells Cervical cancer IC50 : 118 μM
dbacp06165 Styelin D GW*LR**K**AAK**SVGK**FY*Y*K**HK*Y*Y*IK*AAWQIGKHAL-NH2 Asian sea squirt Disruption of cellular membranes MTT assay HCT-116 Human melanoma cancer IC50 : 10.1 mg/ml
dbacp06183 t Mastoparan-C(tMP-C, Tat (49-57)-Mastoparan-C) RKKRRQRRRLNLKALLAVAKKIL Synthetic construct Apoptosis inducing MTT assay H157 Non-small cell Lung cancer IC50 : 2.79 μM
dbacp06184 t Mastoparan-C(tMP-C, Tat (49-57)-Mastoparan-C) RKKRRQRRRLNLKALLAVAKKIL Synthetic construct Apoptosis inducing MTT assay MBD-MB-435S Melanocyte IC50 : 3.86 μM
dbacp06185 t Mastoparan-C(tMP-C, Tat (49-57)-Mastoparan-C) RKKRRQRRRLNLKALLAVAKKIL Synthetic construct Apoptosis inducing MTT assay PC-3 Human prostate carcinoma IC50 : 3.86 μM
dbacp06186 t Mastoparan-C(tMP-C, Tat (49-57)-Mastoparan-C) RKKRRQRRRLNLKALLAVAKKIL Synthetic construct Apoptosis inducing MTT assay U251-MG Human glioblastoma astrocytoma IC50 : 3.36 μM
dbacp06187 t Mastoparan-C(tMP-C, Tat (49-57)-Mastoparan-C) RKKRRQRRRLNLKALLAVAKKIL Synthetic construct Apoptosis inducing MTT assay MCF-7 Human breast cancer IC50 : 3.70 μM
dbacp06267 Temporin-PE FLPIVAKLLSGLL Skin secretions, Common water frog or green frog, Europe Destabilization of membranes MTT assay NCI-H157 Lung cancer TI : 10μM
dbacp06268 Temporin-PE FLPIVAKLLSGLL Skin secretions, Common water frog or green frog, Europe Destabilization of membranes MTT assay U251MG Lung cancer TI : 10μM
dbacp06269 Temporin-PE FLPIVAKLLSGLL Skin secretions, Common water frog or green frog, Europe Destabilization of membranes MTT assay PC-3 Lung cancer TI : 10μM
dbacp06270 Temporin-PE FLPIVAKLLSGLL Skin secretions, Common water frog or green frog, Europe Destabilization of membranes MTT assay MDA-MB-435s Lung cancer TI : 10μM
dbacp06271 Temporin-PE FLPIVAKLLSGLL Skin secretions, Common water frog or green frog, Europe Destabilization of membranes MTT assay NCI-H157 Human neuronal glioblastoma TI : 10μM
dbacp06272 Temporin-PE FLPIVAKLLSGLL Skin secretions, Common water frog or green frog, Europe Destabilization of membranes MTT assay U251MG Human neuronal glioblastoma TI : 10μM
dbacp06273 Temporin-PE FLPIVAKLLSGLL Skin secretions, Common water frog or green frog, Europe Destabilization of membranes MTT assay PC-3 Human neuronal glioblastoma TI : 10μM
dbacp06274 Temporin-PE FLPIVAKLLSGLL Skin secretions, Common water frog or green frog, Europe Destabilization of membranes MTT assay MDA-MB-435s Human neuronal glioblastoma TI : 10μM
dbacp06275 Temporin-PE FLPIVAKLLSGLL Skin secretions, Common water frog or green frog, Europe Destabilization of membranes MTT assay NCI-H157 Human neuronal glioblastoma TI : 10μM
dbacp06276 Temporin-PE FLPIVAKLLSGLL Skin secretions, Common water frog or green frog, Europe Destabilization of membranes MTT assay U251MG Human prostate carcinoma TI : 10μM
dbacp06277 Temporin-PE FLPIVAKLLSGLL Skin secretions, Common water frog or green frog, Europe Destabilization of membranes MTT assay PC-3 Human prostate carcinoma TI : 10μM
dbacp06278 Temporin-PE FLPIVAKLLSGLL Skin secretions, Common water frog or green frog, Europe Destabilization of membranes MTT assay MDA-MB-435s Human prostate carcinoma TI : 10μM
dbacp06279 Temporin-PE FLPIVAKLLSGLL Skin secretions, Common water frog or green frog, Europe Destabilization of membranes MTT assay NCI-H157 Melanoma TI : 10μM
dbacp06280 Temporin-PE FLPIVAKLLSGLL Skin secretions, Common water frog or green frog, Europe Destabilization of membranes MTT assay U251MG Melanoma TI : 10μM
dbacp06281 Temporin-PE FLPIVAKLLSGLL Skin secretions, Common water frog or green frog, Europe Destabilization of membranes MTT assay PC-3 Melanoma TI : 10μM
dbacp06282 Temporin-PE FLPIVAKLLSGLL Skin secretions, Common water frog or green frog, Europe Destabilization of membranes MTT assay MDA-MB-435s Melanoma TI : 10μM
dbacp06283 Temporin-PE FLPIVAKLLSGLL Skin secretions, Common water frog or green frog, Europe Destabilization of membranes MTT assay NCI-H157 Lung cancer TI : approx. 10μM
dbacp06284 Temporin-PE FLPIVAKLLSGLL Skin secretions, Common water frog or green frog, Europe Destabilization of membranes MTT assay U251MG Human neuronal glioblastoma TI : approx. 10μM
dbacp06285 Temporin-PE FLPIVAKLLSGLL Skin secretions, Common water frog or green frog, Europe Destabilization of membranes MTT assay PC-3 Human prostate carcinoma TI : approx. 10μM
dbacp06286 Temporin-PE FLPIVAKLLSGLL Skin secretions, Common water frog or green frog, Europe Destabilization of membranes MTT assay MDA-MB-435s Melanoma TI : approx. 10μM
dbacp06306 Tilapia piscidin 4 FIHHIIGGLFSAGKAIHRLIRRRRR Not found Inducing apoptosis MTT assay MG63 Bone cancer IC50 : 1–5 µM
dbacp06320 TP ASVVNKLTGGVAGLLK Caecum-derived strain TS Cell membrane permeabilisation MTT assay MKN-45 Gastric cancer IC 50: 4.686 μM
dbacp06321 TP ASVVNKLTGGVAGLLK Caecum-derived strain TS Cell membrane permeabilisation MTT assay NB4 Acute promyelocytic leukaemia IC 50: 11.479 μM
dbacp06322 TP3 FIHHIIGGLFSVGKHIHSLIHGH Not found Inducing apoptosis MTT assay MG63 Bone cancer 10.02 ± 1.10 μM
dbacp06381 TT 1 KIKAVLKVLTT Venom base Inducing apoptosis MTT assay TT Thyroid cancer IC50 : 18.23 ± 2.81 μg/ml
dbacp06382 TT 1 KIKAVLKVLTT Venom base Inducing apoptosis MTT assay TT Thyroid cancer IC50 : 3.87 ± 0.34 μg/ml
dbacp06383 TT 1 KIKAVLKVLTT Venom base Inducing apoptosis MTT assay TT Thyroid cancer IC50 : 2.76 ± 0.32 μg/ml
dbacp06500 Vigno 5 GLPLCGETCVGGTCNTPGCSCGWPVCVRN Viola ignobilis Apoptosis inducing MTT assay, AO/EB and DAPI staining assay HeLa cells Cervical cancer IC50 : 2.5 – 10 μM
dbacp06501 Vigno 5 GLPLCGETCVGGTCNTPGCSCGWPVCVRN Viola ignobilis Apoptosis inducing MTT assay, AO/EB and DAPI staining assay L929 Cervical cancer IC50 : 2.5 – 10 μM
dbacp06532 VS-9 VKLRSLLCS Plant sources Inducing apoptosis MTT assay MOLT4 Leukemia Not found
dbacp06533 VS-9 VKLRSLLCS Plant sources Inducing apoptosis MTT assay K562 Leukemia Not found
dbacp06543 XLAsp-P1 DEDDD Skin, African clawed frog, Africa Destruction of the cell membrane MTT assay MCF-7 cells Breast cancer LC50 : < 5 μg/mL
dbacp06598 ZXR-1 FKIGGFIKKLWRSKLA Venom base Inducing apoptosis MTT assay Hela Not found IC50 : 62.6 ± 8.4 µM
dbacp06599 ZXR-1 FKIGGFIKKLWRSKLA Venom base Inducing apoptosis MTT assay SACC-83 Not found IC50 : 27.9 ± 7.7 µM
dbacp06600 ZXR-1 FKIGGFIKKLWRSKLA Venom base Inducing apoptosis MTT assay PC-3 Not found IC50 : 69.1 ± 1.6 µM
dbacp06601 ZXR-1 FKIGGFIKKLWRSKLA Venom base Inducing apoptosis MTT assay HuH-7 Not found IC50 : 77.9 ± 0.9 µM
dbacp06602 ZXR-1 FKIGGFIKKLWRSKLA Venom base Inducing apoptosis MTT assay HepG2 Not found IC50 : 141.7 ± 12.2 µM
dbacp06603 ZXR-1 FKIGGFIKKLWRSKLA Venom base Inducing apoptosis MTT assay 293T Not found IC50 : 186.7 ± 13.1 µM
dbacp06604 ZXR-1 FKIGGFIKKLWRSKLA Venom base Inducing apoptosis MTT assay WPMY-1 Not found IC50 : 283.3 ± 19.0 µM
dbacp06615 LA3IK LAIAVK Migration and invasion enhancer 1 (MIEN1) Targeting the MIEN1 signaling pathway MTT assay MDA-MB-231 Breast Cancer IC50 = 223.6 ± 5.62 µM
dbacp06616 LA3IK LAIAVK Migration and invasion enhancer 1 (MIEN1) Targeting the MIEN1 signaling pathway MTT assay MCF-7 Breast Cancer IC50 = 90.23 ± 7.32 µM
dbacp06617 LA3IK LAIAVK Migration and invasion enhancer 1 (MIEN1) Targeting the MIEN1 signaling pathway MTT assay PC-3 Prostate Cancer IC50 = 321.4 ± 11.79 µM
dbacp06618 LA3IK LAIAVK Migration and invasion enhancer 1 (MIEN1) Targeting the MIEN1 signaling pathway MTT assay DU-145 Prostate Cancer IC50 = 335.7 ± 3.09 µM
dbacp06619 D-LA3IK laiavk Migration and invasion enhancer 1 (MIEN1) Targeting the MIEN1 signaling pathway MTT assay MDA-MB-231 Breast Cancer IC50 = 197.72 ± 5.42 µM
dbacp06620 D-LA3IK laiavk Migration and invasion enhancer 1 (MIEN1) Targeting the MIEN1 signaling pathway MTT assay MCF-7 Breast Cancer IC50 = 91.2 ± 8.21 µM
dbacp06621 D-LA3IK laiavk Migration and invasion enhancer 1 (MIEN1) Targeting the MIEN1 signaling pathway MTT assay PC-3 Prostate Cancer IC50 = 98.71 ± 6.17 µM
dbacp06622 D-LA3IK laiavk Migration and invasion enhancer 1 (MIEN1) Targeting the MIEN1 signaling pathway MTT assay DU-145 Prostate Cancer IC50 = 89.11 ± 8.12 µM
dbacp06623 LA3IK-SCR LAKAVI Migration and invasion enhancer 1 (MIEN1) Targeting the MIEN1 signaling pathway MTT assay MDA-MB-231 Breast Cancer IC50 = 243 ± 8.16 µM
dbacp06624 LA3IK-SCR LAKAVI Migration and invasion enhancer 1 (MIEN1) Targeting the MIEN1 signaling pathway MTT assay MCF-7 Breast Cancer IC50 = 133 ± 9.52 µM
dbacp06625 LA3IK-SCR LAKAVI Migration and invasion enhancer 1 (MIEN1) Targeting the MIEN1 signaling pathway MTT assay PC-3 Prostate Cancer IC50 = 319 ± 13.64 µM
dbacp06626 LA3IK-SCR LAKAVI Migration and invasion enhancer 1 (MIEN1) Targeting the MIEN1 signaling pathway MTT assay DU-145 Prostate Cancer IC50 = 351.76 ± 7.18 µM
dbacp06627 RP-7 RPPCVIL Migration and invasion enhancer 1 (MIEN1) Targeting the MIEN1 signaling pathway MTT assay MDA-MB-231 Breast Cancer IC50 = 139.03 ± 8.41 µM
dbacp06628 RP-7 RPPCVIL Migration and invasion enhancer 1 (MIEN1) Targeting the MIEN1 signaling pathway MTT assay MCF-7 Breast Cancer IC50 = 110.12 ± 4.23 µM
dbacp06629 RP-7 RPPCVIL Migration and invasion enhancer 1 (MIEN1) Targeting the MIEN1 signaling pathway MTT assay PC-3 Prostate Cancer IC50 = 113 ± 8.02 µM
dbacp06630 RP-7 RPPCVIL Migration and invasion enhancer 1 (MIEN1) Targeting the MIEN1 signaling pathway MTT assay DU-145 Prostate Cancer IC50 = 120.72 ± 7.08 µM
dbacp06631 D-RP-7 rppcvil Migration and invasion enhancer 1 (MIEN1) Targeting the MIEN1 signaling pathway MTT assay MDA-MB-231 Breast Cancer IC50 = 95 ± 7.71 µM
dbacp06632 D-RP-7 rppcvil Migration and invasion enhancer 1 (MIEN1) Targeting the MIEN1 signaling pathway MTT assay MCF-7 Breast Cancer IC50 = 90 ± 10.31 µM
dbacp06633 D-RP-7 rppcvil Migration and invasion enhancer 1 (MIEN1) Targeting the MIEN1 signaling pathway MTT assay PC-3 Prostate Cancer IC50 = 101 ± 5.73 µM
dbacp06634 D-RP-7 rppcvil Migration and invasion enhancer 1 (MIEN1) Targeting the MIEN1 signaling pathway MTT assay DU-145 Prostate Cancer IC50 = 121.59 ± 6.56 µM
dbacp06635 RP7 SCR RPPLVIC Migration and invasion enhancer 1 (MIEN1) Targeting the MIEN1 signaling pathway MTT assay MDA-MB-231 Breast Cancer IC50 = 156 ± 8.15 µM
dbacp06636 RP7 SCR RPPLVIC Migration and invasion enhancer 1 (MIEN1) Targeting the MIEN1 signaling pathway MTT assay MCF-7 Breast Cancer IC50 = 150 ± 10.32 µM
dbacp06637 RP7 SCR RPPLVIC Migration and invasion enhancer 1 (MIEN1) Targeting the MIEN1 signaling pathway MTT assay PC-3 Prostate Cancer IC50 = 128 ± 11.65 µM
dbacp06638 RP7 SCR RPPLVIC Migration and invasion enhancer 1 (MIEN1) Targeting the MIEN1 signaling pathway MTT assay DU-145 Prostate Cancer IC50 = 137 ± 5.98 µM
dbacp06639 C-Mel CGIGAVLKVLTTGLPALISWIKRKRQQ Synthetic analogue Plasma memberane pore formation MTT assay HeLa Cervical Cancer IC50 = 64.15 µg/mL
dbacp06640 C-Mel CGIGAVLKVLTTGLPALISWIKRKRQQ Synthetic analogue Plasma memberane pore formation MTT assay C-33A Cervical Cancer IC50 = 44.76 µg/mL
dbacp06641 C-Mel CGIGAVLKVLTTGLPALISWIKRKRQQ Synthetic analogue Plasma memberane pore formation MTT assay MCF-7 Breast Cancer IC50 = 110.59 µg/mL
dbacp06642 CM–FA CGIGAVLKVLTTGLPALISWIKRKRQQ Synthetic analogue Plasma memberane pore formation MTT assay HeLa Cervical Cancer IC50 = 67.34 µg/mL
dbacp06643 CM–FA CGIGAVLKVLTTGLPALISWIKRKRQQ Synthetic analogue Plasma memberane pore formation MTT assay C-33A Cervical Cancer IC50 = 35.75 µg/mL
dbacp06644 CM–FA CGIGAVLKVLTTGLPALISWIKRKRQQ Synthetic analogue Plasma memberane pore formation MTT assay MCF-7 Breast Cancer IC50 = 10.38 µg/mL
dbacp06645 Mel-C GIGAVLKVLTTGLPALISWIKRKRQQC Synthetic analogue Plasma memberane pore formation MTT assay HeLa Cervical Cancer IC50 = 50.72 µg/mL
dbacp06646 Mel-C GIGAVLKVLTTGLPALISWIKRKRQQC Synthetic analogue Plasma memberane pore formation MTT assay C-33A Cervical Cancer IC50 = 58.63 µg/mL
dbacp06647 Mel-C GIGAVLKVLTTGLPALISWIKRKRQQC Synthetic analogue Plasma memberane pore formation MTT assay MCF-7 Breast Cancer IC50 = 160.62 µg/mL
dbacp06648 MC–FA GIGAVLKVLTTGLPALISWIKRKRQQC Synthetic analogue Plasma memberane pore formation MTT assay HeLa Cervical Cancer IC50 = 66.43 µg/mL
dbacp06649 MC–FA GIGAVLKVLTTGLPALISWIKRKRQQC Synthetic analogue Plasma memberane pore formation MTT assay C-33A Cervical Cancer IC50 = 35.22 µg/ mL
dbacp06650 MC–FA GIGAVLKVLTTGLPALISWIKRKRQQC Synthetic analogue Plasma memberane pore formation MTT assay MCF-7 Breast Cancer IC50 = 12.63 µg/mL
dbacp06656 LfcinB (21-25)Pal RWQWRWQWR LfcinB Apoptosis inducing MTT assay CaCo-2 Colorectal Cancer IC50 = 86 μM
dbacp06657 LfcinB (21-25)Pal RWQWRWQWR LfcinB Apoptosis inducing MTT assay HT-29 Colon Cancer IC50 = 100 μM
dbacp06658 LfcinB (21-25)Pal RWQWRWQWR LfcinB Apoptosis inducing MTT assay DU-145 Prostrate Cancer IC50 = 40 μM
dbacp06659 Ahx-[Pal] Ahx-RWQWRWQWR Synthetic Apoptosis inducing MTT assay HT-29 Colon Cancer IC50 = 119 μM
dbacp06660 Ahx-[Pal] Ahx-RWQWRWQWR Synthetic Apoptosis inducing MTT assay CaCo-2 Colorectal Cancer IC50 = 40 μM
dbacp06661 9[Orn] [Pal] RWQWRWQWO Synthetic Apoptosis inducing MTT assay HT-29 Colon Cancer IC50 = 109 μM
dbacp06662 9[Orn] [Pal] RWQWRWQWO Synthetic Apoptosis inducing MTT assay CaCo-2 Colorectal Cancer IC50 = 40 μM
dbacp06663 9[Orn] [Pal] RWQWRWQWO Synthetic Apoptosis inducing MTT assay DU-145 Prostrate Cancer IC50 = 62 μM
dbacp06664 CH3CO-Ahx-[Pal] CH3-CO-Ahx-RWQWRWQWR Synthetic Apoptosis inducing MTT assay CaCo-2 Colorectal Cancer IC50 = 31 μM
dbacp06665 1[dR][Pal] rWQWRWQWR Synthetic Apoptosis inducing MTT assay CaCo-2 Colorectal Cancer IC50 = 105 μM
dbacp06666 1[Orn] [Pal] OWQWRWQWR Synthetic Apoptosis inducing MTT assay CaCo-2 Colorectal Cancer IC50 = 91 μM
dbacp06667 5[Orn] [Pal] RWQWOWQWR Synthetic Apoptosis inducing MTT assay CaCo-2 Colorectal Cancer IC50 = 64 μM
dbacp06668 1[dR] 5[Orn] [Pal] rWQWOWQWR Synthetic Apoptosis inducing MTT assay CaCo-2 Colorectal Cancer IC50 = 109 μM
dbacp06669 Crabrolin FLPLILRKIVTAL European hornet (Vespa crabro) Not available MTT assay H-838 Lung Cancer IC50 = 27.71 μM
dbacp06670 Crabrolin FLPLILRKIVTAL European hornet (Vespa crabro) Not available MTT assay PC-3 Prostate Cancer IC50 = 32.13 μM
dbacp06671 Crabrolin FLPLILRKIVTAL European hornet (Vespa crabro) Not available MTT assay U-251-MG Brain Tumor IC50 = 20.13 μM
dbacp06672 Crabrolin FLPLILRKIVTAL European hornet (Vespa crabro) Not available MTT assay HCT-116 Colon Cancer IC50 = 8.539 μM
dbacp06673 Crabrolin FLPLILRKIVTAL European hornet (Vespa crabro) Not available MTT assay MCF-7 Breast Cancer IC50 = 26.49 μM
dbacp06674 Crabrolin-4R FLPRILRKIVTAL Synthetic Analog of Crabrolin Not available MTT assay H-838 Lung Cancer IC50 = 11.40 μM
dbacp06675 Crabrolin-4R FLPRILRKIVTAL Synthetic Analog of Crabrolin Not available MTT assay PC-3 Prostate Cancer IC50 = 17.98 μM
dbacp06676 Crabrolin-4R FLPRILRKIVTAL Synthetic Analog of Crabrolin Not available MTT assay U-251-MG Brain Tumor IC50 = 25.09 μM
dbacp06677 Crabrolin-4R FLPRILRKIVTAL Synthetic Analog of Crabrolin Not available MTT assay HCT-116 Colon Cancer IC50 = 47.02 μM
dbacp06678 Crabrolin-4R FLPRILRKIVTAL Synthetic Analog of Crabrolin Not available MTT assay MCF-7 Breast Cancer IC50 = 20.26 μM
dbacp06679 Crabrolin-4K FLPKILRKIVTAL Synthetic Analog of Crabrolin Not available MTT assay H-838 Lung Cancer IC50 = 22.55 μM
dbacp06680 Crabrolin-4K FLPKILRKIVTAL Synthetic Analog of Crabrolin Not available MTT assay PC-3 Prostate Cancer IC50 = 20.58 μM
dbacp06681 Crabrolin-4K FLPKILRKIVTAL Synthetic Analog of Crabrolin Not available MTT assay U-251-MG Brain Tumor IC50 = 23.51 μM
dbacp06682 Crabrolin-4K FLPKILRKIVTAL Synthetic Analog of Crabrolin Not available MTT assay HCT-116 Colon Cancer IC50 = 42.88 μM
dbacp06683 Crabrolin-4K FLPKILRKIVTAL Synthetic Analog of Crabrolin Not available MTT assay MCF-7 Breast Cancer IC50 = 23.18 μM
dbacp06684 Crabrolin-TR FLPRILRKIVRAL Synthetic Analog of Crabrolin Not available MTT assay H-838 Lung Cancer IC50 = 4.637 μM
dbacp06685 Crabrolin-TR FLPRILRKIVRAL Synthetic Analog of Crabrolin Not available MTT assay PC-3 Prostate Cancer IC50 = 3.944 μM
dbacp06686 Crabrolin-TR FLPRILRKIVRAL Synthetic Analog of Crabrolin Not available MTT assay U-251-MG Brain Tumor IC50 = 12.40 μM
dbacp06687 Crabrolin-TR FLPRILRKIVRAL Synthetic Analog of Crabrolin Not available MTT assay HCT-116 Colon Cancer IC50 = 2.810 μM
dbacp06688 Crabrolin-TR FLPRILRKIVRAL Synthetic Analog of Crabrolin Not available MTT assay MCF-7 Breast Cancer IC50 = 3.459 μM
dbacp06689 Crabrolin-FR RLPRILRKIVRAL Synthetic Analog of Crabrolin Not available MTT assay H-838 Lung Cancer IC50 = 31.51 μM
dbacp06690 Crabrolin-FR RLPRILRKIVRAL Synthetic Analog of Crabrolin Not available MTT assay PC-3 Prostate Cancer IC50 = 15.87 μM
dbacp06691 Crabrolin-FR RLPRILRKIVRAL Synthetic Analog of Crabrolin Not available MTT assay U-251-MG Brain Tumor IC50 = 62.17 μM
dbacp06692 Crabrolin-FR RLPRILRKIVRAL Synthetic Analog of Crabrolin Not available MTT assay HCT-116 Colon Cancer IC50 = 30.29 μM
dbacp06693 Crabrolin-FR RLPRILRKIVRAL Synthetic Analog of Crabrolin Not available MTT assay MCF-7 Breast Cancer IC50 = 33.85 μM
dbacp06694 Crabrolin-AR RLPRILRKIVRRL Synthetic Analog of Crabrolin Not available MTT assay H-838 Lung Cancer IC50 = 41.31 μM
dbacp06695 Crabrolin-AR RLPRILRKIVRRL Synthetic Analog of Crabrolin Not available MTT assay PC-3 Prostate Cancer IC50 = 28.78 μM
dbacp06696 Crabrolin-AR RLPRILRKIVRRL Synthetic Analog of Crabrolin Not available MTT assay U-251-MG Brain Tumor IC50 = 52.01 μM
dbacp06697 Crabrolin-AR RLPRILRKIVRRL Synthetic Analog of Crabrolin Not available MTT assay HCT-116 Colon Cancer IC50 = 29.90 μM
dbacp06698 Crabrolin-AR RLPRILRKIVRRL Synthetic Analog of Crabrolin Not available MTT assay MCF-7 Breast Cancer IC50 = 32.51 μM
dbacp06699 Crabrolin-PR RLRRILRKIVRRL Synthetic Analog of Crabrolin Not available MTT assay H-838 Lung Cancer IC50 = 32.32 μM
dbacp06700 Crabrolin-PR RLRRILRKIVRRL Synthetic Analog of Crabrolin Not available MTT assay PC-3 Prostate Cancer IC50 = 22.37 μM
dbacp06701 Crabrolin-PR RLRRILRKIVRRL Synthetic Analog of Crabrolin Not available MTT assay U-251-MG Brain Tumor IC50 = 17.70 μM
dbacp06702 Crabrolin-PR RLRRILRKIVRRL Synthetic Analog of Crabrolin Not available MTT assay HCT-116 Colon Cancer IC50 = 16.29 μM
dbacp06703 Crabrolin-PR RLRRILRKIVRRL Synthetic Analog of Crabrolin Not available MTT assay MCF-7 Breast Cancer IC50 = 12.29 μM
dbacp06704 P05 ADDGRPFPQVIK Aldolase A fragment Apoptosis inducing MTT assay MG-63 Bone Cancer Relative viability = 0.85 at 50 μg/ml
dbacp06705 P05 ADDGRPFPQVIK Aldolase A fragment Apoptosis inducing MTT assay U-2 OS Bone Cancer Relative viability = 0.98 at 50 μg/ml
dbacp06706 P02 AEEYEFLTPMEEAPK Rho GDP Dissociation Inhibitor Alpha fragment Apoptosis inducing MTT assay MG-63 Bone Cancer Relative viability = 0.88 at 50 μg/ml
dbacp06707 P02 AEEYEFLTPMEEAPK Rho GDP Dissociation Inhibitor Alpha fragment Apoptosis inducing MTT assay U-2 OS Bone Cancer Relative viability = 0.93 at 50 μg/ml
dbacp06708 P01 SETAPAAPAAPAPAEK Histone H1.4 (H1-4) Fragment Apoptosis inducing MTT assay MG-63 Bone Cancer Relative viability = 0.84 at 50 μg/ml
dbacp06709 P01 SETAPAAPAAPAPAEK Histone H1.4 (H1-4) Fragment Apoptosis inducing MTT assay U-2 OS Bone Cancer Relative viability = 1.13 at 50 μg/ml
dbacp06710 P03 HVFGESDELIGQK Triosephosphate Isomerase (TPI) fragment Apoptosis inducing MTT assay MG-63 Bone Cancer Relative viability = 1.04 at 50 μg/ml
dbacp06711 P03 HVFGESDELIGQK Triosephosphate Isomerase (TPI) fragment Apoptosis inducing MTT assay U-2 OS Bone Cancer Relative viability = 0.98 at 50 μg/ml
dbacp06712 P06 GAGTGGLGLAVEGPSEAK FLNA (Filamin A) fragment Apoptosis inducing MTT assay MG-63 Bone Cancer Relative viability = 0.92 at 50 μg/ml
dbacp06713 P06 GAGTGGLGLAVEGPSEAK FLNA (Filamin A) fragment Apoptosis inducing MTT assay U-2 OS Bone Cancer Relative viability = 1.17 at 50 μg/ml
dbacp06714 P07 VEPGLGADNSVVR FLNA (Filamin A) fragment Apoptosis inducing MTT assay MG-63 Bone Cancer Relative viability = 0.96 at 50 μg/ml
dbacp06715 P07 VEPGLGADNSVVR FLNA (Filamin A) fragment Apoptosis inducing MTT assay U-2 OS Bone Cancer Relative viability = 0.96 at 50 μg/ml
dbacp06716 P08 NSNLVGAAHEELQQSR Lamin A/C (LMNA) fragment Apoptosis inducing MTT assay MG-63 Bone Cancer Relative viability = 0.92 at 50 μg/ml
dbacp06717 P08 NSNLVGAAHEELQQSR Lamin A/C (LMNA) fragment Apoptosis inducing MTT assay U-2 OS Bone Cancer Relative viability = 1.06 at 50 μg/ml
dbacp06718 P09 AAGTLYTYPENWR Eukaryotic Translation Elongation Factor 1 Gamma (Eef1G) fragment Apoptosis inducing MTT assay MG-63 Bone Cancer Relative viability = 0.85 at 50 μg/ml
dbacp06719 P09 AAGTLYTYPENWR Eukaryotic Translation Elongation Factor 1 Gamma (Eef1G) fragment Apoptosis inducing MTT assay U-2 OS Bone Cancer Relative viability = 1.07 at 50 μg/ml
dbacp06720 P10 FAAATGATPIAGR 40S ribosomal protein fragment Apoptosis inducing MTT assay MG-63 Bone Cancer Relative viability = 1.08 at 50 μg/ml
dbacp06721 P10 FAAATGATPIAGR 40S ribosomal protein fragment Apoptosis inducing MTT assay U-2 OS Bone Cancer Relative viability = 1.01 at 50 μg/ml
dbacp06722 GE18 GAGIVVASIDTGVRVSHE Aphanomyces invadans Not available MTT assay MCF-7 Breast Cancer IC50 = 35.34 µM
dbacp06723 L14 ALWKSILKNAGKALNEINQIVQ Dermaseptin-SS1- Analog Membrane Permeabilization MTT assay H-838 Lung Cancer IC50 = 64.4 µM
dbacp06724 L14 ALWKSILKNAGKALNEINQIVQ Dermaseptin-SS1- Analog Membrane Permeabilization MTT assay H-460 Lung Cancer IC50 = 20.1 µM
dbacp06725 14V ALWKSILKNAGKAVLNEINQIVQ Dermaseptin-SS1- Analog Membrane Permeabilization MTT assay H-838 Lung Cancer IC50 = 7.0 µM
dbacp06726 14V ALWKSILKNAGKAVLNEINQIVQ Dermaseptin-SS1- Analog Membrane Permeabilization MTT assay H-460 Lung Cancer IC50 = 4.1 µM
dbacp06727 14G ALWKSILKNAGKAGLNEINQIVQ Dermaseptin-SS1- Analog Membrane Permeabilization MTT assay H-838 Lung Cancer IC50 = 48.7 µM
dbacp06728 14G ALWKSILKNAGKAGLNEINQIVQ Dermaseptin-SS1- Analog Membrane Permeabilization MTT assay H-460 Lung Cancer IC50 = 31.7 µM
dbacp06729 L2V ALWKSILKNVGKVLNEINQIVQ Dermaseptin-SS1- Analog Membrane Permeabilization MTT assay H-838 Lung Cancer IC50 = 2.2 µM
dbacp06730 L2V ALWKSILKNVGKVLNEINQIVQ Dermaseptin-SS1- Analog Membrane Permeabilization MTT assay H-460 Lung Cancer IC50 = 0.6 µM
dbacp06731 14V5K ALWKKILKNAGKAVLNEINQIVQ Dermaseptin-SS1- Analog Membrane Permeabilization MTT assay H-838 Lung Cancer IC50 = 8.1 µM
dbacp06732 14V5K ALWKKILKNAGKAVLNEINQIVQ Dermaseptin-SS1- Analog Membrane Permeabilization MTT assay H-460 Lung Cancer IC50 = 6.1 µM
dbacp06733 14VL23 ALWKSILKNAGKAVLNEINQIV Dermaseptin-SS1- Analog Membrane Permeabilization MTT assay H-838 Lung Cancer IC50 = 5.7 µM
dbacp06734 14VL23 ALWKSILKNAGKAVLNEINQIV Dermaseptin-SS1- Analog Membrane Permeabilization MTT assay H-460 Lung Cancer IC50 = 16.4 µM
dbacp06737 Aurein 1.2_mutant (Aurm) GLFDIIKKIIKSF Synthetic Necrotic activity via cell membrane lysis and apoptotic activity through disrupting mitochondrial membrane MTT assay SW-480 Colon Cancer 51.63% cell viability
dbacp06738 Aurein 1.2_mutant (Aurm) GLFDIIKKIIKSF Synthetic Necrotic activity via cell membrane lysis and apoptotic activity through disrupting mitochondrial membrane MTT assay HT-29 Colon Cancer 66.10% cell viability
dbacp06739 Aurein 1.2_R5 (R5-Aur) RRRRRGLFDIIKKIAESF Synthetic Necrotic activity via cell membrane lysis and apoptotic activity through disrupting mitochondrial membrane MTT assay SW-480 Colon Cancer 43.89% cell viability
dbacp06740 Aurein 1.2_R5 (R5-Aur) RRRRRGLFDIIKKIAESF Synthetic Necrotic activity via cell membrane lysis and apoptotic activity through disrupting mitochondrial membrane MTT assay HT-29 Colon Cancer 61.56% cell viability
dbacp06741 Aurein 1.2_mutant_R5 (R5-Aurm) RRRRRGLFDIIKKIIKSF Synthetic Necrotic activity via cell membrane lysis and apoptotic activity through disrupting mitochondrial membrane MTT assay SW-480 Colon Cancer 40.62% cell viability
dbacp06742 Aurein 1.2_mutant_R5 (R5-Aurm) RRRRRGLFDIIKKIIKSF Synthetic Necrotic activity via cell membrane lysis and apoptotic activity through disrupting mitochondrial membrane MTT assay HT-29 Colon Cancer 54.22% cell viability
dbacp06749 mPNC-NLS QETFSDLWKLLVQRKRQKLMP Synthetic p53-mediated apoptosis MTT assay A-549 Lung Cancer IC50 = 44.9 μM
dbacp06750 mPNC-NLS QETFSDLWKLLVQRKRQKLMP Synthetic p53-mediated apoptosis MTT assay U-87 Brain Tumor IC50 = 56.9 μM
dbacp06752 Salamandrin - I FAVWGCADYRGY Salamandra salamandra Pyroptosis mediated MTT assay HL-60 Leukemia Cancer IC50 = 27 µM
dbacp06754 37-mer peptide TKEQKEQIAKATGLTTKQVRNWYVQLNASIKVCMCSC Synthetic Apoptosis inducing MTT assay SNU-449 Liver Cancer IC50 = 76.4 ± 0.6015 μM
dbacp06755 37-mer peptide TKEQKEQIAKATGLTTKQVRNWYVQLNASIKVCMCSC Synthetic Apoptosis inducing MTT assay HepG-2 Liver Cancer IC50 = 33.65 ± 1.09 μM
dbacp06756 37-mer peptide TKEQKEQIAKATGLTTKQVRNWYVQLNASIKVCMCSC Synthetic Apoptosis inducing MTT assay SK-OV-3 Ovarian cancer IC50 = 27.45 ± 1.5085 μM
dbacp06757 ATMP5 THPPTTTTTTTTTTTYTAAPATTT Synthetic Analog of ATMP1 Apoptosis inducing MTT assay MDA-MB-231 Breast Cancer IC50 = 64.04 ± 0.021 μg /ml
dbacp06758 ATMP1 THPPTTTTTTTTTTTYTAAPATTT Anabas testudineus Apoptosis inducing MTT assay MDA-MB-231 Breast Cancer IC50 = 8.25 ± 0.14 μg/ml
dbacp06759 p28 LSTAADMQGVVTDGMASGLDKDYLKPDD Pseudomonas aeruginosa Apoptosis inducing MTT assay HT-29 Colon Cancer IC50 ~ 200 μg/ml
dbacp06760 p28 LSTAADMQGVVTDGMASGLDKDYLKPDD Pseudomonas aeruginosa Apoptosis inducing MTT assay CT-26 Colorectal Cancer IC50 ~ 150 μg/ml
dbacp06761 RP7 ATRQPNH RAGE(receptor for advanced glycation end product) inhibitor Apoptosis inducing MTT assay MDA-MB-231 Breast Cancer IC50 = 24.5 µM
dbacp06762 RP7 ATRQPNH RAGE(receptor for advanced glycation end product) inhibitor Apoptosis inducing MTT assay BT-549 Breast Cancer IC50 = 29.9 µM
dbacp06771 Moricin AKIPIKAAIKTVGKAVGKGLRAINIASTANDVFNFLKPKKRKA Bombyx mori Peptide-induced cell death MTT assay MDA-MB-231 Triple-negative Breast Cancer 70% cell viability at 6.25 µg/ml
dbacp06774 PMAP-NC RIIDRLWLVRRPQKPKFVLVWVL Synthetic Analgog of PMAP-23 Membrane permeabilization MTT assay MDA-MB-361 Breast Cancer IC50 = 6.4 μM
dbacp06775 PMAP-NC RIIDRLWLVRRPQKPKFVLVWVL Synthetic Analgog of PMAP-24 Membrane permeabilization MTT assay A-549 Lung Cancer IC50 = 7.1 μM
dbacp06776 MP1-Q12K IDWKKLLDAAKLIL Analog of Polybia MP1 Not available MTT assay A-549 Lung Cancer IC50 = 12.5 μM
dbacp06793 CPSA-CPSC-L-ACAN Not Available Recombinant Fusion Peptide Apoptosis inducing MTT assay HeLa Cervical Cancer IC50 = 63.15 μg/ml
dbacp06794 CM11 WKLFKKILKVL Cecropin-Melittin Hybrid Peptide Apoptosis inducing MTT assay Jurkat Blood Cancer Survival rate = 47% at 32 μg/ml
dbacp06795 CM11 WKLFKKILKVL Cecropin-Melittin Hybrid Peptide Apoptosis inducing MTT assay Raji Blood Cancer Survival rate = 51% at 32 μg/ml
dbacp06796 LHRH-BinBC QHWSYGLRPGGRGPKDAVRAVKGSALLPCIIVHDPNLNNSDKMKFNTYYLLEYKEYWHQLWSQIIPAHQTVKIQERTGISEVVQNSMIEDLNMYIGADFGMYFYLRSSGFKEQITRGLNRPLSQTTTQLGERVEEMEYYNSNDLDVRYVKYALAREFTLKRVNGEIVKNWVAVDYRMAGIQSYPNAPITNPLTLT Synthetic Apoptosis inducing MTT assay MCF-7 Breast Cancer IC50 = 10.96 μM
dbacp06798 Test peptide YSFGL Neuropep Peptide Not available MTT assay A-549 Lung Cancer IC50 = 26.417±0.660 µM
dbacp06799 Test peptide YSFGL Neuropep Peptide Not available MTT assay MDA-MB-231 Lung Cancer IC50 = 39.047±0.770 µM
dbacp06859 ALA-A2 KLWCKSSQVPQSR Alpha-Lactalbumin Not available MTT assay A-549 Lung Cancer ~50% cell viability
dbacp06860 ALA-A2 KLWCKSSQVPQSR Alpha-Lactalbumin Not available MTT assay HT-29 Colon Cancer ~50% cell viability
dbacp06861 LK-LE1 CLKKLLKLLKKLLKLCLHELLEHLHELLEH Synthetic Membrane disruption MTT assay HeLa Cervical Cancer IC50 = 11.3 µM at pH 6
dbacp06862 LK-LE2 CLKKLLKLLKKLLKLCLEHLLEHLEHLLEH Synthetic Membrane disruption MTT assay HeLa Cervical Cancer IC50 = 12.9 µM at pH 6
dbacp06863 LK-LE3 CLKKLLKLLKKLLKLCLEELLHHLEELLHH Synthetic Membrane disruption MTT assay HeLa Cervical Cancer IC50 = 10.2 µM at pH 6
dbacp06864 AMP-WF3 FLKSLWRGVKAIFNGARQGYKEHKN Poecilia Mexicana fish Apoptosis inducing MTT assay Jurkat Blood Cancer IC50 = 50 µM
dbacp06868 LfcinB(21-25)Pal RWQWRWQWR LfcinB Apoptosis inducing MTT assay MDA-MB-468 Breast Cancer IC50 = 72 µM
dbacp06869 LfcinB(21-25)Pal RWQWRWQWR LfcinB Apoptosis inducing MTT assay MDA-MB-231 Breast Cancer IC50 = 103 µM
dbacp06870 LfcinB(21-25)Pal RWQWRWQWR LfcinB Apoptosis inducing MTT assay MCF-7 Breast Cancer IC50 = 81 µM
dbacp06871 RR-1-RR RRWQWRWQWRR Synthetic analogue of LfcinB(21-25)Pal Apoptosis inducing MTT assay MCF-7 Breast Cancer IC50 = 58 µM
dbacp06872 RR-1-RR RRWQWRWQWRR Synthetic analogue of LfcinB(21-25)Pal Apoptosis inducing MTT assay MDA-MB-231 Breast Cancer IC50 = 67 µM
dbacp06873 R-1-RR RWQWRWQWRR Synthetic analogue of LfcinB(21-25)Pal Apoptosis inducing MTT assay MCF-7 Breast Cancer IC50 = 122 µM
dbacp06874 R-1-RR RWQWRWQWRR Synthetic analogue of LfcinB(21-25)Pal Apoptosis inducing MTT assay MDA-MB-231 Breast Cancer IC50 = 95 µM
dbacp06875 RR-1-R RRWQWRWQWR Synthetic analogue of LfcinB(21-25)Pal Apoptosis inducing MTT assay MCF-7 Breast Cancer IC50 = 68 µM
dbacp06876 RR-1-R RRWQWRWQWR Synthetic analogue of LfcinB(21-25)Pal Apoptosis inducing MTT assay MDA-MB-231 Breast Cancer IC50 = 73 µM
dbacp06877 1 WQWRWQW Synthetic analogue of LfcinB(21-25)Pal Apoptosis inducing MTT assay MCF-7 Breast Cancer IC50 = 105 µM
dbacp06878 1 WQWRWQW Synthetic analogue of LfcinB(21-25)Pal Apoptosis inducing MTT assay MDA-MB-231 Breast Cancer IC50 > 170 µM
dbacp06879 R-1 RWQWRWQW Synthetic analogue of LfcinB(21-25)Pal Apoptosis inducing MTT assay MCF-7 Breast Cancer IC50 = 58 µM
dbacp06880 R-1 RWQWRWQW Synthetic analogue of LfcinB(21-25)Pal Apoptosis inducing MTT assay MDA-MB-231 Breast Cancer IC50 > 150 µM
dbacp06881 1-R WQWRWQWR Synthetic analogue of LfcinB(21-25)Pal Apoptosis inducing MTT assay MCF-7 Breast Cancer IC50 = 130 µM
dbacp06882 1-R WQWRWQWR Synthetic analogue of LfcinB(21-25)Pal Apoptosis inducing MTT assay MDA-MB-231 Breast Cancer IC50 > 150 µM
dbacp06904 LFcin17–30 FKCRRWQWRMKKLG Lectoferrin Peptide Apoptosis inducing MTT assay HepG-2 Liver Cancer cell viability ~ 50% at 1 µM
dbacp06905 LFcin17–30 FKCRRWQWRMKKLG Lectoferrin Peptide Apoptosis inducing MTT assay Jurkat Blood Cancer cell viability ~ 70% at 20 µM
dbacp06906 LFampin265–284 DLIWKLLSKAQEKFGKNKSR Lectoferrin Peptide Apoptosis inducing MTT assay HepG-2 Liver Cancer cell viability ~ 50% at 1 µM
dbacp06907 LFampin265–284 DLIWKLLSKAQEKFGKNKSR Lectoferrin Peptide Apoptosis inducing MTT assay Jurkat Blood Cancer cell viability ~ 47% at 10 µM
dbacp06908 LFchimera FKCRRWQWRMKKLG-K-RSKNKGFKEQAKSLLKWILD Synthetic - Lectoferrin chimera Apoptosis inducing MTT assay HepG-2 Liver Cancer cell viability ~ 44% at 10 µM
dbacp06909 LFchimera FKCRRWQWRMKKLG-K-RSKNKGFKEQAKSLLKWILD Synthetic - Lectoferrin chimera Apoptosis inducing MTT assay Jurkat Blood Cancer cell viability ~ 8% at 20 µM
dbacp06919 Q7 EQQQQQQPQNRRFRE Pisum sativum Inhibition of cell signalling MTT assay HEC-1-A Endometrial Cancer IC50 = 129.82 ± 7.53 μM
dbacp06920 HAZ GVKFAKRFWRFAKKAFKRFEK Synthetic Cell membrane destabilization MTT assay A-549 Lung Cancer IC50 = 5.44 μM
dbacp06941 PS14 PTECQVGTTCKVES Aphanomyces invadans Apoptosis inducing MTT assay Hep-2 Larynx Cancer IC50 = 21 µM
dbacp06945 LJP-6 FKEHGY Laminaria japonica Inhibition of cell signalling MTT assay HepG-2 Liver Cancer IC50 = 3.06 ± 0.31 mM
dbacp06946 LJP-1 EGFHL Laminaria japonica Inhibition of cell signalling MTT assay Huh-7 Liver Cancer IC50 = 0.48 ± 0.05 mM
dbacp06947 LJP-1 EGFHL Laminaria japonica Inhibition of cell signalling MTT assay HepG-2 Liver Cancer IC50 = 0.45 ± 0.05 mM
dbacp06948 LJP-1 EGFHL Laminaria japonica Inhibition of cell signalling MTT assay H-22 Liver Cancer IC50 = 0.36 ± 0.03 mM
dbacp06949 LJP-8 FSHTYV Laminaria japonica Inhibition of cell signalling MTT assay Huh-7 Liver Cancer IC50 = 0.44 ± 0.04 mM
dbacp06950 LJP-8 FSHTYV Laminaria japonica Inhibition of cell signalling MTT assay HepG-2 Liver Cancer IC50 = 0.63 ± 0.05 mM
dbacp06951 LJP-8 FSHTYV Laminaria japonica Inhibition of cell signalling MTT assay H-22 Liver Cancer IC50 = 0.76 ± 0.08 mM
dbacp06952 LJP-2 LWEHSH Laminaria japonica Inhibition of cell signalling MTT assay Huh-7 Liver Cancer IC50 = 2.25 ± 0.22 mM
dbacp06953 LJP-2 LWEHSH Laminaria japonica Inhibition of cell signalling MTT assay HepG-2 Liver Cancer IC50 = 1.71 ± 0.13 mM
dbacp06954 LJP-2 LWEHSH Laminaria japonica Inhibition of cell signalling MTT assay H-22 Liver Cancer IC50 = 0.62 ± 0.05 mM
dbacp06955 LJP-3 FSHRGH Laminaria japonica Inhibition of cell signalling MTT assay Huh-7 Liver Cancer IC50 = 1.42 ± 0.12 mM
dbacp06956 LJP-3 FSHRGH Laminaria japonica Inhibition of cell signalling MTT assay H-22 Liver Cancer IC50 = 1.70 ± 0.15 mM
dbacp06957 LJP-5 FSTHGG Laminaria japonica Inhibition of cell signalling MTT assay Huh-7 Liver Cancer IC50 = 2.44 ± 0.22 mM
dbacp06958 LJP-5 FSTHGG Laminaria japonica Inhibition of cell signalling MTT assay HepG-2 Liver Cancer IC50 = 2.78 ± 0.26 mM
dbacp06959 LJP-5 FSTHGG Laminaria japonica Inhibition of cell signalling MTT assay H-22 Liver Cancer IC50 = 1.49 ± 0.13 mM
dbacp06960 LJP-7 HAGYSWA Laminaria japonica Inhibition of cell signalling MTT assay Huh-7 Liver Cancer IC50 = 2.53 ± 0.24 mM
dbacp06961 LJP-7 HAGYSWA Laminaria japonica Inhibition of cell signalling MTT assay HepG-2 Liver Cancer IC50 = 1.66 ± 0.11 mM
dbacp06962 LJP-7 HAGYSWA Laminaria japonica Inhibition of cell signalling MTT assay H-22 Liver Cancer IC50 = 1.44 ± 0.12 mM
dbacp06963 LJP-9 FEHSG Laminaria japonica Inhibition of cell signalling MTT assay Huh-7 Liver Cancer IC50 = 0.53 ± 0.05 mM
dbacp06964 LJP-9 FEHSG Laminaria japonica Inhibition of cell signalling MTT assay HepG-2 Liver Cancer IC50 = 0.69 ± 0.08 mM
dbacp06965 LJP-9 FEHSG Laminaria japonica Inhibition of cell signalling MTT assay H-22 Liver Cancer IC50 = 0.51 ± 0.07 mM
dbacp06966 LJP-10 HASWEH Laminaria japonica Inhibition of cell signalling MTT assay Huh-7 Liver Cancer IC50 = 3.52 ± 0.35 mM
dbacp06967 LJP-10 HASWEH Laminaria japonica Inhibition of cell signalling MTT assay HepG-2 Liver Cancer IC50 = 2.69 ± 0.22 mM
dbacp06968 LJP-10 HASWEH Laminaria japonica Inhibition of cell signalling MTT assay H-22 Liver Cancer IC50 = 3.53 ± 0.34 mM
dbacp06969 LJP-11 YEHSHG Laminaria japonica Inhibition of cell signalling MTT assay Huh-7 Liver Cancer IC50 = 0.49 ± 0.05 mM
dbacp06970 LJP-11 YEHSHG Laminaria japonica Inhibition of cell signalling MTT assay HepG-2 Liver Cancer IC50 = 0.61 ± 0.07 mM
dbacp06971 LJP-11 YEHSHG Laminaria japonica Inhibition of cell signalling MTT assay H-22 Liver Cancer IC50 = 0.70 ± 0.07 mM
dbacp06972 LJP-12 TFKHG Laminaria japonica Inhibition of cell signalling MTT assay Huh-7 Liver Cancer IC50 = 0.41 ± 0.04 mM
dbacp06973 LJP-12 TFKHG Laminaria japonica Inhibition of cell signalling MTT assay HepG-2 Liver Cancer IC50 = 0.60 ± 0.08 mM
dbacp06974 LJP-12 TFKHG Laminaria japonica Inhibition of cell signalling MTT assay H-22 Liver Cancer IC50 = 0.72 ± 0.05 mM
dbacp06980 Ponericin-W1 (11-25), At1 KLLPSVVGLFKKKKQ Synthetic Apoptosis inducing MTT assay A-549 Lung Cancer IC50 > 100 µM
dbacp06981 Ponericin-W1 (11-25), At1 KLLPSVVGLFKKKKQ Synthetic Apoptosis inducing MTT assay HepG-2 Liver Cancer IC50 >100 µM
dbacp06982 Ponericin-W1 (11-25) [P4K KLLKKVVKLFKKKKK Synthetic Apoptosis inducing MTT assay A-549 Lung Cancer IC50 >100 µM
dbacp06983 Ponericin-W1 (11-25) [P4K KLLKKVVKLFKKKKK Synthetic Apoptosis inducing MTT assay HepG-2 Liver Cancer IC50 >100 µM
dbacp06984 Ponericin-W1 (11-25) [P4K KLLKKVVKLFKKLLK Synthetic Apoptosis inducing MTT assay A-549 Lung Cancer IC50 = 4.3 µM
dbacp06985 Ponericin-W1 (11-25) [P4K KLLKKVVKLFKKLLK Synthetic Apoptosis inducing MTT assay HepG-2 Liver Cancer IC50 = 2.2 µM
dbacp06986 At4 KLLKKLLKLLKKLLK Synthetic Apoptosis inducing MTT assay A-549 Lung Cancer IC50 = 7.2 µM
dbacp06987 At4 KLLKKLLKLLKKLLK Synthetic Apoptosis inducing MTT assay HepG-2 Liver Cancer IC50 = 2.5 µM
dbacp06988 At5 KIIKKIIKIIKKIIK Synthetic Apoptosis inducing MTT assay A-549 Lung Cancer IC50 = 3.6 µM
dbacp06989 At5 KIIKKIIKIIKKIIK Synthetic Apoptosis inducing MTT assay HepG-2 Liver Cancer IC50 = 1.5 µM
dbacp06990 At6 KVVKKVVKVVKKVVK Synthetic Apoptosis inducing MTT assay A-549 Lung Cancer IC50 > 100 µM
dbacp06991 At6 KVVKKVVKVVKKVVK Synthetic Apoptosis inducing MTT assay HepG-2 Liver Cancer IC50 = 70.8 µM
dbacp06992 At7 KIIKKIKKKIKKIIK Synthetic Apoptosis inducing MTT assay A-549 Lung Cancer IC50 = 10.3 µM
dbacp06993 At7 KIIKKIKKKIKKIIK Synthetic Apoptosis inducing MTT assay HepG-2 Liver Cancer IC50 = 8.8 µM
dbacp06994 At8 KLLKKLKKKLKKLLK Synthetic Apoptosis inducing MTT assay A-549 Lung Cancer IC50 = 13.4 µM
dbacp06995 At8 KLLKKLKKKLKKLLK Synthetic Apoptosis inducing MTT assay HepG-2 Liver Cancer IC50 = 8.9 µM
dbacp06996 At9 KVVKKVKKKVKKVVK Synthetic Apoptosis inducing MTT assay A-549 Lung Cancer IC50 = 100 µM
dbacp06997 At9 KVVKKVKKKVKKVVK Synthetic Apoptosis inducing MTT assay HepG-2 Liver Cancer IC50 = 51.7 µM
dbacp06998 At10 IKKIIKIIKKIIKKI Synthetic Apoptosis inducing MTT assay A-549 Lung Cancer IC50 = 4.4 µM
dbacp06999 At10 IKKIIKIIKKIIKKI Synthetic Apoptosis inducing MTT assay HepG-2 Liver Cancer IC50 = 3.2 µM
dbacp07000 At11 IIIKKIKKKIKKIII Synthetic Apoptosis inducing MTT assay A-549 Lung Cancer IC50 = 7.9 µM
dbacp07001 At11 IIIKKIKKKIKKIII Synthetic Apoptosis inducing MTT assay HepG-2 Liver Cancer IC50 = 7.6 µM
dbacp07002 At12 KIIIKIKKKIKIIIK Synthetic Apoptosis inducing MTT assay A-549 Lung Cancer IC50 = 14.0 µM
dbacp07003 At12 KIIIKIKKKIKIIIK Synthetic Apoptosis inducing MTT assay HepG-2 Liver Cancer IC50 = 13.4 µM
dbacp07004 Rapeseed peptide NDGNQPL extracted from rapeseed protein Inhibition of cell signalling MTT assay HepG-2 Liver Cancer IC50 = 1.56 mmol/L
dbacp07017 D-LAK-120-A kklalalakkwlalakklalalakk Synthetic ROS induction, mitochondria-mediated apoptosis. MTT assay A-549 Lung Cancer IC50 = 5.55 ± 0.13 μM
dbacp07018 D-LAK-120-A kklalalakkwlalakklalalakk Synthetic ROS induction, mitochondria-mediated apoptosis. MTT assay H-358 Non Small Cell Lung Cancer (NSCLC) IC50 = 4.00 ± 0.20 μM
dbacp07019 D-LAK-120-A kklalalakkwlalakklalalakk Synthetic ROS induction, mitochondria-mediated apoptosis. MTT assay H-1975 Non Small Cell Lung Cancer (NSCLC) IC50 between 4.0 and 5.5 μM
dbacp07020 D-LAK-120-A kklalalakkwlalakklalalakk Synthetic ROS induction, mitochondria-mediated apoptosis. MTT assay HCC-827 Lung Adenocarcinoma IC50 between 4.0 and 5.5 μM
dbacp07021 BmPLA2 FKWQFEMLIMKIAKTSGFMFYSSY phospholipase A2 isoform from B. moojeni venom Membrane disruption, selective cancer cytotoxicity MTT assay CaCo-2 Colorectal Cancer IC50 = 0.6 µM
dbacp07022 BmPLA2 FKWQFEMLIMKIAKTSGFMFYSSY phospholipase A2 isoform from B. moojeni venom Membrane disruption, selective cancer cytotoxicity MTT assay RD Rhabdomyosarcoma 60% reduction in cell viability
dbacp07050 Temporin-PKE FLPLIIGALSSLLPKIF skin secretion of Pelophylax kl. esculentus Charge-optimized membranolysis induces apoptosis. MTT assay U251-MG Brain Tumor IC50 = 23.24 μM
dbacp07051 Temporin-PKE FLPLIIGALSSLLPKIF skin secretion of Pelophylax kl. esculentus Charge-optimized membranolysis induces apoptosis. MTT assay PC-3 Prostate Cancer IC50 = 7.29 μM
dbacp07052 Temporin-PKE FLPLIIGALSSLLPKIF skin secretion of Pelophylax kl. esculentus Charge-optimized membranolysis induces apoptosis. MTT assay H-838 Lung Cancer IC50 = 16.38 μM
dbacp07053 Temporin-PKE FLPLIIGALSSLLPKIF skin secretion of Pelophylax kl. esculentus Charge-optimized membranolysis induces apoptosis. MTT assay HCT-116 Colorectal Cancer IC50 = 21.31 μM
dbacp07054 Temporin-PKE FLPLIIGALSSLLPKIF skin secretion of Pelophylax kl. esculentus Charge-optimized membranolysis induces apoptosis. MTT assay H-157 Lung Cancer IC50 = 17.40 μM
dbacp07055 Temporin-PKE-2K FLPLIIGKLSSLLPKIF Synthetic Charge-optimized membranolysis induces apoptosis. MTT assay U251-MG Brain Tumor IC50 = 2.49 μM
dbacp07056 Temporin-PKE-2K FLPLIIGKLSSLLPKIF Synthetic Charge-optimized membranolysis induces apoptosis. MTT assay PC-3 Prostate Cancer IC50 = 2.64 μM
dbacp07057 Temporin-PKE-2K FLPLIIGKLSSLLPKIF Synthetic Charge-optimized membranolysis induces apoptosis. MTT assay H-838 Lung Cancer IC50 = 3.07 μM
dbacp07058 Temporin-PKE-2K FLPLIIGKLSSLLPKIF Synthetic Charge-optimized membranolysis induces apoptosis. MTT assay HCT-116 Colorectal Cancer IC50 = 2.84 μM
dbacp07059 Temporin-PKE-2K FLPLIIGKLSSLLPKIF Synthetic Charge-optimized membranolysis induces apoptosis. MTT assay H-157 Lung Cancer IC50 = 2.78 μM
dbacp07060 Temporin-PKE-K12 FLPLIIGALSSKLPKIF Synthetic Charge-optimized membranolysis induces apoptosis. MTT assay U251-MG Brain Tumor IC50 = 25.75 μM
dbacp07061 Temporin-PKE-K12 FLPLIIGALSSKLPKIF Synthetic Charge-optimized membranolysis induces apoptosis. MTT assay PC-3 Prostate Cancer IC50 = 27.32 μM
dbacp07062 Temporin-PKE-K12 FLPLIIGALSSKLPKIF Synthetic Charge-optimized membranolysis induces apoptosis. MTT assay H-838 Lung Cancer IC50 = 22.67 μM
dbacp07063 Temporin-PKE-K12 FLPLIIGALSSKLPKIF Synthetic Charge-optimized membranolysis induces apoptosis. MTT assay HCT-116 Colorectal Cancer IC50 = 22.09 μM
dbacp07064 Temporin-PKE-K12 FLPLIIGALSSKLPKIF Synthetic Charge-optimized membranolysis induces apoptosis. MTT assay H-157 Lung Cancer IC50 = 24.03 μM
dbacp07065 Temporin-PKE-3K FLPKIIGKLSSLLPKIF Synthetic Charge-optimized membranolysis induces apoptosis. MTT assay U251-MG Brain Tumor IC50 = 2.83 μM
dbacp07066 Temporin-PKE-3K FLPKIIGKLSSLLPKIF Synthetic Charge-optimized membranolysis induces apoptosis. MTT assay PC-3 Prostate Cancer IC50 = 3.01 μM
dbacp07067 Temporin-PKE-3K FLPKIIGKLSSLLPKIF Synthetic Charge-optimized membranolysis induces apoptosis. MTT assay H-838 Lung Cancer IC50 = 0.51 μM
dbacp07068 Temporin-PKE-3K FLPKIIGKLSSLLPKIF Synthetic Charge-optimized membranolysis induces apoptosis. MTT assay HCT-116 Colorectal Cancer IC50 = 0.38 μM
dbacp07069 Temporin-PKE-3K FLPKIIGKLSSLLPKIF Synthetic Charge-optimized membranolysis induces apoptosis. MTT assay H-157 Lung Cancer IC50 = 3.29 μM
dbacp07070 Temporin-PKE-4K FLPKIIGKLSSKLPKIF Synthetic Charge-optimized membranolysis induces apoptosis. MTT assay U251-MG Brain Tumor IC50 = 85.52 μM
dbacp07071 Temporin-PKE-4K FLPKIIGKLSSKLPKIF Synthetic Charge-optimized membranolysis induces apoptosis. MTT assay PC-3 Prostate Cancer IC50 = 49.50 μM
dbacp07072 Temporin-PKE-4K FLPKIIGKLSSKLPKIF Synthetic Charge-optimized membranolysis induces apoptosis. MTT assay H-838 Lung Cancer IC50 = 35.28 μM
dbacp07073 Temporin-PKE-4K FLPKIIGKLSSKLPKIF Synthetic Charge-optimized membranolysis induces apoptosis. MTT assay HCT-116 Colorectal Cancer IC50 = 99.36 μM
dbacp07074 Temporin-PKE-4K FLPKIIGKLSSKLPKIF Synthetic Charge-optimized membranolysis induces apoptosis. MTT assay H-157 Lung Cancer IC50 = 27.76 μM
dbacp07075 Temporin-PKE-i FLPLIIGALSSLLPKiF Synthetic Charge-optimized membranolysis induces apoptosis. MTT assay U251-MG Brain Tumor IC50 = 4.46 μM
dbacp07076 Temporin-PKE-i FLPLIIGALSSLLPKiF Synthetic Charge-optimized membranolysis induces apoptosis. MTT assay PC-3 Prostate Cancer IC50 = 3.35 μM
dbacp07077 Temporin-PKE-i FLPLIIGALSSLLPKiF Synthetic Charge-optimized membranolysis induces apoptosis. MTT assay H-838 Lung Cancer IC50 = 5.28 μM
dbacp07078 Temporin-PKE-i FLPLIIGALSSLLPKiF Synthetic Charge-optimized membranolysis induces apoptosis. MTT assay HCT-116 Colorectal Cancer IC50 = 3.07 μM
dbacp07079 Temporin-PKE-i FLPLIIGALSSLLPKiF Synthetic Charge-optimized membranolysis induces apoptosis. MTT assay H-157 Lung Cancer IC50 = 2.94 μM
dbacp07080 Temporin-PKE-3i FLPLiiGALSSLLPKiF Synthetic Charge-optimized membranolysis induces apoptosis. MTT assay U251-MG Brain Tumor IC50 = 120.6 μM
dbacp07081 Temporin-PKE-3i FLPLiiGALSSLLPKiF Synthetic Charge-optimized membranolysis induces apoptosis. MTT assay PC-3 Prostate Cancer IC50 = 167 μM
dbacp07082 Temporin-PKE-3i FLPLiiGALSSLLPKiF Synthetic Charge-optimized membranolysis induces apoptosis. MTT assay H-838 Lung Cancer IC50 = 193.4 μM
dbacp07083 Temporin-PKE-3i FLPLiiGALSSLLPKiF Synthetic Charge-optimized membranolysis induces apoptosis. MTT assay HCT-116 Colorectal Cancer IC50 = 72.06 μM
dbacp07084 Temporin-PKE-3i FLPLiiGALSSLLPKiF Synthetic Charge-optimized membranolysis induces apoptosis. MTT assay H-157 Lung Cancer IC50 = 71.18 μM
dbacp07107 Nigrocin-M1 GLLGKILGAGKKVLLGVSGLL Synthetic Membrane disruption mediates selective cytotoxicity. MTT assay H-157 Non-small cell lung cancer IC50 = 24 μM
dbacp07108 Nigrocin-M1 GLLGKILGAGKKVLLGVSGLL Synthetic Membrane disruption mediates selective cytotoxicity. MTT assay PC-3 Prostate cancer IC50 = 31.27 μM
dbacp07109 Nigrocin-M1 GLLGKILGAGKKVLLGVSGLL Synthetic Membrane disruption mediates selective cytotoxicity. MTT assay U-251-MG Brain Tumor IC50 = 25.06 μM
dbacp07110 Nigrocin-M1 GLLGKILGAGKKVLLGVSGLL Synthetic Membrane disruption mediates selective cytotoxicity. MTT assay MCF-7 Breast Cancer IC50 = 24.60 μM
dbacp07111 LyeTx-I-b IWLTALKFLGKNLGKLAKQQLAKL Synthetic Synergistic autophagic death via AKT inhibition. MTT assay MDA-MB-231 Breast Cancer IC50 = 2.47 µM
dbacp07112 Galaxamide (N-Me-L)L(N-Me-L)LL Galaxaura filamentosa Cell-cycle arrest induces apoptosis MTT assay HepG-2 Liver Cancer IC50 = 5.20 ± 0.52 µg/ml
dbacp07113 Galaxamide (N-Me-L)L(N-Me-L)LL Galaxaura filamentosa Cell-cycle arrest induces apoptosis MTT assay MCF-7 Breast Cancer IC50 = 11.33 ± 2.95 µg/ml
dbacp07114 Galaxamide (N-Me-L)L(N-Me-L)LL Galaxaura filamentosa Cell-cycle arrest induces apoptosis MTT assay HeLa Cervical Cancer IC50 = 8.53 ± 0.73 µg/ml
dbacp07115 Galaxamide (N-Me-L)L(N-Me-L)LL Galaxaura filamentosa Cell-cycle arrest induces apoptosis MTT assay MDA-MB-231 Breast Cancer IC50 = 8.73 ± 0.29 µg/ml
dbacp07116 Galaxamide (N-Me-L)L(N-Me-L)LL Galaxaura filamentosa Cell-cycle arrest induces apoptosis MTT assay A-549 Lung Cancer IC50 = 6.99 ± 0.63 µg/ml
dbacp07117 Z-1 L(N-Me-L)LPL Synthetic Cell-cycle arrest induces apoptosis MTT assay MCF-7 Breast Cancer IC50 = 5.85 ± 1.28 µg/ml
dbacp07118 Z-1 L(N-Me-L)LPL Synthetic Cell-cycle arrest induces apoptosis MTT assay HepG-2 Liver Cancer IC50 = 7.57 ± 0.17 µg/ml
dbacp07119 Z-1 L(N-Me-L)LPL Synthetic Cell-cycle arrest induces apoptosis MTT assay MDA-MB-231 Breast Cancer IC50 = 17.81 ± 0.6 µg/ml
dbacp07120 Z-1 L(N-Me-L)LPL Synthetic Cell-cycle arrest induces apoptosis MTT assay HeLa Cervical Cancer IC50 = 11.56 ± 0.65 µg/ml
dbacp07121 Z-1 L(N-Me-L)LPL Synthetic Cell-cycle arrest induces apoptosis MTT assay A-549 Lung Cancer IC50 = 4.92 ± 0.84 µg/ml
dbacp07122 DEE GLLDLLELLLEAAGW Synthetic Selective membrane perforation prevents resistance. MTT assay HMLER Breast Cancer IC50 = 5.55 ± 0.35 µM
dbacp07123 DEE GLLDLLELLLEAAGW Synthetic Selective membrane perforation prevents resistance. MTT assay HMLER-shEcad Breast Cancer IC50 = 6.05 ± 2.76 µM
dbacp07124 DEE GLLDLLELLLEAAGW Synthetic Selective membrane perforation prevents resistance. MTT assay U-2 OS Bone Cancer IC50 = 61.00 ± 1.41 µM
dbacp07125 EEE GLLELLELLLEAAGW Synthetic Selective membrane perforation prevents resistance. MTT assay HMLER Breast Cancer IC50 = 6.25 ± 1.77 µM
dbacp07126 EEE GLLELLELLLEAAGW Synthetic Selective membrane perforation prevents resistance. MTT assay HMLER-shEcad Breast Cancer IC50 = 10.55 ± 3.46 µM
dbacp07127 EEE GLLELLELLLEAAGW Synthetic Selective membrane perforation prevents resistance. MTT assay U-2 OS Bone Cancer IC50 = 78.75 ± 5.30 µM
dbacp07128 HEE GLLHLLELLLEAAGW Synthetic Selective membrane perforation prevents resistance. MTT assay HMLER Breast Cancer IC50 = 6.50 ± 0.71 µM
dbacp07129 HEE GLLHLLELLLEAAGW Synthetic Selective membrane perforation prevents resistance. MTT assay HMLER-shEcad Breast Cancer IC50 = 4.95 ± 0.49 µM
dbacp07130 HEE GLLHLLELLLEAAGW Synthetic Selective membrane perforation prevents resistance. MTT assay U-2 OS Bone Cancer IC50 = 47.50 ± 11 µM
dbacp07131 KEE GLLKLLELLLEAAGW Synthetic Selective membrane perforation prevents resistance. MTT assay HMLER Breast Cancer IC50 = 3.75 ± 0.78 µM
dbacp07132 KEE GLLKLLELLLEAAGW Synthetic Selective membrane perforation prevents resistance. MTT assay HMLER-shEcad Breast Cancer IC50 = 2.05 ± 0.21 µM
dbacp07133 KEE GLLKLLELLLEAAGW Synthetic Selective membrane perforation prevents resistance. MTT assay U-2 OS Bone Cancer IC50 = 49.38 ± 13.26 µM
dbacp07134 DHE GLLDLLHLLLEAAGW Synthetic Selective membrane perforation prevents resistance. MTT assay HMLER Breast Cancer IC50 = 3.75 ± 0.92 µM
dbacp07135 DHE GLLDLLHLLLEAAGW Synthetic Selective membrane perforation prevents resistance. MTT assay HMLER-shEcad Breast Cancer IC50 = 2.80 ± 0.14 µM
dbacp07136 DHE GLLDLLHLLLEAAGW Synthetic Selective membrane perforation prevents resistance. MTT assay U-2 OS Bone Cancer IC50 = 17.25 ± 1.06 µM
dbacp07137 EHE GLLELLHLLLEAAGW Synthetic Selective membrane perforation prevents resistance. MTT assay HMLER Breast Cancer IC50 = 3.90 ± 0.28 µM
dbacp07138 EHE GLLELLHLLLEAAGW Synthetic Selective membrane perforation prevents resistance. MTT assay HMLER-shEcad Breast Cancer IC50 = 2.55 ± 0.07 µM
dbacp07139 EHE GLLELLHLLLEAAGW Synthetic Selective membrane perforation prevents resistance. MTT assay U-2 OS Bone Cancer IC50 = 18.25 ± 1.06 µM
dbacp07140 HHE GLLHLLHLLLEAAGW Synthetic Selective membrane perforation prevents resistance. MTT assay HMLER Breast Cancer IC50 = 16.70 ± 2.26 µM
dbacp07141 HHE GLLHLLHLLLEAAGW Synthetic Selective membrane perforation prevents resistance. MTT assay HMLER-shEcad Breast Cancer IC50 = 10.75 ± 0.78 µM
dbacp07142 HHE GLLHLLHLLLEAAGW Synthetic Selective membrane perforation prevents resistance. MTT assay U-2 OS Bone Cancer IC50 = 53.25 ± 5.30 µM
dbacp07143 KHE GLLKLLHLLLEAAGW Synthetic Selective membrane perforation prevents resistance. MTT assay HMLER Breast Cancer IC50 = 3.70 ± 0.14 µM
dbacp07144 KHE GLLKLLHLLLEAAGW Synthetic Selective membrane perforation prevents resistance. MTT assay HMLER-shEcad Breast Cancer IC50 = 2.92 ± 0.17 µM
dbacp07145 KHE GLLKLLHLLLEAAGW Synthetic Selective membrane perforation prevents resistance. MTT assay U-2 OS Bone Cancer IC50 = 53 ± 2.83 µM
dbacp07146 DKE GLLDLLKLLLEAAGW Synthetic Selective membrane perforation prevents resistance. MTT assay HMLER Breast Cancer IC50 = 2.10 ± 0 µM
dbacp07147 DKE GLLDLLKLLLEAAGW Synthetic Selective membrane perforation prevents resistance. MTT assay HMLER-shEcad Breast Cancer IC50 = 1.57 ± 0.33 µM
dbacp07148 DKE GLLDLLKLLLEAAGW Synthetic Selective membrane perforation prevents resistance. MTT assay U-2 OS Bone Cancer IC50 = 9.93 ± 0.25 µM
dbacp07149 EKE GLLELLKLLLEAAGW Synthetic Selective membrane perforation prevents resistance. MTT assay HMLER Breast Cancer IC50 = 1.80 ± 0.28 µM
dbacp07150 EKE GLLELLKLLLEAAGW Synthetic Selective membrane perforation prevents resistance. MTT assay HMLER-shEcad Breast Cancer IC50 = 1.30 ± 0.14 µM
dbacp07151 EKE GLLELLKLLLEAAGW Synthetic Selective membrane perforation prevents resistance. MTT assay U-2 OS Bone Cancer IC50 = 8.00 ± 0.71 µM
dbacp07152 HKE GLLHLLKLLLEAAGW Synthetic Selective membrane perforation prevents resistance. MTT assay HMLER Breast Cancer IC50 = 2.70 ± 0.28 µM
dbacp07153 HKE GLLHLLKLLLEAAGW Synthetic Selective membrane perforation prevents resistance. MTT assay HMLER-shEcad Breast Cancer IC50 = 1.90 ± 0.42 µM
dbacp07154 HKE GLLHLLKLLLEAAGW Synthetic Selective membrane perforation prevents resistance. MTT assay U-2 OS Bone Cancer IC50 = 15.95 ± 0.78 µM
dbacp07155 KKE GLLKLLKLLLEAAGW Synthetic Selective membrane perforation prevents resistance. MTT assay HMLER Breast Cancer IC50 = 2.05 ± 0.64 µM
dbacp07156 KKE GLLKLLKLLLEAAGW Synthetic Selective membrane perforation prevents resistance. MTT assay HMLER-shEcad Breast Cancer IC50 = 1.70 ± 0 µM
dbacp07157 KKE GLLKLLKLLLEAAGW Synthetic Selective membrane perforation prevents resistance. MTT assay U-2 OS Bone Cancer IC50 = 12.75 ± 1.20 µM
dbacp07158 DEH GLLDLLELLLHAAGW Synthetic Selective membrane perforation prevents resistance. MTT assay HMLER Breast Cancer IC50 = 5.35 ± 1.91 µM
dbacp07159 DEH GLLDLLELLLHAAGW Synthetic Selective membrane perforation prevents resistance. MTT assay HMLER-shEcad Breast Cancer IC50 = 3.60 ± 0.42 µM
dbacp07160 DEH GLLDLLELLLHAAGW Synthetic Selective membrane perforation prevents resistance. MTT assay U-2 OS Bone Cancer IC50 = 36.48 ± 3.92 µM
dbacp07161 EEH GLLELLELLLHAAGW Synthetic Selective membrane perforation prevents resistance. MTT assay HMLER Breast Cancer IC50 = 3.30 ± 0.14 µM
dbacp07162 EEH GLLELLELLLHAAGW Synthetic Selective membrane perforation prevents resistance. MTT assay HMLER-shEcad Breast Cancer IC50 = 3.60 ± 0.85 µM
dbacp07163 EEH GLLELLELLLHAAGW Synthetic Selective membrane perforation prevents resistance. MTT assay U-2 OS Bone Cancer IC50 = 19.60 ± 3.96 µM
dbacp07164 HEH GLLHLLELLLHAAGW Synthetic Selective membrane perforation prevents resistance. MTT assay HMLER Breast Cancer IC50 = 28.60 ± 10.75 µM
dbacp07165 HEH GLLHLLELLLHAAGW Synthetic Selective membrane perforation prevents resistance. MTT assay HMLER-shEcad Breast Cancer IC50 = 10.95 ± 1.06 µM
dbacp07166 HEH GLLHLLELLLHAAGW Synthetic Selective membrane perforation prevents resistance. MTT assay U-2 OS Bone Cancer IC50 = 106 ± 14 µM
dbacp07167 KEH GLLKLLELLLHAAGW Synthetic Selective membrane perforation prevents resistance. MTT assay HMLER Breast Cancer IC50 = 3.30 ± 0.42 µM
dbacp07168 KEH GLLKLLELLLHAAGW Synthetic Selective membrane perforation prevents resistance. MTT assay HMLER-shEcad Breast Cancer IC50 = 2.35 ± 0.07 µM
dbacp07169 KEH GLLKLLELLLHAAGW Synthetic Selective membrane perforation prevents resistance. MTT assay U-2 OS Bone Cancer IC50 = 49.25 ± 5.30 µM
dbacp07170 DHH GLLDLLHLLLHAAGW Synthetic Selective membrane perforation prevents resistance. MTT assay HMLER Breast Cancer IC50 = 21.45 ± 2.47 µM
dbacp07171 DHH GLLDLLHLLLHAAGW Synthetic Selective membrane perforation prevents resistance. MTT assay HMLER-shEcad Breast Cancer IC50 = 11.90 ± 0.14 µM
dbacp07172 DHH GLLDLLHLLLHAAGW Synthetic Selective membrane perforation prevents resistance. MTT assay U-2 OS Bone Cancer IC50 = 55.85 ± 18.88 µM
dbacp07173 EHH GLLELLHLLLHAAGW Synthetic Selective membrane perforation prevents resistance. MTT assay HMLER Breast Cancer IC50 = 25.35 ± 2.76 µM
dbacp07174 EHH GLLELLHLLLHAAGW Synthetic Selective membrane perforation prevents resistance. MTT assay HMLER-shEcad Breast Cancer IC50 = 16.05 ± 3.18 µM
dbacp07175 EHH GLLELLHLLLHAAGW Synthetic Selective membrane perforation prevents resistance. MTT assay U-2 OS Bone Cancer IC50 = 117 ± 7 µM
dbacp07176 HHH GLLHLLHLLLHAAGW Synthetic Selective membrane perforation prevents resistance. MTT assay HMLER Breast Cancer IC50 = 21.10 ± 6.93 µM
dbacp07177 HHH GLLHLLHLLLHAAGW Synthetic Selective membrane perforation prevents resistance. MTT assay HMLER-shEcad Breast Cancer IC50 = 9.50 ± 0.99 µM
dbacp07178 HHH GLLHLLHLLLHAAGW Synthetic Selective membrane perforation prevents resistance. MTT assay U-2 OS Bone Cancer IC50 = 185 ± 7 µM
dbacp07179 KHH GLLKLLHLLLHAAGW Synthetic Selective membrane perforation prevents resistance. MTT assay HMLER Breast Cancer IC50 = 5.20 ± 0.71 µM
dbacp07180 KHH GLLKLLHLLLHAAGW Synthetic Selective membrane perforation prevents resistance. MTT assay HMLER-shEcad Breast Cancer IC50 = 4.45 ± 0.49 µM
dbacp07181 KHH GLLKLLHLLLHAAGW Synthetic Selective membrane perforation prevents resistance. MTT assay U-2 OS Bone Cancer IC50 = 39.75 ± 5.30 µM
dbacp07182 DKH GLLDLLKLLLHAAGW Synthetic Selective membrane perforation prevents resistance. MTT assay HMLER Breast Cancer IC50 = 3.45 ± 0.07 µM
dbacp07183 DKH GLLDLLKLLLHAAGW Synthetic Selective membrane perforation prevents resistance. MTT assay HMLER-shEcad Breast Cancer IC50 = 2.80 ± 0.28 µM
dbacp07184 DKH GLLDLLKLLLHAAGW Synthetic Selective membrane perforation prevents resistance. MTT assay U-2 OS Bone Cancer IC50 = 21.13 ± 3.01 µM
dbacp07185 EKH GLLELLKLLLHAAGW Synthetic Selective membrane perforation prevents resistance. MTT assay HMLER Breast Cancer IC50 = 2.75 ± 0.07 µM
dbacp07186 EKH GLLELLKLLLHAAGW Synthetic Selective membrane perforation prevents resistance. MTT assay HMLER-shEcad Breast Cancer IC50 = 2.18 ± 0.31 µM
dbacp07187 EKH GLLELLKLLLHAAGW Synthetic Selective membrane perforation prevents resistance. MTT assay U-2 OS Bone Cancer IC50 = 23.83 ± 0.81 µM
dbacp07188 HKH GLLHLLKLLLHAAGW Synthetic Selective membrane perforation prevents resistance. MTT assay HMLER Breast Cancer IC50 = 3.45 ± 0.21 µM
dbacp07189 HKH GLLHLLKLLLHAAGW Synthetic Selective membrane perforation prevents resistance. MTT assay HMLER-shEcad Breast Cancer IC50 = 3.10 ± 0.57 µM
dbacp07190 HKH GLLHLLKLLLHAAGW Synthetic Selective membrane perforation prevents resistance. MTT assay U-2 OS Bone Cancer IC50 = 18.88 ± 1.24 µM
dbacp07191 KKH GLLKLLKLLLHAAGW Synthetic Selective membrane perforation prevents resistance. MTT assay HMLER Breast Cancer IC50 = 2.40 ± 0.85 µM
dbacp07192 KKH GLLKLLKLLLHAAGW Synthetic Selective membrane perforation prevents resistance. MTT assay HMLER-shEcad Breast Cancer IC50 = 2.20 ± 0.42 µM
dbacp07193 KKH GLLKLLKLLLHAAGW Synthetic Selective membrane perforation prevents resistance. MTT assay U-2 OS Bone Cancer IC50 = 13.30 ± 0.99 µM
dbacp07194 DEK GLLDLLELLLKAAGW Synthetic Selective membrane perforation prevents resistance. MTT assay HMLER Breast Cancer IC50 = 1.14 ± 0.52 µM
dbacp07195 DEK GLLDLLELLLKAAGW Synthetic Selective membrane perforation prevents resistance. MTT assay HMLER-shEcad Breast Cancer IC50 = 0.70 ± 0.07 µM
dbacp07196 DEK GLLDLLELLLKAAGW Synthetic Selective membrane perforation prevents resistance. MTT assay U-2 OS Bone Cancer IC50 = 19.88 ± 2.65 µM
dbacp07197 EEK GLLELLELLLKAAGW Synthetic Selective membrane perforation prevents resistance. MTT assay HMLER Breast Cancer IC50 = 1.10 ± 0.14 µM
dbacp07198 EEK GLLELLELLLKAAGW Synthetic Selective membrane perforation prevents resistance. MTT assay HMLER-shEcad Breast Cancer IC50 = 1.08 ± 0.18 µM
dbacp07199 EEK GLLELLELLLKAAGW Synthetic Selective membrane perforation prevents resistance. MTT assay U-2 OS Bone Cancer IC50 = 32.88 ± 4.07 µM
dbacp07200 HEK GLLHLLELLLKAAGW Synthetic Selective membrane perforation prevents resistance. MTT assay HMLER Breast Cancer IC50 = 2.35 ± 1.06 µM
dbacp07201 HEK GLLHLLELLLKAAGW Synthetic Selective membrane perforation prevents resistance. MTT assay HMLER-shEcad Breast Cancer IC50 = 3.45 ± 2.19 µM
dbacp07202 HEK GLLHLLELLLKAAGW Synthetic Selective membrane perforation prevents resistance. MTT assay U-2 OS Bone Cancer IC50 = 143.20 ± 80.33 µM
dbacp07203 KEK GLLKLLELLLKAAGW Synthetic Selective membrane perforation prevents resistance. MTT assay HMLER Breast Cancer IC50 = 1.60 ± 0.14 µM
dbacp07204 KEK GLLKLLELLLKAAGW Synthetic Selective membrane perforation prevents resistance. MTT assay HMLER-shEcad Breast Cancer IC50 = 1.35 ± 0.07 µM
dbacp07205 KEK GLLKLLELLLKAAGW Synthetic Selective membrane perforation prevents resistance. MTT assay U-2 OS Bone Cancer IC50 = 8.15 ± 0.49 µM
dbacp07206 DHK GLLDLLHLLLKAAGW Synthetic Selective membrane perforation prevents resistance. MTT assay HMLER Breast Cancer IC50 = 1.75 ±0.49 µM
dbacp07207 DHK GLLDLLHLLLKAAGW Synthetic Selective membrane perforation prevents resistance. MTT assay HMLER-shEcad Breast Cancer IC50 = 1.02 ± 0.12 µM
dbacp07208 DHK GLLDLLHLLLKAAGW Synthetic Selective membrane perforation prevents resistance. MTT assay U-2 OS Bone Cancer IC50 = 20.45 ± 2.05 µM
dbacp07209 EHK GLLELLHLLLKAAGW Synthetic Selective membrane perforation prevents resistance. MTT assay HMLER Breast Cancer IC50 = 1.35 ± 0.35 µM
dbacp07210 EHK GLLELLHLLLKAAGW Synthetic Selective membrane perforation prevents resistance. MTT assay HMLER-shEcad Breast Cancer IC50 = 0.71 ± 0.13 µM
dbacp07211 EHK GLLELLHLLLKAAGW Synthetic Selective membrane perforation prevents resistance. MTT assay U-2 OS Bone Cancer IC50 = 25.00 ± 0 µM
dbacp07212 HHK GLLHLLHLLLKAAGW Synthetic Selective membrane perforation prevents resistance. MTT assay HMLER Breast Cancer IC50 = 3.15 ± 0.07 µM
dbacp07213 HHK GLLHLLHLLLKAAGW Synthetic Selective membrane perforation prevents resistance. MTT assay HMLER-shEcad Breast Cancer IC50 = 1.75 ± 0.21 µM
dbacp07214 HHK GLLHLLHLLLKAAGW Synthetic Selective membrane perforation prevents resistance. MTT assay U-2 OS Bone Cancer IC50 = 12.65 ± 1.91 µM
dbacp07215 KHK GLLKLLHLLLKAAGW Synthetic Selective membrane perforation prevents resistance. MTT assay HMLER Breast Cancer IC50 = 2.59 ± 0.92 µM
dbacp07216 KHK GLLKLLHLLLKAAGW Synthetic Selective membrane perforation prevents resistance. MTT assay HMLER-shEcad Breast Cancer IC50 = 1.40 ± 0.14 µM
dbacp07217 KHK GLLKLLHLLLKAAGW Synthetic Selective membrane perforation prevents resistance. MTT assay U-2 OS Bone Cancer IC50 = 12.88 ± 1.24 µM
dbacp07218 DKK GLLDLLKLLLKAAGW Synthetic Selective membrane perforation prevents resistance. MTT assay HMLER Breast Cancer IC50 = 1.95 ± 0.35 µM
dbacp07219 DKK GLLDLLKLLLKAAGW Synthetic Selective membrane perforation prevents resistance. MTT assay HMLER-shEcad Breast Cancer IC50 = 1.20 ± 0.14 µM
dbacp07220 DKK GLLDLLKLLLKAAGW Synthetic Selective membrane perforation prevents resistance. MTT assay U-2 OS Bone Cancer IC50 = 10.40 ± 1.70 µM
dbacp07221 EKK GLLELLKLLLKAAGW Synthetic Selective membrane perforation prevents resistance. MTT assay HMLER Breast Cancer IC50 = 1.72 ± 0.21 µM
dbacp07222 EKK GLLELLKLLLKAAGW Synthetic Selective membrane perforation prevents resistance. MTT assay HMLER-shEcad Breast Cancer IC50 = 1.19 ± 0.40 µM
dbacp07223 EKK GLLELLKLLLKAAGW Synthetic Selective membrane perforation prevents resistance. MTT assay U-2 OS Bone Cancer IC50 = 12.20 ± 1.84 µM
dbacp07224 HKK GLLHLLKLLLKAAGW Synthetic Selective membrane perforation prevents resistance. MTT assay HMLER Breast Cancer IC50 = 3.40 ± 0.71 µM
dbacp07225 HKK GLLHLLKLLLKAAGW Synthetic Selective membrane perforation prevents resistance. MTT assay HMLER-shEcad Breast Cancer IC50 = 2.60 ± 0.42 µM
dbacp07226 HKK GLLHLLKLLLKAAGW Synthetic Selective membrane perforation prevents resistance. MTT assay U-2 OS Bone Cancer IC50 = 12.23 ± 0.11 µM
dbacp07227 KKK GLLKLLKLLLKAAGW Synthetic Selective membrane perforation prevents resistance. MTT assay HMLER Breast Cancer IC50 = 1.57 ± 0.24 µM
dbacp07228 KKK GLLKLLKLLLKAAGW Synthetic Selective membrane perforation prevents resistance. MTT assay HMLER-shEcad Breast Cancer IC50 = 1.35 ± 0.40 µM
dbacp07229 KKK GLLKLLKLLLKAAGW Synthetic Selective membrane perforation prevents resistance. MTT assay U-2 OS Bone Cancer IC50 = 9.65 ± 1.20 µM
dbacp07230 d-DHK GlldllhlllkaaGw Synthetic Selective membrane perforation prevents resistance. MTT assay HMLER Breast Cancer IC50 = 0.32 ± 0.07 µM
dbacp07231 d-DHK GlldllhlllkaaGw Synthetic Selective membrane perforation prevents resistance. MTT assay HMLER-shEcad Breast Cancer IC50 = 0.23 ± 0.04 µM
dbacp07232 d-DHK GlldllhlllkaaGw Synthetic Selective membrane perforation prevents resistance. MTT assay U-2 OS Bone Cancer IC50 = 1.24 ± 0.03 µM
dbacp07233 d-DEK GlldllelllkaaGw Synthetic Selective membrane perforation prevents resistance. MTT assay HMLER Breast Cancer IC50 = 0.44 ± 0.10 µM
dbacp07234 d-DEK GlldllelllkaaGw Synthetic Selective membrane perforation prevents resistance. MTT assay HMLER-shEcad Breast Cancer IC50 = 0.36 ± 0 µM
dbacp07235 d-DEK GlldllelllkaaGw Synthetic Selective membrane perforation prevents resistance. MTT assay U-2 OS Bone Cancer IC50 = 5.84 ± 0.04 µM
dbacp07236 d-EEK GllellelllkaaGw Synthetic Selective membrane perforation prevents resistance. MTT assay HMLER Breast Cancer IC50 = 0.29 ± 0.01 µM
dbacp07237 d-EEK GllellelllkaaGw Synthetic Selective membrane perforation prevents resistance. MTT assay HMLER-shEcad Breast Cancer IC50 = 0.29 ± 0.01 µM
dbacp07238 d-EEK GllellelllkaaGw Synthetic Selective membrane perforation prevents resistance. MTT assay U-2 OS Bone Cancer IC50 = 4.78 ± 0.02 µM
dbacp07239 RB4 MADSERLSAPGCWAACTNFSRTRK Derived from protein PLP2 F-actin modulation induces necrotic death. MTT assay B16-F10-Nex 2 Skin Cancer EC50 = 0.263 ± 0.585 mol/L × 10-3
dbacp07240 RB4 MADSERLSAPGCWAACTNFSRTRK Derived from protein PLP2 F-actin modulation induces necrotic death. MTT assay HeLa Cervical Cancer EC50 = 0.525 ± 0.160 mol/L × 10-3
dbacp07241 RB4 MADSERLSAPGCWAACTNFSRTRK Derived from protein PLP2 F-actin modulation induces necrotic death. MTT assay U-87 Brain Tumor EC50 = 0.427 ± 0.053 mol/L × 10-3
dbacp07242 RB4 MADSERLSAPGCWAACTNFSRTRK Derived from protein PLP2 F-actin modulation induces necrotic death. MTT assay A-2058 Skin Cancer EC50 = 0.744 ± 0.208 mol/L × 10-3
dbacp07243 RB4 MADSERLSAPGCWAACTNFSRTRK Derived from protein PLP2 F-actin modulation induces necrotic death. MTT assay MCF-7 Breast Cancer EC50 = 0.724 ± 0.340 mol/L × 10-3
dbacp07258 trans-Phakellistatin 18 trans(P)PIPYPIF Synthetic Not Available MTT assay HepG-2 Liver Cancer IC50 = 67.5 ± 2.938 µM
dbacp07259 t-DPH1-K4 GLWKKIKNVAAAAGKAALGAL Analogue of t-DPH1 Membrane disruption induces apoptotic signaling. MTT assay PC-3 Prostate Cancer IC50 = 18.99 μM
dbacp07260 t-DPH1-K4 GLWKKIKNVAAAAGKAALGAL Analogue of t-DPH1 Membrane disruption induces apoptotic signaling. MTT assay H-838 Lung Cancer IC50 = 10.11 μM
dbacp07261 t-DPH1-K4 GLWKKIKNVAAAAGKAALGAL Analogue of t-DPH1 Membrane disruption induces apoptotic signaling. MTT assay H-157 Lung Cancer IC50 = 6.143 μM
dbacp07262 t-DPH1-K4 GLWKKIKNVAAAAGKAALGAL Analogue of t-DPH1 Membrane disruption induces apoptotic signaling. MTT assay U251-MG Brain Tumor IC50 = 32.18 μM
dbacp07263 t-DPH1-5K GLWKKIKNVAKAAGKAALGAL Analogue of t-DPH1 Membrane disruption induces apoptotic signaling. MTT assay PC-3 Prostate Cancer IC50 = 2.605 μM
dbacp07264 t-DPH1-5K GLWKKIKNVAKAAGKAALGAL Analogue of t-DPH1 Membrane disruption induces apoptotic signaling. MTT assay H-838 Lung Cancer IC50 = 1.796 μM
dbacp07265 t-DPH1-5K GLWKKIKNVAKAAGKAALGAL Analogue of t-DPH1 Membrane disruption induces apoptotic signaling. MTT assay H-157 Lung Cancer IC50 = 1.546 μM
dbacp07266 t-DPH1-5K GLWKKIKNVAKAAGKAALGAL Analogue of t-DPH1 Membrane disruption induces apoptotic signaling. MTT assay U251-MG Brain Tumor IC50 = 2.679 μM
dbacp07267 t-DPH1-6K GLWKKIKNVAKAAGKAAKGAL Analogue of t-DPH1 Membrane disruption induces apoptotic signaling. MTT assay PC-3 Prostate Cancer IC50 = 55.65 μM
dbacp07268 t-DPH1-6K GLWKKIKNVAKAAGKAAKGAL Analogue of t-DPH1 Membrane disruption induces apoptotic signaling. MTT assay H-838 Lung Cancer IC50 = 186.1 μM
dbacp07269 t-DPH1-6K GLWKKIKNVAKAAGKAAKGAL Analogue of t-DPH1 Membrane disruption induces apoptotic signaling. MTT assay H-157 Lung Cancer IC50 = 88.28 μM
dbacp07270 t-DPH1-6K GLWKKIKNVAKAAGKAAKGAL Analogue of t-DPH1 Membrane disruption induces apoptotic signaling. MTT assay U251-MG Brain Tumor IC50 = 593.7 μM
dbacp07271 t-DPH1-6KW WLWKKIKNVAKAAGKAAKGAL Analogue of t-DPH1 Membrane disruption induces apoptotic signaling. MTT assay PC-3 Prostate Cancer IC50 = 118.4 μM
dbacp07272 t-DPH1-6KW WLWKKIKNVAKAAGKAAKGAL Analogue of t-DPH1 Membrane disruption induces apoptotic signaling. MTT assay H-838 Lung Cancer IC50 = 180.8 μM
dbacp07273 t-DPH1-6KW WLWKKIKNVAKAAGKAAKGAL Analogue of t-DPH1 Membrane disruption induces apoptotic signaling. MTT assay H-157 Lung Cancer IC50 = 427.3 μM
dbacp07274 t-DPH1-6KW WLWKKIKNVAKAAGKAAKGAL Analogue of t-DPH1 Membrane disruption induces apoptotic signaling. MTT assay U251-MG Brain Tumor IC50 = 1499 μM
dbacp07275 LCP-2 WAHT Laminaria japonica Mitochondrial apoptosis via p53 activation. MTT assay SGC-7901 Gastric Cancer IC50 = 116 ± 12.4 μM
dbacp07276 LCP-2 WAHT Laminaria japonica Mitochondrial apoptosis via p53 activation. MTT assay MKN-45 Gastric Cancer IC50 = 107 ± 11.8 μM
dbacp07277 LCP-2 WAHT Laminaria japonica Mitochondrial apoptosis via p53 activation. MTT assay HepG-2 Gastric Cancer IC50 = 96.9 ± 9.91 μM
dbacp07278 LCP-2 WAHT Laminaria japonica Mitochondrial apoptosis via p53 activation. MTT assay CaCo-2 Colon Cancer IC50 = 100 ± 11.6 μM
dbacp07279 LCP-3 WHLV Laminaria japonica Mitochondrial apoptosis via p53 activation. MTT assay SGC-7901 Gastric Cancer IC50 = 101 ± 10.6 μM
dbacp07280 LCP-3 WHLV Laminaria japonica Mitochondrial apoptosis via p53 activation. MTT assay MKN-45 Gastric Cancer IC50 = 86.9 ± 9.11 μM
dbacp07281 LCP-3 WHLV Laminaria japonica Mitochondrial apoptosis via p53 activation. MTT assay HepG-2 Gastric Cancer IC50 = 85.2 ± 9.27 μM
dbacp07282 LCP-3 WHLV Laminaria japonica Mitochondrial apoptosis via p53 activation. MTT assay CaCo-2 Colon Cancer IC50 = 68.2 ± 7.11 μM
dbacp07283 AtMP1 THPPTTTTTTTTTTTTTAAPATTT Anabastestudineus skin mucus fraction 2 p53-mediated Bax/Bcl-2 apoptosis activation MTT assay MCF-7 Breast Cancer IC50 = 8.25 ± 0.14 μg/ml
dbacp07284 AtMP1 THPPTTTTTTTTTTTTTAAPATTT Anabastestudineus skin mucus fraction 2 p53-mediated Bax/Bcl-2 apoptosis activation MTT assay MDA-MB-231 Breast Cancer IC50 = 9.35 ± 0.25 μg/ml
dbacp07285 AtMP2 TGIATSGLATFTLHTGSLAPAT Anabastestudineus skin mucus fraction 2 p53-mediated Bax/Bcl-2 apoptosis activation MTT assay MCF-7 Breast Cancer IC50 = 5.89 ± 0.14 μg/ml
dbacp07286 AtMP2 TGIATSGLATFTLHTGSLAPAT Anabastestudineus skin mucus fraction 2 p53-mediated Bax/Bcl-2 apoptosis activation MTT assay MDA-MB-231 Breast Cancer IC50 = 6.97 ± 0.24 μg/ml
dbacp07296 vCPP0275 KKRYKKKYKAYKPYKKKKKF Capsid protein of the Torque teno douroucouli virus Dual anticancer and BBB-blockade. MTT assay BT-20 Breast Cancer IC50 = 44.8 ± 1.1 μM
dbacp07297 vCPP0275 KKRYKKKYKAYKPYKKKKKF Capsid protein of the Torque teno douroucouli virus Dual anticancer and BBB-blockade. MTT assay SK-BR-3 Breast Cancer IC50 = 34.0 ± 1.0 μM
dbacp07298 vCPP0667 RPRRRATTRRRITTGTRRRR Capsid protein of the Torque teno douroucouli virus Dual anticancer and BBB-blockade. MTT assay BT-20 Breast Cancer IC50 = 88.8 ± 1.0 μM
dbacp07299 vCPP0667 RPRRRATTRRRITTGTRRRR Capsid protein of the Torque teno douroucouli virus Dual anticancer and BBB-blockade. MTT assay BT-474 Breast Cancer IC50 = 92.8 ± 1.1 μM
dbacp07300 vCPP0667 RPRRRATTRRRITTGTRRRR Capsid protein of the Torque teno douroucouli virus Dual anticancer and BBB-blockade. MTT assay SK-BR-3 Breast Cancer IC50 = 71.2 ± 1.1 μM
dbacp07301 vCPP0769 RRLTLRQLLGLGSRRRRRSR Capsid protein of the Torque teno douroucouli virus Dual anticancer and BBB-blockade. MTT assay MDA-MB-231 Breast Cancer IC50 = 9.0 ± 0.1 μM
dbacp07302 vCPP0769 RRLTLRQLLGLGSRRRRRSR Capsid protein of the Torque teno douroucouli virus Dual anticancer and BBB-blockade. MTT assay BT-20 Breast Cancer IC50 = 3.5 ± 1.5 μM
dbacp07303 vCPP0769 RRLTLRQLLGLGSRRRRRSR Capsid protein of the Torque teno douroucouli virus Dual anticancer and BBB-blockade. MTT assay BT-474 Breast Cancer IC50 = 37.5 ± 1.7 μM
dbacp07304 vCPP0769 RRLTLRQLLGLGSRRRRRSR Capsid protein of the Torque teno douroucouli virus Dual anticancer and BBB-blockade. MTT assay SK-BR-3 Breast Cancer IC50 = 21.1 ± 2.0 μM
dbacp07305 vCPP2319 WRRRYRRWRRRRRWRRRPRR Capsid protein of the Torque teno douroucouli virus Dual anticancer and BBB-blockade. MTT assay MDA-MB-231 Breast Cancer IC50 = 4.5 ± 0.1 μM
dbacp07306 vCPP2319 WRRRYRRWRRRRRWRRRPRR Capsid protein of the Torque teno douroucouli virus Dual anticancer and BBB-blockade. MTT assay BT-20 Breast Cancer IC50 = 4.2 ± 2.2 μM
dbacp07307 vCPP2319 WRRRYRRWRRRRRWRRRPRR Capsid protein of the Torque teno douroucouli virus Dual anticancer and BBB-blockade. MTT assay BT-474 Breast Cancer IC50 = 15.7 ± 1.5 μM
dbacp07308 vCPP2319 WRRRYRRWRRRRRWRRRPRR Capsid protein of the Torque teno douroucouli virus Dual anticancer and BBB-blockade. MTT assay SK-BR-3 Breast Cancer IC50 = 14.0 ± 1.0 μM
dbacp07309 LyeTxI-b IWLTALKFLGKNLGKLAKQQLAKL Synthetic Apoptosis induction and immune modulation. MTT assay 4T1 Breast Cancer IC50 = 6.5 ± 5.30 µM
dbacp07310 LyeTxI-b IWLTALKFLGKNLGKLAKQQLAKL Synthetic Apoptosis induction and immune modulation. MTT assay MCF-7 Breast Cancer IC50 = 7.34 ± 3.09 µM
dbacp07311 LyeTxI-b IWLTALKFLGKNLGKLAKQQLAKL Synthetic Apoptosis induction and immune modulation. MTT assay MDA-MB-231 Breast Cancer IC50 = 5.77 ± 0.83 µM
dbacp07312 B1OS-L FLPLIASLAGNVVPKIFCKITKRC B-1OS Not Available MTT assay H-838 Lung Cancer IC50 = 3.976 µM
dbacp07313 B1OS-L FLPLIASLAGNVVPKIFCKITKRC B-1OS Not Available MTT assay PC-3 Prostate Cancer IC50 = 5.473 µM
dbacp07314 B1OS-L FLPLIASLAGNVVPKIFCKITKRC B-1OS Not Available MTT assay U251-MG Brain Tumor IC50 = 8.629 µM
dbacp07315 B1OS-L FLPLIASLAGNVVPKIFCKITKRC B-1OS Not Available MTT assay MCF-7 Breast Cancer IC50 = 8.883 µM
dbacp07316 B1OS-L FLPLIASLAGNVVPKIFCKITKRC B-1OS Not Available MTT assay HCT-116 Colon Cancer IC50 = 11.03 µM
dbacp07317 B1OS-D-L FlPLIASLAGNVVPKIFCKITKRC B-1OS Not Available MTT assay H-838 Lung Cancer IC50 = 2.553 µM
dbacp07318 B1OS-D-L FlPLIASLAGNVVPKIFCKITKRC B-1OS Not Available MTT assay PC-3 Prostate Cancer IC50 = 2.629 µM
dbacp07319 B1OS-D-L FlPLIASLAGNVVPKIFCKITKRC B-1OS Not Available MTT assay U251-MG Brain Tumor IC50 = 3.492 µM
dbacp07320 B1OS-D-L FlPLIASLAGNVVPKIFCKITKRC B-1OS Not Available MTT assay MCF-7 Breast Cancer IC50 = 3.17 µM
dbacp07321 B1OS-D-L FlPLIASLAGNVVPKIFCKITKRC B-1OS Not Available MTT assay HCT-116 Colon Cancer IC50 = 3.721 µM
dbacp07324 IK13 CIIKKIIKKIIKK Synthetic Mitochondrial mediated apoptosis MTT assay HCT-116 Colorectal Cancer IC50 = 29 ± 6 µM
dbacp07325 IK13 CIIKKIIKKIIKK Synthetic Mitochondrial mediated apoptosis MTT assay HeLa Cervical Cancer IC50 = 47±5 µM
dbacp07326 LK13 CLLKKLLKKLLKK Synthetic Mitochondrial mediated apoptosis MTT assay HCT-116 Colorectal Cancer IC50 = 23 ± 2 µM
dbacp07327 LK13 CLLKKLLKKLLKK Synthetic Mitochondrial mediated apoptosis MTT assay HeLa Cervical Cancer IC50 = 83 ± 9 µM
dbacp07328 IR13 CIIRRIIRRIIRR Synthetic Mitochondrial mediated apoptosis MTT assay HCT-116 Colorectal Cancer IC50 > 100 µM
dbacp07329 IR13 CIIRRIIRRIIRR Synthetic Mitochondrial mediated apoptosis MTT assay HeLa Cervical Cancer IC50 > 100 µM
dbacp07330 LR13 CLLRRLLRRLLRR Synthetic Mitochondrial mediated apoptosis MTT assay HCT-116 Colorectal Cancer IC50 = 15.6 ± 1.0 µM
dbacp07331 LR13 CLLRRLLRRLLRR Synthetic Mitochondrial mediated apoptosis MTT assay HeLa Cervical Cancer IC50 = 26.7 ± 1.3 µM
dbacp07332 CI-15 CIIKKIIKKIIKKII Synthetic Mitochondrial mediated apoptosis MTT assay HCT-116 Colorectal Cancer IC50 = 7.7 ± 0.2 µM
dbacp07333 CI-15 CIIKKIIKKIIKKII Synthetic Mitochondrial mediated apoptosis MTT assay HeLa Cervical Cancer IC50 = 2.7 ± 0.5 µM
dbacp07334 GI-15 LC-Propargyl-GIIKKIIKKIIKKII Synthetic Mitochondrial mediated apoptosis MTT assay HCT-116 Colorectal Cancer IC50 = 13.6 ± 0.2 µM
dbacp07335 GI-15 LC-Propargyl-GIIKKIIKKIIKKII Synthetic Mitochondrial mediated apoptosis MTT assay HeLa Cervical Cancer IC50 = 16.6 ± 0.8 µM
dbacp07336 Temporin-HLa FFPLIFGALSSILPKIL Hylarana latouchii Membrane disruption MTT assay NCI-H23 Lung Cancer IC50 = 4.96 ± 0.94 μM
dbacp07337 Temporin-HLa FFPLIFGALSSILPKIL Hylarana latouchii Membrane disruption MTT assay H-157 Lung Cancer IC50 = 15.18 ± 2.98 μM
dbacp07338 Temporin-HLa FFPLIFGALSSILPKIL Hylarana latouchii Membrane disruption MTT assay H-460 Lung Cancer IC50 = 1.64 ± 0.41 μM
dbacp07347 GA - 2 Structure given in figure Synthetic (glycyrrhetinic acid (GA)-based peptides) Apoptosis induction, Bax/p53/caspase activation MTT assay MCF-7 Breast Cancer IC50 = 7.70 ± 1.3 µg/mL
dbacp07348 GA - 2 Structure given in figure Synthetic (glycyrrhetinic acid (GA)-based peptides) Apoptosis induction, Bax/p53/caspase activation MTT assay HCT-116 Colon Cancer IC50 = 70.30 ± 0.9 µg/mL
dbacp07349 GA - 3 Structure given in figure Synthetic (glycyrrhetinic acid (GA)-based peptides) Apoptosis induction, Bax/p53/caspase activation MTT assay MCF-7 Breast Cancer IC50 = 5.1 ± 0.7 µg/mL
dbacp07350 GA - 3 Structure given in figure Synthetic (glycyrrhetinic acid (GA)-based peptides) Apoptosis induction, Bax/p53/caspase activation MTT assay HCT-116 Colon Cancer IC50 = 7.40 ± 0.4 µg/mL
dbacp07351 GA - 4 Structure given in figure Synthetic (glycyrrhetinic acid (GA)-based peptides) Apoptosis induction, Bax/p53/caspase activation MTT assay MCF-7 Breast Cancer IC50 = 6.10 ± 0.4 µg/mL
dbacp07352 GA - 4 Structure given in figure Synthetic (glycyrrhetinic acid (GA)-based peptides) Apoptosis induction, Bax/p53/caspase activation MTT assay HCT-116 Colon Cancer IC50 = 73.0 ± 1.4 µg/mL
dbacp07353 GA - 5 Structure given in figure Synthetic (glycyrrhetinic acid (GA)-based peptides) Apoptosis induction, Bax/p53/caspase activation MTT assay MCF-7 Breast Cancer IC50 = 5.0 ± 0.3 µg/mL
dbacp07354 GA - 5 Structure given in figure Synthetic (glycyrrhetinic acid (GA)-based peptides) Apoptosis induction, Bax/p53/caspase activation MTT assay HCT-116 Colon Cancer IC50 = 5.2 ± 0.8 µg/mL
dbacp07355 GA - 7 Structure given in figure Synthetic (glycyrrhetinic acid (GA)-based peptides) Apoptosis induction, Bax/p53/caspase activation MTT assay MCF-7 Breast Cancer IC50 = 3.70 ± 0.2 µg/mL
dbacp07356 GA - 7 Structure given in figure Synthetic (glycyrrhetinic acid (GA)-based peptides) Apoptosis induction, Bax/p53/caspase activation MTT assay HCT-116 Colon Cancer IC50 = 3.0 ± 1.1 µg/mL
dbacp07357 GA - 7 Structure given in figure Synthetic (glycyrrhetinic acid (GA)-based peptides) Apoptosis induction, Bax/p53/caspase activation MTT assay HepG-2 Liver Cancer IC50 = 3.30 ± 0.1 µg/mL
dbacp07358 GA - 8 Structure given in figure Synthetic (glycyrrhetinic acid (GA)-based peptides) Apoptosis induction, Bax/p53/caspase activation MTT assay MCF-7 Breast Cancer IC50 = 6.90 ± 1.1 µg/mL
dbacp07359 GA - 8 Structure given in figure Synthetic (glycyrrhetinic acid (GA)-based peptides) Apoptosis induction, Bax/p53/caspase activation MTT assay HCT-116 Colon Cancer IC50 = 60.70 ± 0.6 µg/mL
dbacp07360 N-Ter-TAT RDVFTKGYGFGL-GRK(Dansylglycine)KRRQRRRPQ Synthetic Mitochondrial targeting, VDAC1-HKII dissociation MTT assay A-375 Skin Cancer IC50 > 50.0 μM
dbacp07361 Pal-N-Ter-TAT Pal-RDVFTKGYGFGL-GRK(Dansylglycine)KRRQRRRPQ Analogue of N-terminal fragment of the VDAC1 protein Mitochondrial targeting, VDAC1-HKII dissociation MTT assay A-375 Skin Cancer IC50 = 36.67(Supplementary material)/15.2 ± 0.7 μM(Published paper)
dbacp07362 Pal-N-Ter-TAT Pal-RDVFTKGYGFGL-GRK(Dansylglycine)KRRQRRRPQ Analogue of N-terminal fragment of the VDAC1 protein Mitochondrial targeting, VDAC1-HKII dissociation MTT assay A-549 Lung Cancer IC50 = 44.98 μM
dbacp07363 Pal-N-Ter-TAT Pal-RDVFTKGYGFGL-GRK(Dansylglycine)KRRQRRRPQ Analogue of N-terminal fragment of the VDAC1 protein Mitochondrial targeting, VDAC1-HKII dissociation MTT assay MCF-7 Breast Cancer IC50 = 27.26 μM
dbacp07364 pFL-N-Ter-TAT FPWWWPFL-RDVFTKGYGFGL-GRK(Dansylglycine)KRRQRRRPQ Analogue of N-terminal fragment of the VDAC1 protein Mitochondrial targeting, VDAC1-HKII dissociation MTT assay A-375 Skin Cancer IC50 = 11.1 ± 0.1 μM
dbacp07365 Piscidin 3 FIHHIFRGIVHAGRSIGRFLTG Morone chrysops x Morone saxatilis Cu²⁺-mediated membrane lipid oxidation MTT assay HT-1080 Fibrosarcoma IC50 = 26.01 µM
dbacp07366 Piscidin 3 FIHHIFRGIVHAGRSIGRFLTG Morone chrysops x Morone saxatilis Cu²⁺-mediated membrane lipid oxidation MTT assay HT-1080 Fibrosarcoma IC50 = 5.52 µM
dbacp07367 Piscidin 3 FIHHIFRGIVHAGRSIGRFLTG Morone chrysops x Morone saxatilis Cu²⁺-mediated membrane lipid oxidation MTT assay MDA-MB-231 Breast Cancer IC50 = 17.5 µM
dbacp07368 Piscidin 3 FIHHIFRGIVHAGRSIGRFLTG Morone chrysops x Morone saxatilis Cu²⁺-mediated membrane lipid oxidation MTT assay MDA-MB-231 Breast Cancer IC50 = 5.25 µM
dbacp07369 Piscidin 3 FIHHIFRGIVHAGRSIGRFLTG Morone chrysops x Morone saxatilis Cu²⁺-mediated membrane lipid oxidation MTT assay A-549 Lung Cancer IC50 = 21.6 µM
dbacp07370 Piscidin 3 FIHHIFRGIVHAGRSIGRFLTG Morone chrysops x Morone saxatilis Cu²⁺-mediated membrane lipid oxidation MTT assay A-549 Lung Cancer IC50 = 2.99 µM
dbacp07371 Piscidin 3 FIHHIFRGIVHAGRSIGRFLTG Morone chrysops x Morone saxatilis Cu²⁺-mediated membrane lipid oxidation MTT assay HeLa Cervical Cancer IC50 = 18.1 µM
dbacp07372 Piscidin 3 FIHHIFRGIVHAGRSIGRFLTG Morone chrysops x Morone saxatilis Cu²⁺-mediated membrane lipid oxidation MTT assay HeLa Cervical Cancer IC50 = 1.97 µM
dbacp07373 HPRP-A1 FKKLKKLFSKLWNWK N-terminal region of Helicobacter pylori ribosomal protein L1 Apoptosis induction, p53-mediated cell cycle arrest MTT assay CT-26 Colorectal Cancer IC50 between 0.5 and 1 µg/mL
dbacp07374 HPRP-A1 FKKLKKLFSKLWNWK N-terminal region of Helicobacter pylori ribosomal protein L1 Apoptosis induction, p53-mediated cell cycle arrest MTT assay HT-29 Colon Cancer IC50 ~ 0.5 µg/mL
dbacp07375 Brevinin-2DYd GIFDVVKGVLKGVGKNVAGSLLEQLKCKLSGGC Rana dybowskii Not Available MTT assay A-549 Lung Cancer IC50 = 2.975 µg/ml
dbacp07376 Brevinin-2DYd GIFDVVKGVLKGVGKNVAGSLLEQLKCKLSGGC Rana dybowskii Not Available MTT assay MCF-7 Breast Cancer IC50 = 25.74 µg/ml
dbacp07377 Brevinin-2DYd GIFDVVKGVLKGVGKNVAGSLLEQLKCKLSGGC Rana dybowskii Not Available MTT assay HeLa Cervical Cancer IC50 = 19.69 µg/ml
dbacp07378 Brevinin-2DYd GIFDVVKGVLKGVGKNVAGSLLEQLKCKLSGGC Rana dybowskii Not Available MTT assay LoVo Colon Cancer IC50 = 8.05 µg/ml
dbacp07379 Ranatuerin-2Lb GILSSIKGVAKGVAKNVAAQLLDTLKCKITGC Rana luteiventris Not Available MTT assay A-549 Lung Cancer IC50 = 15.32 µM
dbacp07380 Ranatuerin-2Lb GILSSIKGVAKGVAKNVAAQLLDTLKCKITGC Rana luteiventris Not Available MTT assay MCF-7 Breast Cancer IC50 = 45.25 µM
dbacp07381 Ranatuerin-2Lb GILSSIKGVAKGVAKNVAAQLLDTLKCKITGC Rana luteiventris Not Available MTT assay HeLa Cervical Cancer IC50 = 37.23 µM
dbacp07382 Ranatuerin-2Lb GILSSIKGVAKGVAKNVAAQLLDTLKCKITGC Rana luteiventris Not Available MTT assay LoVo Colon Cancer IC50 = 59.78 µM
dbacp07383 Odorranain-C1 GVLGAVKDLLIGAGKSAAQSVLKTLSCKLSNDC Odorrana grahami Not Available MTT assay A-549 Lung Cancer IC50 = 27.31 µM
dbacp07384 Odorranain-C1 GVLGAVKDLLIGAGKSAAQSVLKTLSCKLSNDC Odorrana grahami Not Available MTT assay MCF-7 Breast Cancer IC50 = 41.21 µM
dbacp07385 Odorranain-C1 GVLGAVKDLLIGAGKSAAQSVLKTLSCKLSNDC Odorrana grahami Not Available MTT assay HeLa Cervical Cancer IC50 = 52.83 µM
dbacp07386 Odorranain-C1 GVLGAVKDLLIGAGKSAAQSVLKTLSCKLSNDC Odorrana grahami Not Available MTT assay LoVo Colon Cancer IC50 = 55.22 µM
dbacp07387 Brevinin-2DYb GLFDVVKGVLKGAGKNVAGSLLEQLKCKLSGGC Rana dybowskii Not Available MTT assay A-549 Lung Cancer IC50 = 24.01 µM
dbacp07388 Brevinin-2DYb GLFDVVKGVLKGAGKNVAGSLLEQLKCKLSGGC Rana dybowskii Not Available MTT assay MCF-7 Breast Cancer IC50 = 37.84 µM
dbacp07389 Brevinin-2DYb GLFDVVKGVLKGAGKNVAGSLLEQLKCKLSGGC Rana dybowskii Not Available MTT assay HeLa Cervical Cancer IC50 = 23.26 µM
dbacp07390 Brevinin-2DYb GLFDVVKGVLKGAGKNVAGSLLEQLKCKLSGGC Rana dybowskii Not Available MTT assay LoVo Colon Cancer IC50 = 35.05 µM
dbacp07391 Ranatuerin-2 GLFLDTLKGAAKDVAGKLEGLKCKITGCKLP Rana catesbeiana Not Available MTT assay A-549 Lung Cancer IC50 > 128 µM
dbacp07392 Ranatuerin-2 GLFLDTLKGAAKDVAGKLEGLKCKITGCKLP Rana catesbeiana Not Available MTT assay MCF-7 Breast Cancer IC50 > 128 µM
dbacp07393 Ranatuerin-2 GLFLDTLKGAAKDVAGKLEGLKCKITGCKLP Rana catesbeiana Not Available MTT assay HeLa Cervical Cancer IC50 > 128 µM
dbacp07394 Ranatuerin-2 GLFLDTLKGAAKDVAGKLEGLKCKITGCKLP Rana catesbeiana Not Available MTT assay LoVo Colon Cancer IC50 = 128 µM
dbacp07395 17BIPHE2 GBKRLVQRLKDBLRNLV Derivative of LL-37 ERK-mediated apoptosis and mitochondrial disruption MTT assay A-549 Lung Cancer IC50 = 34.33 µmol
dbacp07396 17BIPHE2 GBKRLVQRLKDBLRNLV Derivative of LL-37 ERK-mediated apoptosis and mitochondrial disruption MTT assay NCI-H-1975 Lung Cancer IC50 = 71.42 µmol/L
dbacp07397 Pugnin A RLMRIFRILKLAR Synthetic Membrane disruption induces necrotic death MTT assay MCF-7 Breast Cancer 12% Cytotoxicity at 100 µM
dbacp07398 Pugnin A RLMRIFRILKLAR Synthetic Membrane disruption induces necrotic death MTT assay PC-3 Prostate Cancer 74% Cytotoxicity at 100 µM
dbacp07399 Pugnin B RMMRIFWVIKLAR Synthetic Membrane disruption induces necrotic death MTT assay MCF-7 Breast Cancer 5% Cytotoxicity at 100 µM
dbacp07400 Pugnin B RMMRIFWVIKLAR Synthetic Membrane disruption induces necrotic death MTT assay PC-3 Prostate Cancer 90% Cytotoxicity at 100 µM
dbacp07401 NMTP-5 zffygwyggmekllrggrgerppr Not Available NRP1/MDM2 inhibition induces apoptosis MTT assay SK-HEP-1 Liver Cancer IC50 = 53.84 ± 4.35 µM
dbacp07402 Pep GKLRLIKKLWVKKWKKKGWKA Synthetic Membrane disruption induces necrotic death MTT assay A-549 Lung Cancer IC50 = 4 µM
dbacp07403 Pep GKLRLIKKLWVKKWKKKGWKA Synthetic Membrane disruption induces necrotic death MTT assay MCF-7 Breast Cancer IC50 = 2 µM
dbacp07408 Dermaseptin-TO ALWKDLLKNVGIAAGKAALNKVTDMVNQ Phyllomedusa tomopterna Membrane disruption induces cell death MTT assay U251-MG Brain Tumor Graph Figure-7
dbacp07409 Dermaseptin-TO ALWKDLLKNVGIAAGKAALNKVTDMVNQ Phyllomedusa tomopterna Membrane disruption induces cell death MTT assay H-157 Lung Cancer Graph Figure-7
dbacp07410 Dermaseptin-TO ALWKDLLKNVGIAAGKAALNKVTDMVNQ Phyllomedusa tomopterna Membrane disruption induces cell death MTT assay PC-3 Prostate Cancer Graph Figure-7
dbacp07411 Si1 (KLAKLAK)2 Synthetic Membrane disruption induces cancer apoptosis MTT assay MCF-7 Breast Cancer IC50 = 124.1 ± 8.12 µM
dbacp07412 Si1 (KLAKLAK)2 Synthetic Membrane disruption induces cancer apoptosis MTT assay MDA-MB-231 Breast Cancer IC50 = 746.5 ± 7.6 µM
dbacp07413 Si3 KL(Beta-A)KL(Beta-A)AK Synthetic Membrane disruption induces cancer apoptosis MTT assay MCF-7 Breast Cancer IC50 = 176.3 ± 4.66 µM
dbacp07414 Si2 KL(Beta-A)KL(Beta-A)K Synthetic Membrane disruption induces cancer apoptosis MTT assay MCF-7 Breast Cancer IC50 = 662.9 ± 20.02 µM
dbacp07415 Si2 KL(Beta-A)KL(Beta-A)K Synthetic Membrane disruption induces cancer apoptosis MTT assay MDA-MB-231 Breast Cancer IC50 = 840 ± 21.18 µM
dbacp07416 Si11 KL(Beta-A)KL(Beta-A)K Synthetic Membrane disruption induces cancer apoptosis MTT assay MDA-MB-231 Breast Cancer IC50 = 1087 ± 70.71 µM
dbacp07417 Si11 KL(Beta-A)KLAK Synthetic Membrane disruption induces cancer apoptosis MTT assay MCF-7 Breast Cancer IC50 = 228.8 ± 7.18 µM
dbacp07418 Si13 KnLAKnLAK Synthetic Membrane disruption induces cancer apoptosis MTT assay MCF-7 Breast Cancer IC50 = 1704 ± 112 µM
dbacp07419 Si14 KnLAKnLAK Synthetic Membrane disruption induces cancer apoptosis MTT assay MCF-7 Breast Cancer IC50 = 593.3 ± 60.3 µM
dbacp07420 Si14 KnLAKnLAK Synthetic Membrane disruption induces cancer apoptosis MTT assay MDA-MB-231 Breast Cancer IC50 = 1049 ± 49.77 µM
dbacp07421 Si15 KnLAKnLAK Synthetic Membrane disruption induces cancer apoptosis MTT assay MCF-7 Breast Cancer IC50 = 140.3 ± 7.12 µM
dbacp07422 Si15 KnLAKnLAK Synthetic Membrane disruption induces cancer apoptosis MTT assay MDA-MB-231 Breast Cancer IC50 = 346.3 ± 7.91 µM
dbacp07423 GP-1 FKEHGY Ginseng Leaf Peptide Mitochondrial apoptosis via p53 activation MTT assay CT-26 Colorectal Cancer IC50 = 86.4 ± 9.46 µM
dbacp07424 GP-1 FKEHGY Ginseng Leaf Peptide Mitochondrial apoptosis via p53 activation MTT assay CaCo-2 Colon Cancer IC50 = 104 ± 11.3 µM
dbacp07425 GP-1 FKEHGY Ginseng Leaf Peptide Mitochondrial apoptosis via p53 activation MTT assay Colo-320 Colon Cancer IC50 = 111 ± 12.0 µM
dbacp07426 GP-2 EGFHL Ginseng Leaf Peptide Mitochondrial apoptosis via p53 activation MTT assay CT-26 Colorectal Cancer IC50 = 114 ± 12.1 µM
dbacp07427 GP-2 EGFHL Ginseng Leaf Peptide Mitochondrial apoptosis via p53 activation MTT assay CaCo-2 Colon Cancer IC50 = 154 ± 15.8 µM
dbacp07428 GP-2 EGFHL Ginseng Leaf Peptide Mitochondrial apoptosis via p53 activation MTT assay Colo-320 Colon Cancer IC50 = 142 ± 14.9 µM
dbacp07429 GP-3 FSHTYV Ginseng Leaf Peptide Mitochondrial apoptosis via p53 activation MTT assay CT-26 Colorectal Cancer IC50 = 133 ± 12.5 µM
dbacp07430 GP-3 FSHTYV Ginseng Leaf Peptide Mitochondrial apoptosis via p53 activation MTT assay CaCo-2 Colon Cancer IC50 = 162 ± 17.1 µM
dbacp07431 GP-3 FSHTYV Ginseng Leaf Peptide Mitochondrial apoptosis via p53 activation MTT assay Colo-320 Colon Cancer IC50 = 149 ± 15.2 µM
dbacp07432 [Arg]3-VmCT1 FLRALWNVAKSVF Synthetic Membrane disruption via cationic interaction MTT assay MCF-7 Breast Cancer IC50 = 20.6 ± 3.1 μmol/L
dbacp07433 [Arg]7-VmCT1 FLGALWRVAKSVF Synthetic Membrane disruption via cationic interaction MTT assay MCF-7 Breast Cancer IC50 = 18.0 ± 2.7 μmol/L
dbacp07434 [Arg]11-VmCT1 FLGALWNVAKRVF Synthetic Membrane disruption via cationic interaction MTT assay MCF-7 Breast Cancer IC50 = 25.8 ± 5.2 μmol/L
dbacp07435 L9H5-1 LHLLLHLLHHLLHL Synthetic Acid-triggered membrane disruption apoptosis MTT assay HeLa Cervical Cancer IC50 = 5.4 µM
dbacp07436 L8H6 LHHLLHLLHHLLHL Synthetic Acid-triggered membrane disruption apoptosis MTT assay HeLa Cervical Cancer IC50 = 16.4 µM
dbacp07466 Tachyplesin KWCFRVCYRGICYIRRCR Horseshoe crab Fas activation drives apoptosis/necroptosis MTT assay A-549 Lung Cancer IC50 = 35 µg/ml
dbacp07467 Tachyplesin KWCFRVCYRGICYIRRCR Horseshoe crab Fas activation drives apoptosis/necroptosis MTT assay H-460 Lung Cancer IC50 = 25 µg/ml
dbacp07472 MzDef MSSSNCANVCQTENFPGGECKAEGATRKCFCKNC Zea mays L. Disulfide-stabilized peptide disrupts pathogens MTT assay HepG-2 Liver Cancer IC50 ~ 22 µg/mL
dbacp07473 MzDef MSSSNCANVCQTENFPGGECKAEGATRKCFCKNC Zea mays L. Disulfide-stabilized peptide disrupts pathogens MTT assay MCF-7 Breast Cancer IC50 = 14.85 µg/mL
dbacp07474 MzDef MSSSNCANVCQTENFPGGECKAEGATRKCFCKNC Zea mays L. Disulfide-stabilized peptide disrupts pathogens MTT assay HCT-116 Colon Cancer IC50 = 29.85 µg/mL
dbacp07477 (LLKK)4 linear peptide LLKKLLKKLLKKLLKK Synthetic Apoptosis, drug-resistance reversal, tumor suppression MTT assay SK-HEP-1 Liver Cancer Cell Viability (%) ~ 14.1 ± 0.8 at 30 µg/mL
dbacp07478 (LLKK)4 linear peptide LLKKLLKKLLKKLLKK Synthetic Apoptosis, drug-resistance reversal, tumor suppression MTT assay HCT-116 Colon Cancer Cell Viability (%) ~ 10.73 ± 2.4 at 30 µg/mL
dbacp07479 (LLKK)4 linear peptide LLKKLLKKLLKKLLKK Synthetic Apoptosis, drug-resistance reversal, tumor suppression MTT assay Bcap-37 Breast Cancer Cell Viability (%) ~ 15.07 ± 0.5 at 30 µg/mL
dbacp07480 (LLKK)4 linear peptide LLKKLLKKLLKKLLKK Synthetic Apoptosis, drug-resistance reversal, tumor suppression MTT assay PC-3 Prostate Cancer Cell Viability (%) ~ 17.1 ± 5.0 at 30 µg/mL
dbacp07481 2-arm branched peptide [LLKKLLKK]2kC Synthetic Apoptosis, drug-resistance reversal, tumor suppression MTT assay SK-HEP-1 Liver Cancer Cell Viability (%) ~ 85.7 ± 4.3 at 30 µg/mL
dbacp07482 2-arm branched peptide [LLKKLLKK]2kC Synthetic Apoptosis, drug-resistance reversal, tumor suppression MTT assay HCT-116 Colon Cancer Cell Viability (%) ~ 78.6 ± 10.5 at 30 µg/mL
dbacp07483 2-arm branched peptide [LLKKLLKK]2kC Synthetic Apoptosis, drug-resistance reversal, tumor suppression MTT assay Bcap-37 Breast Cancer Cell Viability (%) ~ 81.8 ± 8.8 at 30 µg/mL
dbacp07484 2-arm branched peptide [LLKKLLKK]2kC Synthetic Apoptosis, drug-resistance reversal, tumor suppression MTT assay PC-3 Prostate Cancer Cell Viability (%) ~ 73.5 ± 2.2 at 30 µg/mL
dbacp07485 4-arm branched peptide {[LLKKLLKK]2kC}2 Synthetic Apoptosis, drug-resistance reversal, tumor suppression MTT assay SK-HEP-1 Liver Cancer Cell Viability (%) ~ 31.7 ± 5.1 at 30 µg/mL
dbacp07486 4-arm branched peptide {[LLKKLLKK]2kC}2 Synthetic Apoptosis, drug-resistance reversal, tumor suppression MTT assay HCT-116 Colon Cancer Cell Viability (%) ~ 67.6 ± 5.8 at 30 µg/mL
dbacp07487 4-arm branched peptide {[LLKKLLKK]2kC}2 Synthetic Apoptosis, drug-resistance reversal, tumor suppression MTT assay Bcap-37 Breast Cancer Cell Viability (%) ~ 51.4 ± 4.2 at 30 µg/mL
dbacp07488 4-arm branched peptide {[LLKKLLKK]2kC}2 Synthetic Apoptosis, drug-resistance reversal, tumor suppression MTT assay PC-3 Prostate Cancer Cell Viability (%) ~ 49.0 ± 0.8 at 30 µg/mL
dbacp07489 LRH7-G5 Not Available Synthetic GPR1 antagonism, PI3K/AKT inhibition MTT assay MDA-MB-231 Breast Cancer 60% cell viability at 0.01 μM
dbacp07490 LRH7-G5 Not Available Synthetic GPR1 antagonism, PI3K/AKT inhibition MTT assay HCC-1937 Breast Cancer 60% cell viability at 0.1 μM
dbacp07491 Figainin 1 FIGTLIPLALGALTKLFK Boana raniceps Membrane disruption, α-helix mediated MTT assay MCF-7 Breast Cancer IC50 = 13.7 µM
dbacp07492 Figainin 1 FIGTLIPLALGALTKLFK Boana raniceps Membrane disruption, α-helix mediated MTT assay HeLa Cervical Cancer IC50 = 11.1 µM
dbacp07493 Figainin 1 FIGTLIPLALGALTKLFK Boana raniceps Membrane disruption, α-helix mediated MTT assay B16-F10 Skin Cancer IC50 = 10.5 µM
dbacp07494 RA-3 RWrGGGGGLFDIIKKIAESF Synthetic Integrin-targeting, α-helix mediated lysis MTT assay U87-MG Brain Tumor IC50 = 32.27 μM
dbacp07495 RA-3 RWrGGGGGLFDIIKKIAESF Synthetic Integrin-targeting, α-helix mediated lysis MTT assay MDA-MB-231 Breast Cancer IC50 = 28.4 μM
dbacp07496 RA-3 RWrGGGGGLFDIIKKIAESF Synthetic Integrin-targeting, α-helix mediated lysis MTT assay MCF-7 Breast Cancer IC50 = 44.14 μM
dbacp07497 HX-12A FFRKVLKLIRKI Synthetic derivative of Temporin-Pta ABCB1 inhibition, MDR reversal, sensitization MTT assay KB-C2 Cervical Cancer IC50 = 6.45 μM
dbacp07498 HX-12B FFRKVLKLIRKIF Synthetic derivative of Temporin-Pta ABCB1 inhibition, MDR reversal, sensitization MTT assay KB-C2 Cervical Cancer IC50 = 7.61 μM
dbacp07499 HX-12C FFRKVLKLIRKIWR Synthetic derivative of Temporin-Pta ABCB1 inhibition, MDR reversal, sensitization MTT assay KB-C2 Cervical Cancer IC50 = 6.06 μM
dbacp07500 Mambalgin-1 LKCYQHGKVVTCHRDMKFCYHNTGMPFRNLKLILQGCSSSCSETENNKCCSTDRCNK Dendroaspis polylepsis ASIC inhibition suppresses cancer proliferation MTT assay MCF-7 Breast Cancer 22.43% cytotoxicity at 10 µg/mL
dbacp07501 Brevinin-1Ha FALGAVTCLIRTKCKVLPKLF Analogue of Brevinin-1H α-helix enhances antimicrobial, anticancer activity MTT assay PC-3 Prostate Cancer IC50 = 186.9 µM
dbacp07502 Brevinin-1Ha FALGAVTCLIRTKCKVLPKLF Analogue of Brevinin-1H α-helix enhances antimicrobial, anticancer activity MTT assay MDA-MB-435S Breast Cancer IC50 = 214.7 µM
dbacp07503 Brevinin-1Ha FALGAVTCLIRTKCKVLPKLF Analogue of Brevinin-1H α-helix enhances antimicrobial, anticancer activity MTT assay H-157 Lung Cancer IC50 = 278.9 µM
dbacp07504 Brevinin-1Ha FALGAVTCLIRTKCKVLPKLF Analogue of Brevinin-1H α-helix enhances antimicrobial, anticancer activity MTT assay HCT-116 Colon Cancer IC50 = 342.8 µM
dbacp07505 Brevinin-1HY FALGAVTKVLYKLFCLITRKC Analogue of Brevinin-1H α-helix enhances antimicrobial, anticancer activity MTT assay PC-3 Prostate Cancer IC50 = 5.425 µM
dbacp07506 Brevinin-1HY FALGAVTKVLYKLFCLITRKC Analogue of Brevinin-1H α-helix enhances antimicrobial, anticancer activity MTT assay MDA-MB-435S Breast Cancer IC50 = 2.243 µM
dbacp07507 Brevinin-1HY FALGAVTKVLYKLFCLITRKC Analogue of Brevinin-1H α-helix enhances antimicrobial, anticancer activity MTT assay H-157 Lung Cancer IC50 = 2.811 µM
dbacp07508 Brevinin-1HY FALGAVTKVLYKLFCLITRKC Analogue of Brevinin-1H α-helix enhances antimicrobial, anticancer activity MTT assay HCT-116 Colon Cancer IC50 = 3.583 µM
dbacp07509 cyclic dipeptide - 2b WA Synthetic Not Available MTT assay HeLa Cervical Cancer IC50 = 93.1 µM
dbacp07510 cyclic dipeptide - 2b WA Synthetic Not Available MTT assay MCF-7 Breast Cancer IC50 = 45.6 µM
dbacp07511 YT12 YFYPKDFTPGCT Arthrospira platensis ROS scavenging induces cancer cell death MTT assay HT-29 Colon Cancer IC50 = 12.5 μM
dbacp07512 Dermaseptin-PP ALWKDMLKGIGKLAGKAALGAVKTLV Phyllomedusa palliata Membrane disruption triggers dual apoptosis MTT assay H-157 Lung Cancer IC50 = 1.55 μM
dbacp07513 Dermaseptin-PP ALWKDMLKGIGKLAGKAALGAVKTLV Phyllomedusa palliata Membrane disruption triggers dual apoptosis MTT assay MCF-7 Breast Cancer IC50 = 2.92 μM
dbacp07514 Dermaseptin-PP ALWKDMLKGIGKLAGKAALGAVKTLV Phyllomedusa palliata Membrane disruption triggers dual apoptosis MTT assay PC-3 Prostate Cancer IC50 = 4.15 μM
dbacp07515 Dermaseptin-PP ALWKDMLKGIGKLAGKAALGAVKTLV Phyllomedusa palliata Membrane disruption triggers dual apoptosis MTT assay U-251 Brain Tumor IC50 = 2.47 μM
dbacp07517 LL-37 Analogue 2 LKRIVQRIKDFLR Synthetic Analog of LL-37 Helical peptides disrupt cancer membranes MTT assay A-549 Lung Cancer IC50 = 33.7 µg/mL
dbacp07518 LL-37 Analogue 3 AKRIVQRIKDFLR Synthetic Analog of LL-37 Helical peptides disrupt cancer membranes MTT assay A-549 Lung Cancer IC50 = 29.8 µg/mL
dbacp07519 LL-37 Analogue 4 FΚRIVQRILDFLR Synthetic Analog of LL-37 Helical peptides disrupt cancer membranes MTT assay A-549 Lung Cancer IC50 = 3.9 µg/mL
dbacp07520 LL-37 Analogue 5 FKSARIVQRILDFLR Synthetic Analog of LL-37 Helical peptides disrupt cancer membranes MTT assay A-549 Lung Cancer IC50 = 10.7 µg/mL
dbacp07521 LL-37 Analogue 6 FKRIVQRIRDFLR Synthetic Analog of LL-37 Helical peptides disrupt cancer membranes MTT assay A-549 Lung Cancer IC50 = 56 µg/mL
dbacp07522 LL-37 Analogue 7 FKRIVQRIRDFLR Synthetic Analog of LL-37 Helical peptides disrupt cancer membranes MTT assay A-549 Lung Cancer IC50 = 12.5 µg/mL
dbacp07523 LL-37 Analogue 8 FKRIVQKIKDFLR Synthetic Analog of LL-37 Helical peptides disrupt cancer membranes MTT assay A-549 Lung Cancer IC50 = 145 µg/mL
dbacp07524 LL-37 Analogue 9 FKRIVQLIKDFLR Synthetic Analog of LL-37 Helical peptides disrupt cancer membranes MTT assay A-549 Lung Cancer IC50 = 18.9 µg/mL
dbacp07525 LL-37 Analogue 10 FKRIVQLIKDFLR Synthetic Analog of LL-37 Helical peptides disrupt cancer membranes MTT assay A-549 Lung Cancer IC50 = 13.9 µg/mL
dbacp07526 LL-37 Analogue 11 FKRIVQRIKDLLR Synthetic Analog of LL-37 Helical peptides disrupt cancer membranes MTT assay A-549 Lung Cancer IC50 = 75 µg/mL
dbacp07527 LL-37 Analogue 12 FKRIVQRIKDLLR Synthetic Analog of LL-37 Helical peptides disrupt cancer membranes MTT assay A-549 Lung Cancer IC50 = 45.5 µg/mL
dbacp07528 LL-37 Analogue 13 FKRIVQIIKKFLR Synthetic Analog of LL-37 Helical peptides disrupt cancer membranes MTT assay A-549 Lung Cancer IC50 = 20.0 µg/mL
dbacp07529 LL-37 Analogue 14 FKRIVQIIKKFLR Synthetic Analog of LL-37 Helical peptides disrupt cancer membranes MTT assay A-549 Lung Cancer IC50 = 12.9 µg/mL
dbacp07530 LL-37 Analogue 15 FKRIVQLLKKLLR Synthetic Analog of LL-37 Helical peptides disrupt cancer membranes MTT assay A-549 Lung Cancer IC50 = 12.8 µg/mL
dbacp07531 LL-37 Analogue 16 FKRIVQLLKKLLR Synthetic Analog of LL-37 Helical peptides disrupt cancer membranes MTT assay A-549 Lung Cancer IC50 = 9.8 µg/mL
dbacp07532 LL-37 Analogue 17 FKRILQRIKDFLR Synthetic Analog of LL-37 Helical peptides disrupt cancer membranes MTT assay A-549 Lung Cancer IC50 = 19.2 µg/mL
dbacp07533 LL-37 Analogue 18 FKRILQRIKDFLR Synthetic Analog of LL-37 Helical peptides disrupt cancer membranes MTT assay A-549 Lung Cancer IC50 = 29.2 µg/mL
dbacp07534 rCT-II LKCKKLVPLFSKTCPAGKNLCYKMFMVAAPHVPVKRGCIDVCPKSSLLVKYVCCNTDKCN Naja naja Apoptosis via intrinsic (mitochondrial) and extrinsic (death receptor) pathways MTT assay MCF-7 Breast Cancer IC50 = 3.66 µg/mL
dbacp07546 Sur-X YGRKKRRQRRRKDHRISTFKNWPFLEGCACTPERM Synthetic Disrupts XIAP-survivin, induces apoptosis/necroptosis MTT assay HCT-116 Colon Cancer 20% cell viability at at 20 μM
dbacp07547 Sur-X YGRKKRRQRRRKDHRISTFKNWPFLEGCACTPERM Synthetic Disrupts XIAP-survivin, induces apoptosis/necroptosis MTT assay HCT-15 Colon Cancer Not Available
dbacp07548 Sur-X YGRKKRRQRRRKDHRISTFKNWPFLEGCACTPERM Synthetic Disrupts XIAP-survivin, induces apoptosis/necroptosis MTT assay RKO Colon Cancer 25% cell viability at at 20 μM
dbacp07549 Sur-X YGRKKRRQRRRKDHRISTFKNWPFLEGCACTPERM Synthetic Disrupts XIAP-survivin, induces apoptosis/necroptosis MTT assay HT-29 Colon Cancer Not Available
dbacp07550 NMANF2 KAIGLVIPEIDGKLDGGAQRV Staphylococcus hominis strain MANF2 GAPDH-like protein disrupts survival MTT assay A-549 Lung Cancer IC50 = 46.6 µg/mL
dbacp07551 NMANF2 KAIGLVIPEIDGKLDGGAQRV Staphylococcus hominis strain MANF2 GAPDH-like protein disrupts survival MTT assay HT-29 Colon Cancer IC50 = 48.9 µg/mL
dbacp07552 macrocyclic pyridoheptapeptide derivative 1a Structure given in Scheme 1 Synthetic Macrocyclic peptides disrupt cancer growth MTT assay MCF-7 Breast Cancer IC50 = 15.329 ± 0.672 μM
dbacp07553 macrocyclic pyridoheptapeptide derivative 1a Structure given in Scheme 1 Synthetic Macrocyclic peptides disrupt cancer growth MTT assay HepG-2 Liver Cancer IC50 = 6.615 ± 0.353 μM
dbacp07554 macrocyclic pyridoheptapeptide derivative 1b Structure given in Scheme 1 Synthetic Macrocyclic peptides disrupt cancer growth MTT assay MCF-7 Breast Cancer IC50 = 10.904 ± 0.534 μM
dbacp07555 macrocyclic pyridoheptapeptide derivative 1b Structure given in Scheme 1 Synthetic Macrocyclic peptides disrupt cancer growth MTT assay HepG-2 Liver Cancer IC50 = 8.724 ± 0.474 μM
dbacp07556 macrocyclic pyridoheptapeptide derivative 1c Structure given in Scheme 1 Synthetic Macrocyclic peptides disrupt cancer growth MTT assay MCF-7 Breast Cancer IC50 = 34.894 ± 1.273 μM
dbacp07557 macrocyclic pyridoheptapeptide derivative 1c Structure given in Scheme 1 Synthetic Macrocyclic peptides disrupt cancer growth MTT assay HepG-2 Liver Cancer IC50 = 17.011 ± 0.965 μM
dbacp07558 macrocyclic pyridoheptapeptide derivative 2a Structure given in Scheme 1 Synthetic Macrocyclic peptides disrupt cancer growth MTT assay HepG-2 Liver Cancer IC50 = 17.513 ± 0.876 μM
dbacp07559 macrocyclic pyridoheptapeptide derivative 2b Structure given in Scheme 1 Synthetic Macrocyclic peptides disrupt cancer growth MTT assay MCF-7 Breast Cancer IC50 = 20.697 ± 0.974 μM
dbacp07560 macrocyclic pyridoheptapeptide derivative 2b Structure given in Scheme 1 Synthetic Macrocyclic peptides disrupt cancer growth MTT assay HepG-2 Liver Cancer IC50 = 18.681 ± 0.988 μM
dbacp07561 macrocyclic pyridoheptapeptide derivative 2c Structure given in Scheme 1 Synthetic Macrocyclic peptides disrupt cancer growth MTT assay MCF-7 Breast Cancer IC50 = 24.943 ± 1.082 μM
dbacp07562 macrocyclic pyridoheptapeptide derivative 2c Structure given in Scheme 1 Synthetic Macrocyclic peptides disrupt cancer growth MTT assay HepG-2 Liver Cancer IC50 = 19.318 ± 1.057 μM
dbacp07563 macrocyclic pyridoheptapeptide derivative 3a Structure given in Scheme 1 Synthetic Macrocyclic peptides disrupt cancer growth MTT assay MCF-7 Breast Cancer IC50 = 10.316 ± 0.546 μM
dbacp07564 macrocyclic pyridoheptapeptide derivative 3a Structure given in Scheme 1 Synthetic Macrocyclic peptides disrupt cancer growth MTT assay HepG-2 Liver Cancer IC50 = 8.063 ± 0.863 μM
dbacp07565 macrocyclic pyridoheptapeptide derivative 3b Structure given in Scheme 1 Synthetic Macrocyclic peptides disrupt cancer growth MTT assay MCF-7 Breast Cancer IC50 = 9.911 ± 0.491 μM
dbacp07566 macrocyclic pyridoheptapeptide derivative 3b Structure given in Scheme 1 Synthetic Macrocyclic peptides disrupt cancer growth MTT assay HepG-2 Liver Cancer IC50 = 9.66 ± 0.792 μM
dbacp07567 macrocyclic pyridoheptapeptide derivative 3c Structure given in Scheme 1 Synthetic Macrocyclic peptides disrupt cancer growth MTT assay MCF-7 Breast Cancer IC50 = 22.864 ± 0.992 μM
dbacp07568 macrocyclic pyridoheptapeptide derivative 3c Structure given in Scheme 1 Synthetic Macrocyclic peptides disrupt cancer growth MTT assay HepG-2 Liver Cancer IC50 = 16.957 ± 1.161 μM
dbacp07569 macrocyclic pyridoheptapeptide derivative 4a Structure given in Scheme 1 Synthetic Macrocyclic peptides disrupt cancer growth MTT assay MCF-7 Breast Cancer IC50 = 9.304 ± 0.536 μM
dbacp07570 macrocyclic pyridoheptapeptide derivative 4a Structure given in Scheme 1 Synthetic Macrocyclic peptides disrupt cancer growth MTT assay HepG-2 Liver Cancer IC50 = 7.31 ± 0.595 μM
dbacp07571 macrocyclic pyridoheptapeptide derivative 4b Structure given in Scheme 1 Synthetic Macrocyclic peptides disrupt cancer growth MTT assay MCF-7 Breast Cancer IC50 = 9.188 ± 0.545 μM
dbacp07572 macrocyclic pyridoheptapeptide derivative 4b Structure given in Scheme 1 Synthetic Macrocyclic peptides disrupt cancer growth MTT assay HepG-2 Liver Cancer IC50 = 7.166 ± 0.892 μM
dbacp07573 macrocyclic pyridoheptapeptide derivative 4c Structure given in Scheme 1 Synthetic Macrocyclic peptides disrupt cancer growth MTT assay MCF-7 Breast Cancer IC50 = 19.552 ± 1.032 μM
dbacp07574 macrocyclic pyridoheptapeptide derivative 4c Structure given in Scheme 1 Synthetic Macrocyclic peptides disrupt cancer growth MTT assay HepG-2 Liver Cancer IC50 = 9.631 ± 0.932 μM
dbacp07575 macrocyclic pyridoheptapeptide derivative 5a Structure given in Scheme 1 Synthetic Macrocyclic peptides disrupt cancer growth MTT assay HepG-2 Liver Cancer IC50 = 7.117 ± 0.790 μM
dbacp07576 macrocyclic pyridoheptapeptide derivative 5b Structure given in Scheme 1 Synthetic Macrocyclic peptides disrupt cancer growth MTT assay HepG-2 Liver Cancer IC50 = 7.088 ± 0.784 μM
dbacp07577 macrocyclic pyridoheptapeptide derivative 5c Structure given in Scheme 1 Synthetic Macrocyclic peptides disrupt cancer growth MTT assay HepG-2 Liver Cancer IC50 = 9.568 ± 1.139 μM
dbacp07599 Tritrp-Agb V(Agb)(Agb)FPWWWPFL(Agb)(Agb) Synthetic Membrane permeabilization via lysine substitution MTT assay Jurkat Blood Cancer IC50 = 9.6 μM
dbacp07600 Tritrp-hArg V(hArg)(hArg)FPWWWPFL(hArg)(hArg) Synthetic Membrane permeabilization via lysine substitution MTT assay Jurkat Blood Cancer IC50 = 13.3 μM
dbacp07601 Tritrp-Lys VKKFPWWWPFLKK Synthetic Membrane permeabilization via lysine substitution MTT assay Jurkat Blood Cancer IC50 = 11.5 μM
dbacp07602 Tritrp-Dap V(Dap)(Dap)FPWWWPFL(Dap)(Dap) Synthetic Membrane permeabilization via lysine substitution MTT assay Jurkat Blood Cancer IC50 ≥ 65 μM
dbacp07603 Tritrp-Dab V(Dab)(Dab)FPWWWPFL(Dab)(Dab) Synthetic Membrane permeabilization via lysine substitution MTT assay Jurkat Blood Cancer IC50 ≤ 6.5 μM
dbacp07604 Tritrp-Orn V(Orn)(Orn)FPWWWPFL(Orn)(Orn) Synthetic Membrane permeabilization via lysine substitution MTT assay Jurkat Blood Cancer IC50 ≤ 6.5 μM
dbacp07605 Tritrp-P59A VRRFAWWWAFLRR Synthetic Membrane permeabilization via lysine substitution MTT assay Jurkat Blood Cancer IC50 = 12.5 μM
dbacp07606 Tritrp-P59A-Lys VKKFAWWWAFLKK Synthetic Membrane permeabilization via lysine substitution MTT assay Jurkat Blood Cancer IC50 = 27.6 μM
dbacp07607 Tritrp-P5A VRRFAWWWPFLRR Synthetic Membrane permeabilization via lysine substitution MTT assay Jurkat Blood Cancer IC50 = 16.2 μM
dbacp07608 Tritrp-P5A-Lys VKKFAWWWPFLKK Synthetic Membrane permeabilization via lysine substitution MTT assay Jurkat Blood Cancer IC50 = 27.6 μM
dbacp07609 Tritrp-P9A VRRFPWWWAFLRR Synthetic Membrane permeabilization via lysine substitution MTT assay Jurkat Blood Cancer IC50 = 6.8 μM
dbacp07610 Tritrp-P9A-Lys VKKFPWWWAFLKK Synthetic Membrane permeabilization via lysine substitution MTT assay Jurkat Blood Cancer IC50 = 15.1 μM
dbacp07611 Tritrp-W678F VRRFPFFFPFLRR Synthetic Membrane permeabilization via lysine substitution MTT assay Jurkat Blood Cancer IC50 = 24.6 μM
dbacp07612 Tritrp-W678bTA VRRFP(bTA)(bTA)(bTA)PFLRR Synthetic Membrane permeabilization via lysine substitution MTT assay Jurkat Blood Cancer IC50 = 9.6 μM
dbacp07613 Tritrp-W6hW VRRFP(hW)WWPFLRR Synthetic Membrane permeabilization via lysine substitution MTT assay Jurkat Blood Cancer IC50 = 16.1 μM
dbacp07614 Tritrp-W7hW VRRFPW(hW)WPFLRR Synthetic Membrane permeabilization via lysine substitution MTT assay Jurkat Blood Cancer IC50 = 15.1 μM
dbacp07615 Tritrp-W8hW VRRFPWW(hW)PFLRR Synthetic Membrane permeabilization via lysine substitution MTT assay Jurkat Blood Cancer IC50 = 10.7 μM
dbacp07616 Tritrp-W789hW VRRFP(hW)(hW)(hW)PFLRR Synthetic Membrane permeabilization via lysine substitution MTT assay Jurkat Blood Cancer IC50 = 44.8 μM
dbacp07617 Tritrp-W6A VRRFPAWWPFLRR Synthetic Membrane permeabilization via lysine substitution MTT assay Jurkat Blood Cancer IC50 = 36.5 μM
dbacp07618 Tritrp-W7A VRRFPWAWPFLRR Synthetic Membrane permeabilization via lysine substitution MTT assay Jurkat Blood Cancer IC50 = 48.2 μM
dbacp07619 Tritrp-W8A VRRFPWWAPFLRR Synthetic Membrane permeabilization via lysine substitution MTT assay Jurkat Blood Cancer IC50 = 22.8 μM
dbacp07620 Tritrp-W67A VRRFPAAWPFLRR Synthetic Membrane permeabilization via lysine substitution MTT assay Jurkat Blood Cancer IC50 ≥ 65 μM
dbacp07621 Tritrp-W68A VRRFPAWAPFLRR Synthetic Membrane permeabilization via lysine substitution MTT assay Jurkat Blood Cancer IC50 ≥ 65 μM
dbacp07622 Tritrp-W78A VRRFPWAAPFLRR Synthetic Membrane permeabilization via lysine substitution MTT assay Jurkat Blood Cancer IC50 ≥ 65 μM
dbacp07623 Tritrp-W678A VRRFPAAAPFLRR Synthetic Membrane permeabilization via lysine substitution MTT assay Jurkat Blood Cancer IC50 ≥ 65 μM
dbacp07624 Tritrp-W6Y VRRFPYWWPFLRR Synthetic Membrane permeabilization via lysine substitution MTT assay Jurkat Blood Cancer IC50 = 19.3 μM
dbacp07625 Tritrp-W7Y VRRFPWYWPFLRR Synthetic Membrane permeabilization via lysine substitution MTT assay Jurkat Blood Cancer IC50 = 11.4 μM
dbacp07626 Tritrp-W8Y VRRFPWWYPFLRR Synthetic Membrane permeabilization via lysine substitution MTT assay Jurkat Blood Cancer IC50 = 12.0 μM
dbacp07627 Tritrp-W67Y VRRFPYYWPFLRR Synthetic Membrane permeabilization via lysine substitution MTT assay Jurkat Blood Cancer IC50 = 32.2 μM
dbacp07628 Tritrp-W68Y VRRFPYWYPFLRR Synthetic Membrane permeabilization via lysine substitution MTT assay Jurkat Blood Cancer IC50 = 35.4 μM
dbacp07629 Tritrp-W78Y VRRFPWYYPFLRR Synthetic Membrane permeabilization via lysine substitution MTT assay Jurkat Blood Cancer IC50 = 25.6 μM
dbacp07630 Tritrp-W678Y VRRFPYYYPFLRR Synthetic Membrane permeabilization via lysine substitution MTT assay Jurkat Blood Cancer IC50 ≥ 65 μM
dbacp07631 Tritrp DiSu CVRRFPWWYPFLRRC Synthetic Membrane permeabilization via lysine substitution MTT assay Jurkat Blood Cancer IC50 = 12.3 μM
dbacp07632 MagaininF5W-Lys GIGKWLHSAKKFGKAFVGEIMNS Synthetic Membrane permeabilization via lysine substitution MTT assay Jurkat Blood Cancer IC50 = 16.8 μM
dbacp07633 MagaininF5W-Arg GIGRWLHSARRFGRAFVGEIMNS Synthetic Membrane permeabilization via lysine substitution MTT assay Jurkat Blood Cancer IC50 = 16.8 μM
dbacp07634 PuroA-Arg FPVTWKWWKWWKG Synthetic Membrane permeabilization via lysine substitution MTT assay Jurkat Blood Cancer IC50 = 10.0 μM
dbacp07635 PuroA-Lys FPVTWRWWRWWRG Synthetic Membrane permeabilization via lysine substitution MTT assay Jurkat Blood Cancer IC50 = 12.0 μM
dbacp07636 Indolicidin-Lys ILPWKWPWWPWKK Synthetic Membrane permeabilization via lysine substitution MTT assay Jurkat Blood Cancer IC50 = 9.5 μM
dbacp07637 MPG GALFLGFLGAAGSTMGAWSQPKKKRKV Synthetic Membrane permeabilization via lysine substitution MTT assay Jurkat Blood Cancer IC50 = 15.8 μM
dbacp07638 branched tetrapeptide Schiff bases derivative 4a Figure given in Scheme 1 Synthetic p53 stabilization and LDHA inhibition MTT assay MCF-7 Breast Cancer IC50 between 8.12 ± 0.14 to 17.55 ± 0.27 μM
dbacp07639 branched tetrapeptide Schiff bases derivative 4b Figure given in Scheme 1 Synthetic p53 stabilization and LDHA inhibition MTT assay MCF-7 Breast Cancer IC50 between 8.12 ± 0.14 to 17.55 ± 0.27 μM
dbacp07640 branched tetrapeptide Schiff bases derivative 4c Figure given in Scheme 1 Synthetic p53 stabilization and LDHA inhibition MTT assay MCF-7 Breast Cancer IC50 between 8.12 ± 0.14 to 17.55 ± 0.27 μM
dbacp07641 branched tetrapeptide Schiff bases derivative 5c Figure given in Scheme 1 Synthetic p53 stabilization and LDHA inhibition MTT assay MCF-7 Breast Cancer IC50 between 8.12 ± 0.14 to 17.55 ± 0.27 μM
dbacp07642 branched tetrapeptide Schiff bases derivative 5d Figure given in Scheme 1 Synthetic p53 stabilization and LDHA inhibition MTT assay MCF-7 Breast Cancer IC50 between 8.12 ± 0.14 to 17.55 ± 0.27 μM
dbacp07643 branched tetrapeptide Schiff bases derivative 5e Figure given in Scheme 1 Synthetic p53 stabilization and LDHA inhibition MTT assay MCF-7 Breast Cancer IC50 between 8.12 ± 0.14 to 17.55 ± 0.27 μM
dbacp07644 Colicin N HGDNNSKPKPGGNSGNRGNNGDGASAKVGEITITPDNSKPGRYISSNPEYSLLAKLIDAESIKGTEVYTFHTRKGQYVKVTVPDSNIDKMRVDYVNWKGPKYNNKLVKRFVSQFLLFRKEEKEKNEKEALLKASELVSGMGDKLGEYLGVKYKNVAKEVANDIKNFHGRNIRSYNEAMASLNKVLANPKMKVNKSDKDAIVNAWKQVNAKDMANKIGNLGKAFKVADLAIKVEKIREKSIEGYNTGNWGPLLLEVESWIIGGVVAGVAISLFGAVLSFLPISGLAVTALGVIGIMTISYLSSFIDANRVSNINNIISSVIR Apoptosis via integrin-Akt suppression MTT assay H-460 Lung Cancer Dose dependent % cell viability resuctuction at 1-15 µM
dbacp07645 Colicin N HGDNNSKPKPGGNSGNRGNNGDGASAKVGEITITPDNSKPGRYISSNPEYSLLAKLIDAESIKGTEVYTFHTRKGQYVKVTVPDSNIDKMRVDYVNWKGPKYNNKLVKRFVSQFLLFRKEEKEKNEKEALLKASELVSGMGDKLGEYLGVKYKNVAKEVANDIKNFHGRNIRSYNEAMASLNKVLANPKMKVNKSDKDAIVNAWKQVNAKDMANKIGNLGKAFKVADLAIKVEKIREKSIEGYNTGNWGPLLLEVESWIIGGVVAGVAISLFGAVLSFLPISGLAVTALGVIGIMTISYLSSFIDANRVSNINNIISSVIR Apoptosis via integrin-Akt suppression MTT assay H-292 Lung Cancer Dose dependent % cell viability resuctuction at 1-15 µM
dbacp07646 Colicin N HGDNNSKPKPGGNSGNRGNNGDGASAKVGEITITPDNSKPGRYISSNPEYSLLAKLIDAESIKGTEVYTFHTRKGQYVKVTVPDSNIDKMRVDYVNWKGPKYNNKLVKRFVSQFLLFRKEEKEKNEKEALLKASELVSGMGDKLGEYLGVKYKNVAKEVANDIKNFHGRNIRSYNEAMASLNKVLANPKMKVNKSDKDAIVNAWKQVNAKDMANKIGNLGKAFKVADLAIKVEKIREKSIEGYNTGNWGPLLLEVESWIIGGVVAGVAISLFGAVLSFLPISGLAVTALGVIGIMTISYLSSFIDANRVSNINNIISSVIR Apoptosis via integrin-Akt suppression MTT assay NCI-H23 Lung Cancer Dose dependent % cell viability resuctuction at 1-15 µM
dbacp07647 AP1-Z1 FLFSLIPHAISGLISAFK AcrAP1 from the venom of the Arabian scorpion Charge–hydrophobicity balance drives apoptosis MTT assay MCF-7 Breast Cancer IC50 = 7.222 μM
dbacp07648 AP1-Z1 FLFSLIPHAISGLISAFK AcrAP1 from the venom of the Arabian scorpion Charge–hydrophobicity balance drives apoptosis MTT assay A-375 Skin Cancer IC50 = 9.478 μM
dbacp07649 AP1-Z1 FLFSLIPHAISGLISAFK AcrAP1 from the venom of the Arabian scorpion Charge–hydrophobicity balance drives apoptosis MTT assay U-87 Brain Tumor IC50 = 10.21 μM
dbacp07650 AP1-Z5a FLFKLIPKAIKGLIKAFK Mutant of APR-Z1 Charge–hydrophobicity balance drives apoptosis MTT assay MCF-7 Breast Cancer Graph Figure 2A
dbacp07651 AP1-Z5a FLFKLIPKAIKGLIKAFK Mutant of APR-Z1 Charge–hydrophobicity balance drives apoptosis MTT assay A-375 Skin Cancer Graph Figure 2B
dbacp07652 AP1-Z5a FLFKLIPKAIKGLIKAFK Mutant of APR-Z1 Charge–hydrophobicity balance drives apoptosis MTT assay U-87 Brain Tumor Graph Figure 2C
dbacp07653 AP1-Z5b FLFKLIKHAIKGLIKAFK Mutant of APR-Z1 Charge–hydrophobicity balance drives apoptosis MTT assay MCF-7 Breast Cancer IC50 = 1.037 μM
dbacp07654 AP1-Z5b FLFKLIKHAIKGLIKAFK Mutant of APR-Z1 Charge–hydrophobicity balance drives apoptosis MTT assay A-375 Skin Cancer IC50 = 2.607 μM
dbacp07655 AP1-Z5b FLFKLIKHAIKGLIKAFK Mutant of APR-Z1 Charge–hydrophobicity balance drives apoptosis MTT assay U-87 Brain Tumor IC50 = 3.115 μM
dbacp07656 AP1-Z3a FLFSLIKHAIKGLISAFK Mutant of APR-Z1 Charge–hydrophobicity balance drives apoptosis MTT assay MCF-7 Breast Cancer Graph Figure 2A
dbacp07657 AP1-Z3a FLFSLIKHAIKGLISAFK Mutant of APR-Z1 Charge–hydrophobicity balance drives apoptosis MTT assay A-375 Skin Cancer Graph Figure 2B
dbacp07658 AP1-Z3a FLFSLIKHAIKGLISAFK Mutant of APR-Z1 Charge–hydrophobicity balance drives apoptosis MTT assay U-87 Brain Tumor Graph Figure 2C
dbacp07659 AP1-Z3b FLFSLIKHAISKLISAFK Mutant of APR-Z1 Charge–hydrophobicity balance drives apoptosis MTT assay MCF-7 Breast Cancer Graph Figure 2A
dbacp07660 AP1-Z3b FLFSLIKHAISKLISAFK Mutant of APR-Z1 Charge–hydrophobicity balance drives apoptosis MTT assay A-375 Skin Cancer Graph Figure 2B
dbacp07661 AP1-Z3b FLFSLIKHAISKLISAFK Mutant of APR-Z1 Charge–hydrophobicity balance drives apoptosis MTT assay U-87 Brain Tumor Graph Figure 2C
dbacp07662 AP1-Z7 FLFKLIKKAIKKLIKAFK Mutant of APR-Z1 Charge–hydrophobicity balance drives apoptosis MTT assay MCF-7 Breast Cancer Graph Figure 2A
dbacp07663 AP1-Z7 FLFKLIKKAIKKLIKAFK Mutant of APR-Z1 Charge–hydrophobicity balance drives apoptosis MTT assay A-375 Skin Cancer Graph Figure 2B
dbacp07664 AP1-Z7 FLFKLIKKAIKKLIKAFK Mutant of APR-Z1 Charge–hydrophobicity balance drives apoptosis MTT assay U-87 Brain Tumor Graph Figure 2C
dbacp07665 AP1-Z9 FLFKLIKKKIKKLIKKFK Mutant of APR-Z1 Charge–hydrophobicity balance drives apoptosis MTT assay MCF-7 Breast Cancer Graph Figure 2A
dbacp07666 AP1-Z9 FLFKLIKKKIKKLIKKFK Mutant of APR-Z1 Charge–hydrophobicity balance drives apoptosis MTT assay A-375 Skin Cancer Graph Figure 2B
dbacp07667 AP1-Z9 FLFKLIKKKIKKLIKKFK Mutant of APR-Z1 Charge–hydrophobicity balance drives apoptosis MTT assay U-87 Brain Tumor Graph Figure 2C
dbacp07668 Longicalycinin A linear analogue 1 GYPFV Synthetic Analogue of Longicalycinin A Cyclization enhances apoptosis via lysosomes MTT assay HepG-2 Liver Cancer IC50 = 9.66 ± 0.0007 µg/ml
dbacp07669 Longicalycinin A linear analogue 1 GYPFV Synthetic Analogue of Longicalycinin A Cyclization enhances apoptosis via lysosomes MTT assay HT-29 Colorectal Cancer IC50 = 10.45 ± 0.0042 µg/ml
dbacp07670 Longicalycinin A linear analogue 1 GYPFV Synthetic Analogue of Longicalycinin A Cyclization enhances apoptosis via lysosomes MTT assay HepG-2 Liver Cancer 13.29% Cell death at 100 µg/ml
dbacp07671 Longicalycinin A linear analogue 1 GYPFV Synthetic Analogue of Longicalycinin A Cyclization enhances apoptosis via lysosomes MTT assay HT-29 Colorectal Cancer 83.02% Cell death at 100 µg/ml
dbacp07672 Longicalycinin A Cyclic analogue 1 GYPFV Synthetic Analogue of Longicalycinin A Cyclization enhances apoptosis via lysosomes MTT assay HepG-2 Liver Cancer IC50 = 10.2 ± 0.007 µg/ml
dbacp07673 Longicalycinin A Cyclic analogue 1 GYPFV Synthetic Analogue of Longicalycinin A Cyclization enhances apoptosis via lysosomes MTT assay HT-29 Colorectal Cancer IC50 = 11.4 ± 0.0028 µg/ml
dbacp07674 Longicalycinin A Cyclic analogue 1 GYPFV Synthetic Analogue of Longicalycinin A Cyclization enhances apoptosis via lysosomes MTT assay HepG-2 Liver Cancer 69.73% Cell death at 100 µg/ml
dbacp07675 Longicalycinin A Cyclic analogue 1 GYPFV Synthetic Analogue of Longicalycinin A Cyclization enhances apoptosis via lysosomes MTT assay HT-29 Colorectal Cancer 71.5% Cell death at 100 µg/ml
dbacp07676 Longicalycinin A linear analogue 2 LYPFA Synthetic Analogue of Longicalycinin A Cyclization enhances apoptosis via lysosomes MTT assay HepG-2 Liver Cancer IC50 = 8.76 ± 0.0035 µg/ml
dbacp07677 Longicalycinin A linear analogue 2 LYPFA Synthetic Analogue of Longicalycinin A Cyclization enhances apoptosis via lysosomes MTT assay HT-29 Colorectal Cancer IC50 = 12.33 ± 0 µg/ml
dbacp07678 Longicalycinin A linear analogue 2 LYPFA Synthetic Analogue of Longicalycinin A Cyclization enhances apoptosis via lysosomes MTT assay HepG-2 Liver Cancer 71.37% Cell death at 100 µg/ml
dbacp07679 Longicalycinin A linear analogue 2 LYPFA Synthetic Analogue of Longicalycinin A Cyclization enhances apoptosis via lysosomes MTT assay HT-29 Colorectal Cancer 88.47% Cell death at 100 µg/ml
dbacp07680 Longicalycinin A FYPFG Dianthus superbus Cyclization enhances apoptosis via lysosomes MTT assay HepG-2 Liver Cancer IC50 = 13.52 µg/ml
dbacp07681 Longicalycinin A FYPFG Dianthus superbus Cyclization enhances apoptosis via lysosomes MTT assay DLA cell line Lung Cancer CTC50 = 2.62 µM
dbacp07682 Longicalycinin A FYPFG Dianthus superbus Cyclization enhances apoptosis via lysosomes MTT assay EAC cell Line Breast Cancer CTC50 = 6.17 µM
dbacp07683 Longicalycinin A FYPFG Synthetic Cyclization enhances apoptosis via lysosomes MTT assay HepG-2 Liver Cancer IC50 = 10.45 ± 0.0042 µg/ml
dbacp07684 Longicalycinin A FYPFG Synthetic Cyclization enhances apoptosis via lysosomes MTT assay HT-29 Colorectal Cancer IC50 = 11.87 ± 0.0021 µg/ml
dbacp07685 Longicalycinin A (Linear) FYPFG Synthetic Cyclization enhances apoptosis via lysosomes MTT assay HepG-2 Liver Cancer IC50 = 9.18 ± 0.0014 µg/ml
dbacp07686 Longicalycinin A (Linear) FYPFG Synthetic Cyclization enhances apoptosis via lysosomes MTT assay HT-29 Colorectal Cancer IC50 = 9.61 ± 0.0007 µg/ml
dbacp07687 Longicalycinin A linear analogue 14 PYFFL Synthetic Analogue of Longicalycinin A Cyclization enhances apoptosis via lysosomes MTT assay HepG-2 Liver Cancer IC50 = 9.67 ± 0.0007 µg/ml
dbacp07688 Longicalycinin A linear analogue 14 PYFFL Synthetic Analogue of Longicalycinin A Cyclization enhances apoptosis via lysosomes MTT assay HT-29 Colorectal Cancer IC50 = 9.12 ± 0.0042 µg/ml
dbacp07689 Longicalycinin A linear analogue 14 PYFFL Synthetic Analogue of Longicalycinin A Cyclization enhances apoptosis via lysosomes MTT assay HepG-2 Liver Cancer 13.02% Cell death at 100 µg/ml
dbacp07690 Longicalycinin A linear analogue 14 PYFFL Synthetic Analogue of Longicalycinin A Cyclization enhances apoptosis via lysosomes MTT assay HT-29 Colorectal Cancer 82.36% Cell death at 100 µg/ml
dbacp07691 Longicalycinin A cyclic analogue 14 PYFFL Synthetic Analogue of Longicalycinin A Cyclization enhances apoptosis via lysosomes MTT assay HepG-2 Liver Cancer IC50 = 10.46 ± 0.0028 µg/ml
dbacp07692 Longicalycinin A cyclic analogue 14 PYFFL Synthetic Analogue of Longicalycinin A Cyclization enhances apoptosis via lysosomes MTT assay HT-29 Colorectal Cancer IC50 = 10.92 ± 0.0021 µg/ml
dbacp07693 Longicalycinin A cyclic analogue 14 PYFFL Synthetic Analogue of Longicalycinin A Cyclization enhances apoptosis via lysosomes MTT assay HepG-2 Liver Cancer 70.69% Cell death at 100 µg/ml
dbacp07694 Longicalycinin A cyclic analogue 14 PYFFL Synthetic Analogue of Longicalycinin A Cyclization enhances apoptosis via lysosomes MTT assay HT-29 Colorectal Cancer 52.38% Cell death at 100 µg/ml
dbacp07695 Longicalycinin A linear analogue 3 GYPFA Synthetic Analogue of Longicalycinin A Cyclization enhances apoptosis via lysosomes MTT assay HepG-2 Liver Cancer IC50 = 9.77 ± 0.0007 µg/ml
dbacp07696 Longicalycinin A linear analogue 3 GYPFA Synthetic Analogue of Longicalycinin A Cyclization enhances apoptosis via lysosomes MTT assay HT-29 Colorectal Cancer IC50 = 11.4 ± 0 µg/ml
dbacp07697 Longicalycinin A linear analogue 3 GYPFA Synthetic Analogue of Longicalycinin A Cyclization enhances apoptosis via lysosomes MTT assay HepG-2 Liver Cancer 82.33% Cell death at 100 µg/ml
dbacp07698 Longicalycinin A linear analogue 3 GYPFA Synthetic Analogue of Longicalycinin A Cyclization enhances apoptosis via lysosomes MTT assay HT-29 Colorectal Cancer 87.56% Cell death at 100 µg/ml
dbacp07699 Longicalycinin A cyclic analogue 3 GYPFA Synthetic Analogue of Longicalycinin A Cyclization enhances apoptosis via lysosomes MTT assay HepG-2 Liver Cancer IC50 = 9.5 ± 0.0056 µg/ml
dbacp07700 Longicalycinin A cyclic analogue 3 GYPFA Synthetic Analogue of Longicalycinin A Cyclization enhances apoptosis via lysosomes MTT assay HT-29 Colorectal Cancer IC50 = 11.28 ± 0.0063 µg/ml
dbacp07701 Longicalycinin A cyclic analogue 3 GYPFA Synthetic Analogue of Longicalycinin A Cyclization enhances apoptosis via lysosomes MTT assay HepG-2 Liver Cancer 56.72% Cell death at 100 µg/ml
dbacp07702 Longicalycinin A cyclic analogue 3 GYPFA Synthetic Analogue of Longicalycinin A Cyclization enhances apoptosis via lysosomes MTT assay HT-29 Colorectal Cancer 28.51% Cell death at 100 µg/ml
dbacp07703 Longicalycinin A linear analogue 4 AYPFG Synthetic Analogue of Longicalycinin A Cyclization enhances apoptosis via lysosomes MTT assay HepG-2 Liver Cancer IC50 = 9.53 ± 0.0014 µg/ml
dbacp07704 Longicalycinin A linear analogue 4 AYPFG Synthetic Analogue of Longicalycinin A Cyclization enhances apoptosis via lysosomes MTT assay HT-29 Colorectal Cancer IC50 = 10.78 ± 0.0021 µg/ml
dbacp07705 Longicalycinin A linear analogue 4 AYPFG Synthetic Analogue of Longicalycinin A Cyclization enhances apoptosis via lysosomes MTT assay HepG-2 Liver Cancer 27.13% Cell death at 100 µg/ml
dbacp07706 Longicalycinin A linear analogue 4 AYPFG Synthetic Analogue of Longicalycinin A Cyclization enhances apoptosis via lysosomes MTT assay HT-29 Colorectal Cancer 75.91% Cell death at 100 µg/ml
dbacp07707 Longicalycinin A cyclic analogue 4 AYPFG Synthetic Analogue of Longicalycinin A Cyclization enhances apoptosis via lysosomes MTT assay HepG-2 Liver Cancer IC50 = 9.77 ± 0.007 µg/ml
dbacp07708 Longicalycinin A cyclic analogue 4 AYPFG Synthetic Analogue of Longicalycinin A Cyclization enhances apoptosis via lysosomes MTT assay HT-29 Colorectal Cancer IC50 = 11.33 ± 0.0035 µg/ml
dbacp07709 Longicalycinin A cyclic analogue 4 AYPFG Synthetic Analogue of Longicalycinin A Cyclization enhances apoptosis via lysosomes MTT assay HepG-2 Liver Cancer 71.1% Cell death at 100 µg/ml
dbacp07710 Longicalycinin A cyclic analogue 4 AYPFG Synthetic Analogue of Longicalycinin A Cyclization enhances apoptosis via lysosomes MTT assay HT-29 Colorectal Cancer 52.49% Cell death at 100 µg/ml
dbacp07711 Longicalycinin A linear analogue 5 FSPFG Synthetic Analogue of Longicalycinin A Cyclization enhances apoptosis via lysosomes MTT assay HepG-2 Liver Cancer IC50 = 8.99 ± 0.0014 µg/ml
dbacp07712 Longicalycinin A linear analogue 5 FSPFG Synthetic Analogue of Longicalycinin A Cyclization enhances apoptosis via lysosomes MTT assay HT-29 Colorectal Cancer IC50 = 10.97 ± 0.0049 µg/ml
dbacp07713 Longicalycinin A linear analogue 5 FSPFG Synthetic Analogue of Longicalycinin A Cyclization enhances apoptosis via lysosomes MTT assay HepG-2 Liver Cancer 76.72% Cell death at 100 µg/ml
dbacp07714 Longicalycinin A linear analogue 5 FSPFG Synthetic Analogue of Longicalycinin A Cyclization enhances apoptosis via lysosomes MTT assay HT-29 Colorectal Cancer 91.52% Cell death at 100 µg/ml
dbacp07715 Longicalycinin A cyclic analogue 5 FSPFG Synthetic Analogue of Longicalycinin A Cyclization enhances apoptosis via lysosomes MTT assay HepG-2 Liver Cancer IC50 = 9.45 ± 0.0056 µg/ml
dbacp07716 Longicalycinin A cyclic analogue 5 FSPFG Synthetic Analogue of Longicalycinin A Cyclization enhances apoptosis via lysosomes MTT assay HT-29 Colorectal Cancer IC50 = 9.98 ± 0.4256 µg/ml
dbacp07717 Longicalycinin A cyclic analogue 5 FSPFG Synthetic Analogue of Longicalycinin A Cyclization enhances apoptosis via lysosomes MTT assay HepG-2 Liver Cancer 41.37% Cell death at 100 µg/ml
dbacp07718 Longicalycinin A cyclic analogue 5 FSPFG Synthetic Analogue of Longicalycinin A Cyclization enhances apoptosis via lysosomes MTT assay HT-29 Colorectal Cancer 97.74% Cell death at 100 µg/ml
dbacp07719 Longicalycinin A linear analogue 6 VYPIA Synthetic Analogue of Longicalycinin A Cyclization enhances apoptosis via lysosomes MTT assay HepG-2 Liver Cancer IC50 = 10.98 ± 0.0014 µg/ml
dbacp07720 Longicalycinin A linear analogue 6 VYPIA Synthetic Analogue of Longicalycinin A Cyclization enhances apoptosis via lysosomes MTT assay HT-29 Colorectal Cancer IC50 = 12.31 ± 0.0063 µg/ml
dbacp07721 Longicalycinin A linear analogue 6 VYPIA Synthetic Analogue of Longicalycinin A Cyclization enhances apoptosis via lysosomes MTT assay HepG-2 Liver Cancer 38.64% Cell death at 100 µg/ml
dbacp07722 Longicalycinin A linear analogue 6 VYPIA Synthetic Analogue of Longicalycinin A Cyclization enhances apoptosis via lysosomes MTT assay HT-29 Colorectal Cancer 49.33% Cell death at 100 µg/ml
dbacp07723 Longicalycinin A cyclic analogue 6 VYPIA Synthetic Analogue of Longicalycinin A Cyclization enhances apoptosis via lysosomes MTT assay HepG-2 Liver Cancer IC50 = 17.34 ± 0.0014 µg/ml
dbacp07724 Longicalycinin A cyclic analogue 6 VYPIA Synthetic Analogue of Longicalycinin A Cyclization enhances apoptosis via lysosomes MTT assay HT-29 Colorectal Cancer IC50 = 10.2 ± 0.0021 µg/ml
dbacp07725 Longicalycinin A cyclic analogue 6 VYPIA Synthetic Analogue of Longicalycinin A Cyclization enhances apoptosis via lysosomes MTT assay HepG-2 Liver Cancer 51.79% Cell death at 100 µg/ml
dbacp07726 Longicalycinin A cyclic analogue 6 VYPIA Synthetic Analogue of Longicalycinin A Cyclization enhances apoptosis via lysosomes MTT assay HT-29 Colorectal Cancer 27.61% Cell death at 100 µg/ml
dbacp07727 Longicalycinin A linear analogue 7 PYVFA Synthetic Analogue of Longicalycinin A Cyclization enhances apoptosis via lysosomes MTT assay HepG-2 Liver Cancer IC50 = 9.6 ± 0.0007 µg/ml
dbacp07728 Longicalycinin A linear analogue 7 PYVFA Synthetic Analogue of Longicalycinin A Cyclization enhances apoptosis via lysosomes MTT assay HT-29 Colorectal Cancer IC50 = 9.78 ± 0.0212 µg/ml
dbacp07729 Longicalycinin A linear analogue 7 PYVFA Synthetic Analogue of Longicalycinin A Cyclization enhances apoptosis via lysosomes MTT assay HepG-2 Liver Cancer 82.33% Cell death at 100 µg/ml
dbacp07730 Longicalycinin A linear analogue 7 PYVFA Synthetic Analogue of Longicalycinin A Cyclization enhances apoptosis via lysosomes MTT assay HT-29 Colorectal Cancer 84.17% Cell death at 100 µg/ml
dbacp07731 Longicalycinin A cyclic analogue 7 PYVFA Synthetic Analogue of Longicalycinin A Cyclization enhances apoptosis via lysosomes MTT assay HepG-2 Liver Cancer IC50 = 9.21 ± 0.0056 µg/ml
dbacp07732 Longicalycinin A cyclic analogue 7 PYVFA Synthetic Analogue of Longicalycinin A Cyclization enhances apoptosis via lysosomes MTT assay HT-29 Colorectal Cancer IC50 = 12.11 ± 0.0035 µg/ml
dbacp07733 Longicalycinin A cyclic analogue 7 PYVFA Synthetic Analogue of Longicalycinin A Cyclization enhances apoptosis via lysosomes MTT assay HepG-2 Liver Cancer 47.68% Cell death at 100 µg/ml
dbacp07734 Longicalycinin A cyclic analogue 7 PYVFA Synthetic Analogue of Longicalycinin A Cyclization enhances apoptosis via lysosomes MTT assay HT-29 Colorectal Cancer 22.86% Cell death at 100 µg/ml
dbacp07735 Longicalycinin A linear analogue 8 FYPVG Synthetic Analogue of Longicalycinin A Cyclization enhances apoptosis via lysosomes MTT assay HepG-2 Liver Cancer IC50 = 10.35 ± 0.0014 µg/ml
dbacp07736 Longicalycinin A linear analogue 8 FYPVG Synthetic Analogue of Longicalycinin A Cyclization enhances apoptosis via lysosomes MTT assay HT-29 Colorectal Cancer IC50 = 12.88 ± 0.0014 µg/ml
dbacp07737 Longicalycinin A linear analogue 8 FYPVG Synthetic Analogue of Longicalycinin A Cyclization enhances apoptosis via lysosomes MTT assay HepG-2 Liver Cancer 15.35% Cell death at 100 µg/ml
dbacp07738 Longicalycinin A linear analogue 8 FYPVG Synthetic Analogue of Longicalycinin A Cyclization enhances apoptosis via lysosomes MTT assay HT-29 Colorectal Cancer 88.01% Cell death at 100 µg/ml
dbacp07739 Longicalycinin A cyclic analogue 8 FYPVG Synthetic Analogue of Longicalycinin A Cyclization enhances apoptosis via lysosomes MTT assay HepG-2 Liver Cancer IC50 = 9.12 ± 0.0007 µg/ml
dbacp07740 Longicalycinin A cyclic analogue 8 FYPVG Synthetic Analogue of Longicalycinin A Cyclization enhances apoptosis via lysosomes MTT assay HT-29 Colorectal Cancer IC50 = 12.67 ± 0.0028 µg/ml
dbacp07741 Longicalycinin A cyclic analogue 8 FYPVG Synthetic Analogue of Longicalycinin A Cyclization enhances apoptosis via lysosomes MTT assay HepG-2 Liver Cancer 36.85% Cell death at 100 µg/ml
dbacp07742 Longicalycinin A cyclic analogue 8 FYPVG Synthetic Analogue of Longicalycinin A Cyclization enhances apoptosis via lysosomes MTT assay HT-29 Colorectal Cancer 29.87% Cell death at 100 µg/ml
dbacp07743 Longicalycinin A linear analogue 9 FYPFV Synthetic Analogue of Longicalycinin A Cyclization enhances apoptosis via lysosomes MTT assay HepG-2 Liver Cancer IC50 = 9.33 ± 0.0007 µg/ml
dbacp07744 Longicalycinin A linear analogue 9 FYPFV Synthetic Analogue of Longicalycinin A Cyclization enhances apoptosis via lysosomes MTT assay HT-29 Colorectal Cancer IC50 = 10.44 ± 0.5536 µg/ml
dbacp07745 Longicalycinin A linear analogue 9 FYPFV Synthetic Analogue of Longicalycinin A Cyclization enhances apoptosis via lysosomes MTT assay HepG-2 Liver Cancer 72.74% Cell death at 100 µg/ml
dbacp07746 Longicalycinin A linear analogue 9 FYPFV Synthetic Analogue of Longicalycinin A Cyclization enhances apoptosis via lysosomes MTT assay HT-29 Colorectal Cancer 1.59% Cell death at 100 µg/ml
dbacp07747 Longicalycinin A cyclic analogue 9 FYPFV Synthetic Analogue of Longicalycinin A Cyclization enhances apoptosis via lysosomes MTT assay HepG-2 Liver Cancer IC50 = 10.67 ± 0 µg/ml
dbacp07748 Longicalycinin A cyclic analogue 9 FYPFV Synthetic Analogue of Longicalycinin A Cyclization enhances apoptosis via lysosomes MTT assay HT-29 Colorectal Cancer IC50 = 10.7 ± 0.0056 µg/ml
dbacp07749 Longicalycinin A cyclic analogue 9 FYPFV Synthetic Analogue of Longicalycinin A Cyclization enhances apoptosis via lysosomes MTT assay HepG-2 Liver Cancer 73.98% Cell death at 100 µg/ml
dbacp07750 Longicalycinin A cyclic analogue 9 FYPFV Synthetic Analogue of Longicalycinin A Cyclization enhances apoptosis via lysosomes MTT assay HT-29 Colorectal Cancer 76.25% Cell death at 100 µg/ml
dbacp07751 Longicalycinin A linear analogue 10 FYPFA Synthetic Analogue of Longicalycinin A Cyclization enhances apoptosis via lysosomes MTT assay HepG-2 Liver Cancer IC50 = 10.5 ± 0.0014 µg/ml
dbacp07752 Longicalycinin A linear analogue 10 FYPFA Synthetic Analogue of Longicalycinin A Cyclization enhances apoptosis via lysosomes MTT assay HT-29 Colorectal Cancer IC50 = 10.5 ± 0.0007 µg/ml
dbacp07753 Longicalycinin A linear analogue 10 FYPFA Synthetic Analogue of Longicalycinin A Cyclization enhances apoptosis via lysosomes MTT assay HepG-2 Liver Cancer 76.72% Cell death at 100 µg/ml
dbacp07754 Longicalycinin A linear analogue 10 FYPFA Synthetic Analogue of Longicalycinin A Cyclization enhances apoptosis via lysosomes MTT assay HT-29 Colorectal Cancer 92.09% Cell death at 100 µg/ml
dbacp07755 Longicalycinin A cyclic analogue 10 FYPFA Synthetic Analogue of Longicalycinin A Cyclization enhances apoptosis via lysosomes MTT assay HepG-2 Liver Cancer IC50 = 10.28 ± 0 µg/ml
dbacp07756 Longicalycinin A cyclic analogue 10 FYPFA Synthetic Analogue of Longicalycinin A Cyclization enhances apoptosis via lysosomes MTT assay HT-29 Colorectal Cancer IC50 = 11.56 ± 0.0028 µg/ml
dbacp07757 Longicalycinin A cyclic analogue 10 FYPFA Synthetic Analogue of Longicalycinin A Cyclization enhances apoptosis via lysosomes MTT assay HepG-2 Liver Cancer 72.06% Cell death at 100 µg/ml
dbacp07758 Longicalycinin A cyclic analogue 10 FYPFA Synthetic Analogue of Longicalycinin A Cyclization enhances apoptosis via lysosomes MTT assay HT-29 Colorectal Cancer 71.27% Cell death at 100 µg/ml
dbacp07759 Longicalycinin A linear analogue 11 TVPFA Synthetic Analogue of Longicalycinin A Cyclization enhances apoptosis via lysosomes MTT assay HepG-2 Liver Cancer IC50 = 9.56 ± 0.0021 µg/ml
dbacp07760 Longicalycinin A linear analogue 11 TVPFA Synthetic Analogue of Longicalycinin A Cyclization enhances apoptosis via lysosomes MTT assay HT-29 Colorectal Cancer IC50 = 11.67 ± 0.0014 µg/ml
dbacp07761 Longicalycinin A linear analogue 11 TVPFA Synthetic Analogue of Longicalycinin A Cyclization enhances apoptosis via lysosomes MTT assay HepG-2 Liver Cancer 70.28% Cell death at 100 µg/ml
dbacp07762 Longicalycinin A linear analogue 11 TVPFA Synthetic Analogue of Longicalycinin A Cyclization enhances apoptosis via lysosomes MTT assay HT-29 Colorectal Cancer 88.47% Cell death at 100 µg/ml
dbacp07763 Longicalycinin A cyclic analogue 11 TVPFA Synthetic Analogue of Longicalycinin A Cyclization enhances apoptosis via lysosomes MTT assay HepG-2 Liver Cancer IC50 = 10.36 ± 0 µg/ml
dbacp07764 Longicalycinin A cyclic analogue 11 TVPFA Synthetic Analogue of Longicalycinin A Cyclization enhances apoptosis via lysosomes MTT assay HT-29 Colorectal Cancer IC50 = 10.61 ± 0.0007 µg/ml
dbacp07765 Longicalycinin A cyclic analogue 11 TVPFA Synthetic Analogue of Longicalycinin A Cyclization enhances apoptosis via lysosomes MTT assay HepG-2 Liver Cancer 72.06% Cell death at 100 µg/ml
dbacp07766 Longicalycinin A cyclic analogue 11 TVPFA Synthetic Analogue of Longicalycinin A Cyclization enhances apoptosis via lysosomes MTT assay HT-29 Colorectal Cancer 74.89% Cell death at 100 µg/ml
dbacp07767 Longicalycinin A linear analogue 12 FYPFI Synthetic Analogue of Longicalycinin A Cyclization enhances apoptosis via lysosomes MTT assay HepG-2 Liver Cancer IC50 = 11.32 ± 0.0014 µg/ml
dbacp07768 Longicalycinin A linear analogue 12 FYPFI Synthetic Analogue of Longicalycinin A Cyclization enhances apoptosis via lysosomes MTT assay HT-29 Colorectal Cancer IC50 = 14.2 ± 0.0014 µg/ml
dbacp07769 Longicalycinin A linear analogue 12 FYPFI Synthetic Analogue of Longicalycinin A Cyclization enhances apoptosis via lysosomes MTT assay HepG-2 Liver Cancer 12.06% Cell death at 100 µg/ml
dbacp07770 Longicalycinin A linear analogue 12 FYPFI Synthetic Analogue of Longicalycinin A Cyclization enhances apoptosis via lysosomes MTT assay HT-29 Colorectal Cancer 81.34% Cell death at 100 µg/ml
dbacp07771 Longicalycinin A cyclic analogue 12 FYPFI Synthetic Analogue of Longicalycinin A Cyclization enhances apoptosis via lysosomes MTT assay HepG-2 Liver Cancer IC50 = 12.37 ± 0.0014 µg/ml
dbacp07772 Longicalycinin A cyclic analogue 12 FYPFI Synthetic Analogue of Longicalycinin A Cyclization enhances apoptosis via lysosomes MTT assay HT-29 Colorectal Cancer IC50 = 13.2 ± 0 µg/ml
dbacp07773 Longicalycinin A cyclic analogue 12 FYPFI Synthetic Analogue of Longicalycinin A Cyclization enhances apoptosis via lysosomes MTT assay HepG-2 Liver Cancer 63.84% Cell death at 100 µg/ml
dbacp07774 Longicalycinin A cyclic analogue 12 FYPFI Synthetic Analogue of Longicalycinin A Cyclization enhances apoptosis via lysosomes MTT assay HT-29 Colorectal Cancer 52.72% Cell death at 100 µg/ml
dbacp07775 Longicalycinin A cyclic analogue 15 PYGFV Synthetic Analogue of Longicalycinin A Cyclization enhances apoptosis via lysosomes MTT assay HepG-2 Liver Cancer IC50 = 10.33 ± 0 µg/ml
dbacp07776 Longicalycinin A cyclic analogue 15 PYGFV Synthetic Analogue of Longicalycinin A Cyclization enhances apoptosis via lysosomes MTT assay HT-29 Colorectal Cancer IC50 = 11.23 ± 0.0007 µg/ml
dbacp07777 Longicalycinin A cyclic analogue 15 PYGFV Synthetic Analogue of Longicalycinin A Cyclization enhances apoptosis via lysosomes MTT assay HepG-2 Liver Cancer 52.33% Cell death at 100 µg/ml
dbacp07778 Longicalycinin A cyclic analogue 15 PYGFV Synthetic Analogue of Longicalycinin A Cyclization enhances apoptosis via lysosomes MTT assay HT-29 Colorectal Cancer 27.43% Cell death at 100 µg/ml
dbacp07779 Longicalycinin A linear analogue 16 FTPFV Synthetic Analogue of Longicalycinin A Cyclization enhances apoptosis via lysosomes MTT assay HepG-2 Liver Cancer IC50 = 11.1 ± 0.0007 µg/ml
dbacp07780 Longicalycinin A linear analogue 16 FTPFV Synthetic Analogue of Longicalycinin A Cyclization enhances apoptosis via lysosomes MTT assay HT-29 Colorectal Cancer IC50 = 12.11 ± 0.0056 µg/ml
dbacp07781 Longicalycinin A linear analogue 16 FTPFV Synthetic Analogue of Longicalycinin A Cyclization enhances apoptosis via lysosomes MTT assay HepG-2 Liver Cancer 15.76% Cell death at 100 µg/ml
dbacp07782 Longicalycinin A linear analogue 16 FTPFV Synthetic Analogue of Longicalycinin A Cyclization enhances apoptosis via lysosomes MTT assay HT-29 Colorectal Cancer 88.24% Cell death at 100 µg/ml
dbacp07783 Longicalycinin A cyclic analogue 16 FTPFV Synthetic Analogue of Longicalycinin A Cyclization enhances apoptosis via lysosomes MTT assay HepG-2 Liver Cancer IC50 = 12.1 ± 0.0007 µg/ml
dbacp07784 Longicalycinin A cyclic analogue 16 FTPFV Synthetic Analogue of Longicalycinin A Cyclization enhances apoptosis via lysosomes MTT assay HT-29 Colorectal Cancer IC50 = 10.4 ± 0.0028 µg/ml
dbacp07785 Longicalycinin A cyclic analogue 16 FTPFV Synthetic Analogue of Longicalycinin A Cyclization enhances apoptosis via lysosomes MTT assay HepG-2 Liver Cancer 42.33% Cell death at 100 µg/ml
dbacp07786 Longicalycinin A cyclic analogue 16 FTPFV Synthetic Analogue of Longicalycinin A Cyclization enhances apoptosis via lysosomes MTT assay HT-29 Colorectal Cancer 29.87% Cell death at 100 µg/ml
dbacp07787 Longicalycinin A linear analogue 17 FSPFA Synthetic Analogue of Longicalycinin A Cyclization enhances apoptosis via lysosomes MTT assay HepG-2 Liver Cancer IC50 = 9.33 ± 0.0007 µg/ml
dbacp07788 Longicalycinin A linear analogue 17 FSPFA Synthetic Analogue of Longicalycinin A Cyclization enhances apoptosis via lysosomes MTT assay HT-29 Colorectal Cancer IC50 = 11.33 ± 0.0035 µg/ml
dbacp07789 Longicalycinin A linear analogue 17 FSPFA Synthetic Analogue of Longicalycinin A Cyclization enhances apoptosis via lysosomes MTT assay HepG-2 Liver Cancer 27.54% Cell death at 100 µg/ml
dbacp07790 Longicalycinin A linear analogue 17 FSPFA Synthetic Analogue of Longicalycinin A Cyclization enhances apoptosis via lysosomes MTT assay HT-29 Colorectal Cancer 75.68% Cell death at 100 µg/ml
dbacp07791 Longicalycinin A cyclic analogue 17 FSPFA Synthetic Analogue of Longicalycinin A Cyclization enhances apoptosis via lysosomes MTT assay HepG-2 Liver Cancer IC50 = 9.4 ± 0.0014 µg/ml
dbacp07792 Longicalycinin A cyclic analogue 17 FSPFA Synthetic Analogue of Longicalycinin A Cyclization enhances apoptosis via lysosomes MTT assay HT-29 Colorectal Cancer IC50 = 11.2 ± 0.0007 µg/ml
dbacp07793 Longicalycinin A cyclic analogue 17 FSPFA Synthetic Analogue of Longicalycinin A Cyclization enhances apoptosis via lysosomes MTT assay HepG-2 Liver Cancer 74.53% Cell death at 100 µg/ml
dbacp07794 Longicalycinin A cyclic analogue 17 FSPFA Synthetic Analogue of Longicalycinin A Cyclization enhances apoptosis via lysosomes MTT assay HT-29 Colorectal Cancer 76.14% Cell death at 100 µg/ml
dbacp07795 Longicalycinin A linear analogue 18 FSPAG Synthetic Analogue of Longicalycinin A Cyclization enhances apoptosis via lysosomes MTT assay HepG-2 Liver Cancer IC50 = 10.33 ± 0.0007 µg/ml
dbacp07796 Longicalycinin A linear analogue 18 FSPAG Synthetic Analogue of Longicalycinin A Cyclization enhances apoptosis via lysosomes MTT assay HT-29 Colorectal Cancer IC50 = 10.2 ± 0.0014 µg/ml
dbacp07797 Longicalycinin A linear analogue 18 FSPAG Synthetic Analogue of Longicalycinin A Cyclization enhances apoptosis via lysosomes MTT assay HepG-2 Liver Cancer 15.55% Cell death at 100 µg/ml
dbacp07798 Longicalycinin A linear analogue 18 FSPAG Synthetic Analogue of Longicalycinin A Cyclization enhances apoptosis via lysosomes MTT assay HT-29 Colorectal Cancer 56.51% Cell death at 100 µg/ml
dbacp07799 Longicalycinin A cyclic analogue 18 FSPAG Synthetic Analogue of Longicalycinin A Cyclization enhances apoptosis via lysosomes MTT assay HepG-2 Liver Cancer IC50 = 9.68 ± 0.0014 µg/ml
dbacp07800 Longicalycinin A cyclic analogue 18 FSPAG Synthetic Analogue of Longicalycinin A Cyclization enhances apoptosis via lysosomes MTT assay HT-29 Colorectal Cancer IC50 = 9.06 ± 0.0014 µg/ml
dbacp07801 Longicalycinin A cyclic analogue 18 FSPAG Synthetic Analogue of Longicalycinin A Cyclization enhances apoptosis via lysosomes MTT assay HepG-2 Liver Cancer 46.58% Cell death at 100 µg/ml
dbacp07802 Longicalycinin A cyclic analogue 18 FSPAG Synthetic Analogue of Longicalycinin A Cyclization enhances apoptosis via lysosomes MTT assay HT-29 Colon Cancer 22.8% Cell death at 100 µg/ml
dbacp07848 Carnosine (Beta-A)H Muscular and Nervous tissues of vertebrates Inhibits VEGFR-2 angiogenic signaling MTT assay MGH-U1 (EJ) Bladder Cancer IC50 = 50 mM
dbacp07849 Dermaseptin-PT9 GLWSKIKDAAKTAGKAALGFVNEMV Phyllomedusa tarsius Membrane disruption and cationic enhancement MTT assay MCF-7 Breast Cancer IC50 = 7.44 µM
dbacp07850 Dermaseptin-PT9 GLWSKIKDAAKTAGKAALGFVNEMV Phyllomedusa tarsius Membrane disruption and cationic enhancement MTT assay U251-MG Brain Tumor IC50 = 49.51 µM
dbacp07851 Dermaseptin-PT9 GLWSKIKDAAKTAGKAALGFVNEMV Phyllomedusa tarsius Membrane disruption and cationic enhancement MTT assay H-157 Lung Cancer IC50 = 25.51 µM
dbacp07852 Dermaseptin-PT9 GLWSKIKDAAKTAGKAALGFVNEMV Phyllomedusa tarsius Membrane disruption and cationic enhancement MTT assay PC-3 Prostate Cancer IC50 = 21.78 µM
dbacp07853 Dermaseptin-PT9 GLWSKIKDAAKTAGKAALGFVNEMV Phyllomedusa tarsius Membrane disruption and cationic enhancement MTT assay PANC-1 Pancreatic Cancer IC50 = 28.95 µM
dbacp07854 K8, 23-DPT9 GLWSKIKKAAKTAGKAALGFVNKMV Synthetic Membrane disruption and cationic enhancement MTT assay MCF-7 Breast Cancer IC50 = 8.64 µM
dbacp07855 K8, 23-DPT9 GLWSKIKKAAKTAGKAALGFVNKMV Synthetic Membrane disruption and cationic enhancement MTT assay U251-MG Brain Tumor IC50 = 18.51 µM
dbacp07856 K8, 23-DPT9 GLWSKIKKAAKTAGKAALGFVNKMV Synthetic Membrane disruption and cationic enhancement MTT assay H-157 Lung Cancer IC50 = 9.88 µM
dbacp07857 K8, 23-DPT9 GLWSKIKKAAKTAGKAALGFVNKMV Synthetic Membrane disruption and cationic enhancement MTT assay PC-3 Prostate Cancer IC50 = 9.97 µM
dbacp07858 K8, 23-DPT9 GLWSKIKKAAKTAGKAALGFVNKMV Synthetic Membrane disruption and cationic enhancement MTT assay PANC-1 Pancreatic Cancer IC50 = 11.17 µM
dbacp07859 HN-1 FALGAVTKLLPSLLCMITRKC Amolops hainanensis Apoptosis induction and immune activation MTT assay MCF-7 Breast Cancer IC50 = 6.9 μM
dbacp07860 HN-1 FALGAVTKLLPSLLCMITRKC Amolops hainanensis Apoptosis induction and immune activation MTT assay A-549 Lung Cancer Not Available
dbacp07861 HN-1 FALGAVTKLLPSLLCMITRKC Amolops hainanensis Apoptosis induction and immune activation MTT assay SGC-7901 Stomach Cancer Not Available
dbacp07862 HN-1 FALGAVTKLLPSLLCMITRKC Amolops hainanensis Apoptosis induction and immune activation MTT assay MDA-MB-453 Breast Cancer Not Available
dbacp07863 HN-1 FALGAVTKLLPSLLCMITRKC Amolops hainanensis Apoptosis induction and immune activation MTT assay PC-3 Prostate Cancer Not Available
dbacp07864 HN-1 FALGAVTKLLPSLLCMITRKC Amolops hainanensis Apoptosis induction and immune activation MTT assay 4T1 Breast Cancer Not Available
dbacp07879 Nubein6.8 LKCNQLIPPFWKTCPKGKNLCYKMTMRAAPMVPVKRGCIDVCPKSSLLIKYMCCNTDKCN Naja nubiae DNA damage and apoptosis induction MTT assay A-375 Skin Cancer EC50 = 0.54 ± 0.04 μM
dbacp07880 Nubein6.8 LKCNQLIPPFWKTCPKGKNLCYKMTMRAAPMVPVKRGCIDVCPKSSLLIKYMCCNTDKCN Naja nubiae DNA damage and apoptosis induction MTT assay A-2780 Ovarian Cancer EC50 = 1.249 ± 0.06 μM
dbacp07881 Nubein6.8 LKCNQLIPPFWKTCPKGKNLCYKMTMRAAPMVPVKRGCIDVCPKSSLLIKYMCCNTDKCN Naja nubiae DNA damage and apoptosis induction MTT assay PANC-1 Pancreatic Cancer slight toxicity above 3.7 μM
dbacp07887 ICD-85 Not Available Active fractions from Gloydius halys and Hemiscorpius lepturus Caspase-9 mediated apoptotic death MTT assay MCF-7 Breast Cancer IC50 = 36.45 ± 0.38 μg/mL
dbacp07889 H-58 IKLSKKTKKNLKKVLKGS5IKGS5IAVAKMV Synthetic Cell entry, DNA damage, apoptosis. MTT assay A-549 Lung Cancer IC50 = 0.62 ± 0.12 μM
dbacp07890 H-58 IKLSKKTKKNLKKVLKGS5IKGS5IAVAKMV Synthetic Cell entry, DNA damage, apoptosis. MTT assay HCT-116 Colon Cancer IC50 = 1.29 ± 0.08 μM
dbacp07891 H-58 IKLSKKTKKNLKKVLKGS5IKGS5IAVAKMV Synthetic Cell entry, DNA damage, apoptosis. MTT assay HepG-2 Liver Cancer IC50 = 2.13 ± 0.07 μM
dbacp07892 H-57 IKLSKKTKKNLKKVLKGS5IKGS5IAVAKMV Synthetic Cell entry, DNA damage, apoptosis. MTT assay A-549 Lung Cancer IC50 = 0.62 ± 0.12 μM
dbacp07893 H-57 IKLSKKTKKNLKKVLKGS5IKGS5IAVAKMV Synthetic Cell entry, DNA damage, apoptosis. MTT assay HCT-116 Colon Cancer IC50 = 1.29 ± 0.08 μM
dbacp07894 H-57 IKLSKKTKKNLKKVLKGS5IKGS5IAVAKMV Synthetic Cell entry, DNA damage, apoptosis. MTT assay HepG-2 Liver Cancer IC50 = 2.13 ± 0.07 μM
dbacp07895 H-18 IKLSKKTKKNLKKVLKGS5IKGS5IAVAKMV Synthetic Cell entry, DNA damage, apoptosis. MTT assay A-549 Lung Cancer IC50 = 0.89 ± 0.21 μM
dbacp07896 H-18 IKLSKKTKKNLKKVLKGS5IKGS5IAVAKMV Synthetic Cell entry, DNA damage, apoptosis. MTT assay HCT-116 Colon Cancer IC50 = 1.11 ± 0.21 μM
dbacp07897 H-18 IKLSKKTKKNLKKVLKGS5IKGS5IAVAKMV Synthetic Cell entry, DNA damage, apoptosis. MTT assay HepG-2 Liver Cancer IC50 = 1.61 ± 0.21 μM
dbacp07898 H-21 IKLSKS5TKKS5LKKVLKGS5IKGS5IAVAKMV Synthetic Cell entry, DNA damage, apoptosis. MTT assay A-549 Lung Cancer IC50 = 3.26 ± 0.36 μM
dbacp07899 H-21 IKLSKS5TKKS5LKKVLKGS5IKGS5IAVAKMV Synthetic Cell entry, DNA damage, apoptosis. MTT assay HCT-116 Colon Cancer IC50 = 3.05 ± 0.21 μM
dbacp07900 H-21 IKLSKS5TKKS5LKKVLKGS5IKGS5IAVAKMV Synthetic Cell entry, DNA damage, apoptosis. MTT assay HepG-2 Liver Cancer IC50 = 1.50 ± 0.28 μM
dbacp07901 H-20 IKLSPS5TKKS5LKKVLKGS5IKGS5IAVAKMV Synthetic Cell entry, DNA damage, apoptosis. MTT assay A-549 Lung Cancer IC50 = 2.10 ± 0.32 μM
dbacp07902 H-20 IKLSPS5TKKS5LKKVLKGS5IKGS5IAVAKMV Synthetic Cell entry, DNA damage, apoptosis. MTT assay HCT-116 Colon Cancer IC50 = 2.63 ± 0.35 μM
dbacp07903 H-20 IKLSPS5TKKS5LKKVLKGS5IKGS5IAVAKMV Synthetic Cell entry, DNA damage, apoptosis. MTT assay HepG-2 Liver Cancer IC50 = 4.93 ± 0.53 μM
dbacp07904 H-19 IKLSKETKKNLKKVLKGS5IKGS5IAVAKMV Synthetic Cell entry, DNA damage, apoptosis. MTT assay A-549 Lung Cancer IC50 = 1.00 ± 0.36 μM
dbacp07905 H-19 IKLSKETKKNLKKVLKGS5IKGS5IAVAKMV Synthetic Cell entry, DNA damage, apoptosis. MTT assay HCT-116 Colon Cancer IC50 = 1.78 ± 0.35 μM
dbacp07906 H-19 IKLSKETKKNLKKVLKGS5IKGS5IAVAKMV Synthetic Cell entry, DNA damage, apoptosis. MTT assay HepG-2 Liver Cancer IC50 = 1.64 ± 0.36 μM
dbacp07907 H-17 IKLSKS5TKKS5LKKVLKGAIKGAIAVAKMV Synthetic Cell entry, DNA damage, apoptosis. MTT assay A-549 Lung Cancer IC50 = 0.96 ± 0.33 μM
dbacp07908 H-17 IKLSKS5TKKS5LKKVLKGAIKGAIAVAKMV Synthetic Cell entry, DNA damage, apoptosis. MTT assay HCT-116 Colon Cancer IC50 = 1.49 ± 0.45 μM
dbacp07909 H-17 IKLSKS5TKKS5LKKVLKGAIKGAIAVAKMV Synthetic Cell entry, DNA damage, apoptosis. MTT assay HepG-2 Liver Cancer IC50 = 1.64 ± 0.47 μM
dbacp07910 H-16 IKLSPS5TKKS5LKKVLKGAIKGAIAVAKMV Synthetic Cell entry, DNA damage, apoptosis. MTT assay A-549 Lung Cancer IC50 = 1.85 ± 0.31 μM
dbacp07911 H-16 IKLSPS5TKKS5LKKVLKGAIKGAIAVAKMV Synthetic Cell entry, DNA damage, apoptosis. MTT assay HCT-116 Colon Cancer IC50 = 2.65 ± 0.35 μM
dbacp07912 H-16 IKLSPS5TKKS5LKKVLKGAIKGAIAVAKMV Synthetic Cell entry, DNA damage, apoptosis. MTT assay HepG-2 Liver Cancer IC50 = 3.14 ± 0.46 μM
dbacp07913 H-15 IKLSKS5TKDS5LKKVLKGAIKGAIAVAKMV Synthetic Cell entry, DNA damage, apoptosis. MTT assay A-549 Lung Cancer IC50 = 2.26 ± 0.24 μM
dbacp07914 H-15 IKLSKS5TKDS5LKKVLKGAIKGAIAVAKMV Synthetic Cell entry, DNA damage, apoptosis. MTT assay HCT-116 Colon Cancer IC50 = 2.95 ± 0.25 μM
dbacp07915 H-15 IKLSKS5TKDS5LKKVLKGAIKGAIAVAKMV Synthetic Cell entry, DNA damage, apoptosis. MTT assay HepG-2 Liver Cancer IC50 = 2.20 ± 0.27 μM
dbacp07916 H-10 IKLSPS5TKDS5LKKVLKGS5IKGS5IAVAKMV Synthetic Cell entry, DNA damage, apoptosis. MTT assay A-549 Lung Cancer IC50 = 3.59 ± 0.12 μM
dbacp07917 H-10 IKLSPS5TKDS5LKKVLKGS5IKGS5IAVAKMV Synthetic Cell entry, DNA damage, apoptosis. MTT assay HCT-116 Colon Cancer IC50 = 3.51 ± 0.37 μM
dbacp07918 H-10 IKLSPS5TKDS5LKKVLKGS5IKGS5IAVAKMV Synthetic Cell entry, DNA damage, apoptosis. MTT assay HepG-2 Liver Cancer IC50 = 1.50 ± 0.21 μM
dbacp07919 H-5 IKLSPETKDNLKKVLKGS5IKGS5IAVAKMV Synthetic Cell entry, DNA damage, apoptosis. MTT assay A-549 Lung Cancer IC50 = 7.35 ± 0.22 μM
dbacp07920 H-5 IKLSPETKDNLKKVLKGS5IKGS5IAVAKMV Synthetic Cell entry, DNA damage, apoptosis. MTT assay HCT-116 Colon Cancer IC50 = 4.16 ± 0.21 μM
dbacp07921 H-5 IKLSPETKDNLKKVLKGS5IKGS5IAVAKMV Synthetic Cell entry, DNA damage, apoptosis. MTT assay HepG-2 Liver Cancer IC50 = 2.82 ± 0.23 μM
dbacp07922 H-2 IKLSPS5TKDS5LKKVLKGAIKGAIAVAKMV Synthetic Cell entry, DNA damage, apoptosis. MTT assay A-549 Lung Cancer IC50 = 4.26 ± 0.52 μM
dbacp07923 H-2 IKLSPS5TKDS5LKKVLKGAIKGAIAVAKMV Synthetic Cell entry, DNA damage, apoptosis. MTT assay HCT-116 Colon Cancer IC50 = 3.54 ± 0.72 μM
dbacp07924 H-2 IKLSPS5TKDS5LKKVLKGAIKGAIAVAKMV Synthetic Cell entry, DNA damage, apoptosis. MTT assay HepG-2 Liver Cancer IC50 = 1.60 ± 0.24 μM
dbacp07925 oligopeptide 1 AGAPGG Sarcophyton glaucum Selective cytotoxicity, DNA damage, apoptosis MTT assay HeLa Cervical Cancer EC50 = 8.6 mmol/L
dbacp07926 Phylloseptin-PBa3 FLSLIPHIVSGVAALANHL Phyllomedusa burmeisteri Membrane disruption, apoptosis, selective cytotoxicity MTT assay MDA-MB-435S Breast Cancer IC50 = 208 µM
dbacp07927 Phylloseptin-PBa3 FLSLIPHIVSGVAALANHL Phyllomedusa burmeisteri Membrane disruption, apoptosis, selective cytotoxicity MTT assay H-838 Lung Cancer Cell viability ~ 65% at 10-5 M
dbacp07931 myristoyl-CM4 GRWKIFKKIEKVGQNIRDGIVKAGPAVAVVGQAATI Bombyx mori Cell penetration, Mitochondrial dysfunction, Apoptosis pathway activation MTT assay MCF-7 Breast cancer IC50 = 6 μM
dbacp07932 myristoyl-CM4 GRWKIFKKIEKVGQNIRDGIVKAGPAVAVVGQAATI Bombyx mori Enhanced binding, mitochondrial dysfunction, apoptosis MTT assay MDA-MB-231 Breast cancer IC50 = 4 μM
dbacp07933 myristoyl-CM4 GRWKIFKKIEKVGQNIRDGIVKAGPAVAVVGQAATI Bombyx mori Enhanced binding, mitochondrial dysfunction, apoptosis MTT assay MX-1 Breast cancer IC50 = 3 μM
dbacp07943 TC22 MTVVLLLIVLPLLGGVHSSGIL Tribolium castaneum ROS, p53, mitochondrial apoptosis activation MTT assay HeLa Cervical Cancer Fig 4a
dbacp07944 TC22 MTVVLLLIVLPLLGGVHSSGIL Tribolium castaneum ROS, p53, mitochondrial apoptosis activation MTT assay MCF-7 Breast Cancer Fig 4a
dbacp07945 Emericellipsin A (3-MeP)-(AHMOD)-A-Aib-IV-beta-A-N-(2-Hydroxyethyl)-1,2-propanediamine Emericellopsis alkalina Membrane disruption, antifungal, antibacterial, anticancer MTT assay HepG-2 Liver Cancer EC50 = 2.8 uM
dbacp07946 Emericellipsin A (3-MeP)-(AHMOD)-A-Aib-IV-beta-A-N-(2-Hydroxyethyl)-1,2-propanediamine Emericellopsis alkalina Membrane disruption, antifungal, antibacterial, anticancer MTT assay HeLa Cervical Cancer EC50 < 0.5 uM
dbacp07947 IL13Rα2 D1 peptide GSETWKTIITKN Synthetic IL13Rα2 blockade inhibits cancer metastasis MTT assay KM12SM Colorectal Cancer inhibited IL13-stimulated cell adhesion
dbacp07948 IL13Rα2 D1 peptide GSETWKTIITKN Synthetic IL13Rα2 blockade inhibits cancer metastasis MTT assay SW-620 Colorectal Cancer inhibited IL13-stimulated cell adhesion
dbacp07949 IL13Rα2 D1 peptide GSETWKTIITKN Synthetic IL13Rα2 blockade inhibits cancer metastasis MTT assay U-87 Brain Cancer inhibited IL13-stimulated cell adhesion
dbacp07950 IL13Rα2 D1 peptide GSETWKTIITKN Synthetic IL13Rα2 blockade inhibits cancer metastasis MTT assay U-118 Brain Cancer inhibited IL13-stimulated cell adhesion
dbacp07951 S-24-R2PLx GIMDTVKNAAKNLAGQLLDKLKCSITAC Synthetic Analogue of Ranatuerin-2PLx R2PLx induces caspase-dependent apoptosis MTT assay PC-3 Prostate Cancer IC50 = 792.60 µM
dbacp07952 S-24-R2PLx GIMDTVKNAAKNLAGQLLDKLKCSITAC Synthetic Analogue of Ranatuerin-2PLx R2PLx induces caspase-dependent apoptosis MTT assay H-157 Lung Cancer IC50 = 58.18 µM
dbacp07953 S-24-R2PLx GIMDTVKNAAKNLAGQLLDKLKCSITAC Synthetic Analogue of Ranatuerin-2PLx R2PLx induces caspase-dependent apoptosis MTT assay MDA-MB-435S Skin Cancer IC50 = 179.00 µM
dbacp07954 S-24-R2PLx GIMDTVKNAAKNLAGQLLDKLKCSITAC Synthetic Analogue of Ranatuerin-2PLx R2PLx induces caspase-dependent apoptosis MTT assay U-251-MG Brain Tumor IC50 = 278.30 µM
dbacp07955 S-24-R2PLx GIMDTVKNAAKNLAGQLLDKLKCSITAC Synthetic Analogue of Ranatuerin-2PLx R2PLx induces caspase-dependent apoptosis MTT assay MCF-7 Breast Cancer IC50 = 316.90 µM
dbacp07956 DP-2 GRKKRRQRRRGALWKSLLKNVGKA Synthetic DRS-DU-1 induces selective tumor cytotoxicity MTT assay H-157 Lung Cancer IC50 = 3.21 μM
dbacp07957 DP-2 GRKKRRQRRRGALWKSLLKNVGKA Synthetic DRS-DU-1 induces selective tumor cytotoxicity MTT assay PC-3 Prostate Cancer IC50 = 6.75 μM
dbacp07989 K5, 17-DPS3 ALWKKILKNAGKAALNKINQIVQ Analogue of Dermaseptin-PS3 Enhanced cationicity/hydrophobicity increases cytotoxicity MTT assay H-157 Lung Cancer IC50 = 18.20 μM
dbacp07990 K5, 17-DPS3 ALWKKILKNAGKAALNKINQIVQ Analogue of Dermaseptin-PS3 Enhanced cationicity/hydrophobicity increases cytotoxicity MTT assay PC-3 Prostate Cancer IC50 = 18.20 μM
dbacp07991 L10, 11-DPS3 ALWKDILKNLLKAALNEINQIVQ Analogue of Dermaseptin-PS3 Enhanced cationicity/hydrophobicity increases cytotoxicity MTT assay H-157 Lung Cancer IC50 = 0.12 μM
dbacp07992 L10, 11-DPS3 ALWKDILKNLLKAALNEINQIVQ Analogue of Dermaseptin-PS3 Enhanced cationicity/hydrophobicity increases cytotoxicity MTT assay PC-3 Prostate Cancer IC50 = 1.85 μM
dbacp07993 [G10a]SHa FLSGIVGMLaKLF Synthetic analogue of Temporin-1SHa Enhanced cationicity/hydrophobicity increases cytotoxicity MTT assay MCF-7 Breast Cancer IC50 = 16.2 ± 2.2 µM
dbacp07994 [G10a]SHa FLSGIVGMLaKLF Synthetic analogue of Temporin-1SHa Enhanced cationicity/hydrophobicity increases cytotoxicity MTT assay HeLa Cervical Cancer IC50 = 22.7 ± 0.86 µM
dbacp07995 [G10a]SHa FLSGIVGMLaKLF Synthetic analogue of Temporin-1SHa Enhanced cationicity/hydrophobicity increases cytotoxicity MTT assay NCI-H-460 Lung Cancer IC50 =24.3 ± 0.8 µM
dbacp07996 [G10a]SHa-BCTP FLSGIVGMLaKLFLFKQYAELW Synthetic analogue of Temporin-1SHa Enhanced cationicity/hydrophobicity increases cytotoxicity MTT assay MCF-7 Breast Cancer IC50 = 26.85 ± 1.85 µM
dbacp07997 [G10a]SHa-BCTP FLSGIVGMLaKLFLFKQYAELW Synthetic analogue of Temporin-1SHa Enhanced cationicity/hydrophobicity increases cytotoxicity MTT assay HeLa Cervical Cancer IC50 >100 µM
dbacp07998 [G10a]SHa-BCTP FLSGIVGMLaKLFLFKQYAELW Synthetic analogue of Temporin-1SHa Enhanced cationicity/hydrophobicity increases cytotoxicity MTT assay NCI-H-460 Lung Cancer IC50 >100 µM
dbacp07999 [G4a]SHa FLSaIVGMLGKLF Synthetic analogue of Temporin-1SHa Enhanced cationicity/hydrophobicity increases cytotoxicity MTT assay MCF-7 Breast Cancer IC50 = 17.9 ± 1.1 µM
dbacp08000 [G4a]SHa FLSaIVGMLGKLF Synthetic analogue of Temporin-1SHa Enhanced cationicity/hydrophobicity increases cytotoxicity MTT assay HeLa Cervical Cancer IC50 >100 µM
dbacp08001 [G4a]SHa FLSaIVGMLGKLF Synthetic analogue of Temporin-1SHa Enhanced cationicity/hydrophobicity increases cytotoxicity MTT assay NCI-H-460 Lung Cancer IC50 >100 µM
dbacp08002 [G7a]SHa FLSGIVaMLGKLF Synthetic analogue of Temporin-1SHa Enhanced cationicity/hydrophobicity increases cytotoxicity MTT assay MCF-7 Breast Cancer IC50 =22.4 ± 2.2 µM
dbacp08003 [G7a]SHa FLSGIVaMLGKLF Synthetic analogue of Temporin-1SHa Enhanced cationicity/hydrophobicity increases cytotoxicity MTT assay HeLa Cervical Cancer IC50 >100 µM
dbacp08004 [G7a]SHa FLSGIVaMLGKLF Synthetic analogue of Temporin-1SHa Enhanced cationicity/hydrophobicity increases cytotoxicity MTT assay NCI-H-460 Lung Cancer IC50 >100 µM
dbacp08005 [G4,7a]SHa FLSaIVaMLGKLF Synthetic analogue of Temporin-1SHa Enhanced cationicity/hydrophobicity increases cytotoxicity MTT assay MCF-7 Breast Cancer IC50 = 29.5 ± 6.03 µM
dbacp08006 [G4,7a]SHa FLSaIVaMLGKLF Synthetic analogue of Temporin-1SHa Enhanced cationicity/hydrophobicity increases cytotoxicity MTT assay HeLa Cervical Cancer IC50 >100 µM
dbacp08007 [G4,7a]SHa FLSaIVaMLGKLF Synthetic analogue of Temporin-1SHa Enhanced cationicity/hydrophobicity increases cytotoxicity MTT assay NCI-H-460 Lung Cancer IC50 = 37.3 ± 3.5 µM
dbacp08008 [G4,7,10a]SHa FLSaIVaMLaKLF Synthetic analogue of Temporin-1SHa Enhanced cationicity/hydrophobicity increases cytotoxicity MTT assay MCF-7 Breast Cancer IC50 = 26.33 ± 5.8 µM
dbacp08009 [G4,7,10a]SHa FLSaIVaMLaKLF Synthetic analogue of Temporin-1SHa Enhanced cationicity/hydrophobicity increases cytotoxicity MTT assay HeLa Cervical Cancer IC50 >100 µM
dbacp08010 [G4,7,10a]SHa FLSaIVaMLaKLF Synthetic analogue of Temporin-1SHa Enhanced cationicity/hydrophobicity increases cytotoxicity MTT assay NCI-H-460 Lung Cancer IC50 >100 µM
dbacp08011 [G7,10a]SHa FLSGIVaMLaKLF Synthetic analogue of Temporin-1SHa Enhanced cationicity/hydrophobicity increases cytotoxicity MTT assay MCF-7 Breast Cancer IC50 = 21.3 ± 1.13 µM
dbacp08012 [G7,10a]SHa FLSGIVaMLaKLF Synthetic analogue of Temporin-1SHa Enhanced cationicity/hydrophobicity increases cytotoxicity MTT assay HeLa Cervical Cancer IC50 >100 µM
dbacp08013 [G7,10a]SHa FLSGIVaMLaKLF Synthetic analogue of Temporin-1SHa Enhanced cationicity/hydrophobicity increases cytotoxicity MTT assay NCI-H-460 Lung Cancer IC50 >100 µM
dbacp08018 Peptide4 Gonearrestide ADAPGNYPLDARGKSYYC Androctonus australis Gonearrestide induces G1 cell-cycle arrest MTT assay HCT-116 Colon Cancer Not Available
dbacp08019 Peptide4 Gonearrestide ADAPGNYPLDARGKSYYC Androctonus australis Gonearrestide induces G1 cell-cycle arrest MTT assay DLD-1 Colon Cancer Not Available
dbacp08020 Peptide4 Gonearrestide ADAPGNYPLDARGKSYYC Androctonus australis Gonearrestide induces G1 cell-cycle arrest MTT assay HKe-3 Colon Cancer Not Available
dbacp08021 Peptide4 Gonearrestide ADAPGNYPLDARGKSYYC Androctonus australis Gonearrestide induces G1 cell-cycle arrest MTT assay Dks8 Colon Cancer Not Available
dbacp08022 Peptide4 Gonearrestide ADAPGNYPLDARGKSYYC Androctonus australis Gonearrestide induces G1 cell-cycle arrest MTT assay U-251 Brain tumor Not Available
dbacp08023 Peptide6 Gonearrestide KLSAIISKIRDE Androctonus australis Gonearrestide induces G1 cell-cycle arrest MTT assay HCT-116 Colon Cancer Not Available
dbacp08024 Peptide6 Gonearrestide KLSAIISKIRDE Androctonus australis Gonearrestide induces G1 cell-cycle arrest MTT assay DLD-1 Colon Cancer Not Available
dbacp08025 Peptide6 Gonearrestide KLSAIISKIRDE Androctonus australis Gonearrestide induces G1 cell-cycle arrest MTT assay HKe-3 Colon Cancer Not Available
dbacp08026 Peptide6 Gonearrestide KLSAIISKIRDE Androctonus australis Gonearrestide induces G1 cell-cycle arrest MTT assay Dks8 Colon Cancer Not Available
dbacp08027 Peptide6 Gonearrestide KLSAIISKIRDE Androctonus australis Gonearrestide induces G1 cell-cycle arrest MTT assay U-251 Brain tumor Not Available
dbacp08028 Peptide10 Gonearrestide NDADKDEMQSVYRGKANDDNSRGSKTNHRF Androctonus mauritanicus Gonearrestide induces G1 cell-cycle arrest MTT assay HCT-116 Colon Cancer Not Available
dbacp08029 Peptide10 Gonearrestide NDADKDEMQSVYRGKANDDNSRGSKTNHRF Androctonus mauritanicus Gonearrestide induces G1 cell-cycle arrest MTT assay DLD-1 Colon Cancer Not Available
dbacp08030 Peptide10 Gonearrestide NDADKDEMQSVYRGKANDDNSRGSKTNHRF Androctonus mauritanicus Gonearrestide induces G1 cell-cycle arrest MTT assay HKe-3 Colon Cancer Not Available
dbacp08031 Peptide10 Gonearrestide NDADKDEMQSVYRGKANDDNSRGSKTNHRF Androctonus mauritanicus Gonearrestide induces G1 cell-cycle arrest MTT assay Dks8 Colon Cancer Not Available
dbacp08032 Peptide10 Gonearrestide NDADKDEMQSVYRGKANDDNSRGSKTNHRF Androctonus mauritanicus Gonearrestide induces G1 cell-cycle arrest MTT assay U-251 Brain tumor Not Available
dbacp08033 Peptide13 Gonearrestide WCYKLPDRVSIKEKGRCN Androctonus mauritanicus Gonearrestide induces G1 cell-cycle arrest MTT assay HCT-116 Colon Cancer IC50 ~ 100 μM/L
dbacp08034 Peptide13 Gonearrestide WCYKLPDRVSIKEKGRCN Androctonus mauritanicus Gonearrestide induces G1 cell-cycle arrest MTT assay DLD-1 Colon Cancer Not Available
dbacp08035 Peptide13 Gonearrestide WCYKLPDRVSIKEKGRCN Androctonus mauritanicus Gonearrestide induces G1 cell-cycle arrest MTT assay HKe-3 Colon Cancer Not Available
dbacp08036 Peptide13 Gonearrestide WCYKLPDRVSIKEKGRCN Androctonus mauritanicus Gonearrestide induces G1 cell-cycle arrest MTT assay Dks8 Colon Cancer Not Available
dbacp08037 Peptide13 Gonearrestide WCYKLPDRVSIKEKGRCN Androctonus mauritanicus Gonearrestide induces G1 cell-cycle arrest MTT assay U-251 Brain tumor Not Available
dbacp08038 Silk Fibroin peptide Not Available Silkworm Cocoons SFP induces S-phase cell-cycle arrest MTT assay A-549 Lung Cancer IC50 = 9.921 ± 0.82 mg/ml
dbacp08039 Silk Fibroin peptide Not Available Silkworm Cocoons SFP induces S-phase cell-cycle arrest MTT assay H-460 Lung Cancer IC50 = 9.083 ± 1.22 mg/ml
dbacp08040 Silk Fibroin peptide Not Available Silkworm Cocoons SFP induces S-phase cell-cycle arrest MTT assay SW-1990 Pancreatic Cancer IC50 = 8.005 ± 1.34 mg/ml
dbacp08041 Silk Fibroin peptide Not Available Silkworm Cocoons SFP induces S-phase cell-cycle arrest MTT assay PANC-1 Pancreatic Cancer IC50 = 8.224 ± 1.43 mg/ml
dbacp08042 Silk Fibroin peptide Not Available Silkworm Cocoons SFP induces S-phase cell-cycle arrest MTT assay PC-9 Lung Cancer IC50 = 7.921 ± 1.19 mg/ml
dbacp08043 Silk Fibroin peptide Not Available Silkworm Cocoons SFP induces S-phase cell-cycle arrest MTT assay HT-29 Colon Cancer IC50 = 11.55 ± 3.33 mg/ml
dbacp08044 Silk Fibroin peptide Not Available Silkworm Cocoons SFP induces S-phase cell-cycle arrest MTT assay LN229 Brain Tumor IC50 = 13.32 ± 1.15 mg/ml
dbacp08064 Temporin-PE FLPIVAKLLSGLL Pelophylax kl. esculentus Modulates membrane interactions MTT assay NCI-H-157 Lung Cancer IC50 = 34.56 μM
dbacp08065 Temporin-PE FLPIVAKLLSGLL Pelophylax kl. esculentus Modulates membrane interactions MTT assay U251-MG Brain Tumor IC50 = 25.13 μM
dbacp08066 Temporin-PE FLPIVAKLLSGLL Pelophylax kl. esculentus Modulates membrane interactions MTT assay PC-3 Prostate Cancer IC50 = 38.56 μM
dbacp08067 Temporin-PE FLPIVAKLLSGLL Pelophylax kl. esculentus Modulates membrane interactions MTT assay MDA-MB-435S Skin Cancer IC50 = 33.23 μM
dbacp08068 temporin-PEa FLYIVAKLLSGLL Synthetic analog of Temporin-PE Modulates membrane interactions MTT assay NCI-H-157 Lung Cancer IC50 = 3.398 μM
dbacp08069 temporin-PEa FLYIVAKLLSGLL Synthetic analog of Temporin-PE Modulates membrane interactions MTT assay U251-MG Brain Tumor IC50 = 3.520 μM
dbacp08070 temporin-PEa FLYIVAKLLSGLL Synthetic analog of Temporin-PE Modulates membrane interactions MTT assay PC-3 Prostate Cancer IC50 = 27.62 μM
dbacp08071 temporin-PEa FLYIVAKLLSGLL Synthetic analog of Temporin-PE Modulates membrane interactions MTT assay MDA-MB-435S Skin Cancer IC50 = 9.864 μM
dbacp08072 temporin-PEb FLPIVAKLLSGLLGRKKRRQRRR Synthetic analog of Temporin-PE Modulates membrane interactions MTT assay NCI-H-157 Lung Cancer IC50 = 3.464 μM
dbacp08073 temporin-PEb FLPIVAKLLSGLLGRKKRRQRRR Synthetic analog of Temporin-PE Modulates membrane interactions MTT assay U251-MG Brain Tumor IC50 = 3.087 μM
dbacp08074 temporin-PEb FLPIVAKLLSGLLGRKKRRQRRR Synthetic analog of Temporin-PE Modulates membrane interactions MTT assay PC-3 Prostate Cancer IC50 = 3.051 μM
dbacp08075 temporin-PEb FLPIVAKLLSGLLGRKKRRQRRR Synthetic analog of Temporin-PE Modulates membrane interactions MTT assay MDA-MB-435S Skin Cancer IC50 = 3.483 μM
dbacp08076 PvD1 KTCENLADTYKGPCFTTGSCDDHCKNKEHLRSGRCRDDFRCWCTKNC Phaseolus vulgaris Disrupts tumor cells MTT assay HBMEC Brain Cancer Not Available
dbacp08077 PvD1 KTCENLADTYKGPCFTTGSCDDHCKNKEHLRSGRCRDDFRCWCTKNC Phaseolus vulgaris Disrupts tumor cells MTT assay MDA-MB-231 Breast Cancer IC50 = 0.82 ± 0.14 µM
dbacp08081 Peptide 3a YD Synthetic Inhibit COX-2 enzyme MTT assay MCF-7 Breast Cancer IC50 = 17.5 ± 0.04 µM
dbacp08082 Peptide 3a YD Synthetic Inhibit COX-2 enzyme MTT assay HepG-2 Liver Cancer IC50 = 4.8 ± 0.12 µM
dbacp08083 Peptide 3a YD Synthetic Inhibit COX-2 enzyme MTT assay A-549 Lung Cancer IC50 = 5.7 ± 0.04 µM
dbacp08084 Peptide 3b YD Synthetic Inhibit COX-2 enzyme MTT assay HepG-2 Liver Cancer IC50 = 62.3 ± 0.02 µM
dbacp08085 Peptide 3b YD Synthetic Inhibit COX-2 enzyme MTT assay A-549 Lung Cancer IC50 = 5.8 ± 0.02 µM
dbacp08086 L-K6 IKKILSKIKKLLK Temporin 1CEb analogue L-K6 binds, internalizes, damages nucleus MTT assay MCF-7 Breast Cancer IC50 = 31 μM
dbacp08087 PTP-7S EENFLGALFKALSKLL PTP-7 Not Available MTT assay HeLa Cervical Cancer 55 - 60% cell viability at 75 µM
dbacp08088 PTP-7S EENFLGALFKALSKLL PTP-7 Not Available MTT assay A-549 Lung Cancer 65% cell viability at 10 µΜ
dbacp08089 B1 KKLFKKILKYLK Analogue of BP 100 Membrane disruption triggers apoptosis MTT assay K-562 Leukemia Cancer IC50 = 17.9 ± 1.4 μM
dbacp08090 B1 KKLFKKILKYLK Analogue of BP 100 Membrane disruption triggers apoptosis MTT assay MCF-7 Breast Cancer IC50 = 15.7 ± 1.5 μM
dbacp08091 B1 KKLFKKILKYLK Analogue of BP 100 Membrane disruption triggers apoptosis MTT assay MCF-7/ADM Breast Cancer IC50 = 18.2 ± 1.3 μM
dbacp08092 B1 KKLFKKILKYLK Analogue of BP 100 Membrane disruption triggers apoptosis MTT assay K-562/ADM Leukemia Cancer IC50 = 19.1 ± 2.1 μM
dbacp08093 B2 KKLFKKILKYLKK Analogue of BP 100 Membrane disruption triggers apoptosis MTT assay K-562 Leukemia Cancer IC50 = 33.6 ± 4.2 μM
dbacp08094 B2 KKLFKKILKYLKK Analogue of BP 100 Membrane disruption triggers apoptosis MTT assay MCF-7 Breast Cancer IC50 = 30.8 ± 3.4 μM
dbacp08095 B2 KKLFKKILKYLKK Analogue of BP 100 Membrane disruption triggers apoptosis MTT assay MCF-7/ADM Breast Cancer IC50 = 36.1 ± 6.7 μM
dbacp08096 B2 KKLFKKILKYLKK Analogue of BP 100 Membrane disruption triggers apoptosis MTT assay K-562/ADM Leukemia Cancer IC50 = 39.6 ± 5.7 μM
dbacp08097 B3 KKLFKKILKYLKKL Analogue of BP 100 Membrane disruption triggers apoptosis MTT assay K-562 Leukemia Cancer IC50 = 47.4 ± 12.5 μM
dbacp08098 B3 KKLFKKILKYLKKL Analogue of BP 100 Membrane disruption triggers apoptosis MTT assay MCF-7 Breast Cancer IC50 = 25.3 ± 3.2 μM
dbacp08099 B3 KKLFKKILKYLKKL Analogue of BP 100 Membrane disruption triggers apoptosis MTT assay MCF-7/ADM Breast Cancer IC50 = 28.4 ± 3.1 μM
dbacp08100 B5 LKKLFKKILKYLK Analogue of BP 100 Membrane disruption triggers apoptosis MTT assay K-562 Leukemia Cancer IC50 = 26.5 ± 1.5 μM
dbacp08101 B5 LKKLFKKILKYLK Analogue of BP 100 Membrane disruption triggers apoptosis MTT assay MCF-7 Breast Cancer IC50 = 27.3 ± 2.4 μM
dbacp08102 B5 LKKLFKKILKYLK Analogue of BP 100 Membrane disruption triggers apoptosis MTT assay MCF-7/ADM Breast Cancer IC50 = 28.2 ± 2.7 μM
dbacp08103 B5 LKKLFKKILKYLK Analogue of BP 100 Membrane disruption triggers apoptosis MTT assay K-562/ADM Leukemia Cancer IC50 = 28.3 ± 2.3 μM
dbacp08104 B6 LKKLFKKILKYLKK Analogue of BP 100 Membrane disruption triggers apoptosis MTT assay K-562 Leukemia Cancer IC50 = 19.2 ± 2.3 μM
dbacp08105 B6 LKKLFKKILKYLKK Analogue of BP 100 Membrane disruption triggers apoptosis MTT assay MCF-7 Breast Cancer IC50 = 18.4 ± 1.5 μM
dbacp08106 B6 LKKLFKKILKYLKK Analogue of BP 100 Membrane disruption triggers apoptosis MTT assay MCF-7/ADM Breast Cancer IC50 = 20.7 ± 1.6 μM
dbacp08107 B6 LKKLFKKILKYLKK Analogue of BP 100 Membrane disruption triggers apoptosis MTT assay K-562/ADM Leukemia Cancer IC50 = 22.7 ± 2.3 μM
dbacp08108 B9 KLKKLFKKILKY Analogue of BP 100 Membrane disruption triggers apoptosis MTT assay K-562 Leukemia Cancer IC50 = 60.7 ± 5.4 μM
dbacp08109 B9 KLKKLFKKILKY Analogue of BP 100 Membrane disruption triggers apoptosis MTT assay MCF-7 Breast Cancer IC50 = 38.3 ± 2.5 μM
dbacp08110 B9 KLKKLFKKILKY Analogue of BP 100 Membrane disruption triggers apoptosis MTT assay MCF-7/ADM Breast Cancer IC50 = 30.6 ± 5.7 μM
dbacp08111 B9 KLKKLFKKILKY Analogue of BP 100 Membrane disruption triggers apoptosis MTT assay K-562/ADM Leukemia Cancer IC50 = 83.7 ± 5.3 μM
dbacp08112 FR-15 FRRFFKWFRRFFKFF Synthetic Proline-substituted AMP triggers mitochondrial apoptosis MTT assay MDA-MB-231 Breast Cancer IC50 = 3.15 μM
dbacp08113 FR-15 FRRFFKWFRRFFKFF Synthetic Proline-substituted AMP triggers mitochondrial apoptosis MTT assay HeLa Cervical Cancer IC50 = 4.9 μM
dbacp08114 FR-15 FRRFFKWFRRFFKFF Synthetic Proline-substituted AMP triggers mitochondrial apoptosis MTT assay DLD-1 Colon Cancer IC50 = 6.7 μM
dbacp08115 FR-15 FRRFFKWFRRFFKFF Synthetic Proline-substituted AMP triggers mitochondrial apoptosis MTT assay HepG-2 Liver Cancer IC50 = 2.5 μM
dbacp08116 FR4P FRRPFKWFRRFFKFF Analogue of FR-15 Proline-substituted AMP triggers mitochondrial apoptosis MTT assay MDA-MB-231 Breast Cancer IC50 = 6.3 μM
dbacp08117 FR4P FRRPFKWFRRFFKFF Analogue of FR-15 Proline-substituted AMP triggers mitochondrial apoptosis MTT assay HeLa Cervical Cancer IC50 = 7.7 μM
dbacp08118 FR4P FRRPFKWFRRFFKFF Analogue of FR-15 Proline-substituted AMP triggers mitochondrial apoptosis MTT assay DLD-1 Colon Cancer IC50 = 9.4 μM
dbacp08119 FR4P FRRPFKWFRRFFKFF Analogue of FR-15 Proline-substituted AMP triggers mitochondrial apoptosis MTT assay HepG-2 Liver Cancer IC50 = 2.5 μM
dbacp08120 FR8P FRRFFKWPRRFFKFF Analogue of FR-15 Proline-substituted AMP triggers mitochondrial apoptosis MTT assay MDA-MB-231 Breast Cancer IC50 = 6.4 μM
dbacp08121 FR8P FRRFFKWPRRFFKFF Analogue of FR-15 Proline-substituted AMP triggers mitochondrial apoptosis MTT assay HeLa Cervical Cancer IC50 = 10.5 μM
dbacp08122 FR8P FRRFFKWPRRFFKFF Analogue of FR-15 Proline-substituted AMP triggers mitochondrial apoptosis MTT assay DLD-1 Colon Cancer IC50 = 10.8 μM
dbacp08123 FR8P FRRFFKWPRRFFKFF Analogue of FR-15 Proline-substituted AMP triggers mitochondrial apoptosis MTT assay HepG-2 Liver Cancer IC50 = 4.2 μM
dbacp08124 FR11P FRRFFKWFRRPFKFF Analogue of FR-15 Proline-substituted AMP triggers mitochondrial apoptosis MTT assay MDA-MB-231 Breast Cancer IC50 = 7 μM
dbacp08125 FR11P FRRFFKWFRRPFKFF Analogue of FR-15 Proline-substituted AMP triggers mitochondrial apoptosis MTT assay HeLa Cervical Cancer IC50 = 11 μM
dbacp08126 FR11P FRRFFKWFRRPFKFF Analogue of FR-15 Proline-substituted AMP triggers mitochondrial apoptosis MTT assay DLD-1 Colon Cancer IC50 = 12.9 μM
dbacp08127 FR11P FRRFFKWFRRPFKFF Analogue of FR-15 Proline-substituted AMP triggers mitochondrial apoptosis MTT assay HepG-2 Liver Cancer IC50 = 4.8 μM
dbacp08128 FR4,8P FRRPFKWPRRFFKFF Analogue of FR-15 Proline-substituted AMP triggers mitochondrial apoptosis MTT assay MDA-MB-231 Breast Cancer IC50 = 15.4 μM
dbacp08129 FR4,8P FRRPFKWPRRFFKFF Analogue of FR-15 Proline-substituted AMP triggers mitochondrial apoptosis MTT assay HeLa Cervical Cancer IC50 = 13.8 μM
dbacp08130 FR4,8P FRRPFKWPRRFFKFF Analogue of FR-15 Proline-substituted AMP triggers mitochondrial apoptosis MTT assay DLD-1 Colon Cancer IC50 = 15.3 μM
dbacp08131 FR4,8P FRRPFKWPRRFFKFF Analogue of FR-15 Proline-substituted AMP triggers mitochondrial apoptosis MTT assay HepG-2 Liver Cancer IC50 = 5 μM
dbacp08132 FR8,11P FRRFFKWPRRPFKFF Analogue of FR-15 Proline-substituted AMP triggers mitochondrial apoptosis MTT assay MDA-MB-231 Breast Cancer IC50 = 27 μM
dbacp08133 FR8,11P FRRFFKWPRRPFKFF Analogue of FR-15 Proline-substituted AMP triggers mitochondrial apoptosis MTT assay HeLa Cervical Cancer IC50 = 18.9 μM
dbacp08134 FR8,11P FRRFFKWPRRPFKFF Analogue of FR-15 Proline-substituted AMP triggers mitochondrial apoptosis MTT assay DLD-1 Colon Cancer IC50 = 22 μM
dbacp08135 FR8,11P FRRFFKWPRRPFKFF Analogue of FR-15 Proline-substituted AMP triggers mitochondrial apoptosis MTT assay HepG-2 Liver Cancer IC50 = 15 μM
dbacp08136 Laterosporulin10 (LS10) ACVNQCPDAIDRFIVKDKGCHGVEKKYYKQVYVACMNGQHLYCRTEGGPCQL Brevibacillus sp. strain SKDU10 Apoptosis inducing MTT assay MCF-7 Breast Cancer 40% cytotoxicity at 5 μM concentration
dbacp08138 Laterosporulin10 (LS10) ACVNQCPDAIDRFIVKDKGCHGVEKKYYKQVYVACMNGQHLYCRTEGGPCQL Brevibacillus sp. strain SKDU10 Apoptosis inducing MTT assay HEK-293T Renal Cancer 20% cytotoxicity 5 μM concentration
dbacp08139 Laterosporulin10 (LS10) ACVNQCPDAIDRFIVKDKGCHGVEKKYYKQVYVACMNGQHLYCRTEGGPCQL Brevibacillus sp. strain SKDU10 Apoptosis inducing MTT assay HT-1080 Fibrosarcoma 20% cytotoxicity 5 μM concentration
dbacp08140 Laterosporulin10 (LS10) ACVNQCPDAIDRFIVKDKGCHGVEKKYYKQVYVACMNGQHLYCRTEGGPCQL Brevibacillus sp. strain SKDU10 Apoptosis inducing MTT assay HeLa Cervical Cancer 20% cytotoxicity 5 μM concentration
dbacp08142 Laterosporulin10 (LS10) ACVNQCPDAIDRFIVKDKGCHGVEKKYYKQVYVACMNGQHLYCRTEGGPCQL Brevibacillus sp. strain SKDU10 Apoptosis inducing MTT assay H-1299 Lung Cancer 80% cytotoxicity 10 μM concentration
dbacp08143 MccJ25-18-4 GGAGHVPEYFVGIGTPISFYG-WxEAAYQrFL Synthetic Apoptosis inducing MTT assay MCF-7 Breast Cancer IC50 = 14.2 ± 1.5 μM
dbacp08144 MccJ25-18-4 GGAGHVPEYFVGIGTPISFYG-WxEAAYQrFL Synthetic Apoptosis inducing MTT assay MDA-MB-435 Breast Cancer IC50 = 20.0 ± 0.5 μM
dbacp08145 MccJ25-18-4 GGAGHVPEYFVGIGTPISFYG-WxEAAYQrFL Synthetic Apoptosis inducing MTT assay MDA-MB-435-MDR Breast Cancer IC50 = 25.0 ± 0.5 μM
dbacp08146 LfcinB-P13 KCRRWLKRMKKLG Synthetic analog of LFcinB LfcinB-P13 induces liver cancer apoptosis MTT assay SMMC-7721 Liver Cancer IC50 = 41.8 µg/ml
dbacp08147 Bothropoidin Not Available Bothrops pauloensis snake venom Bothropoidin inhibits breast cancer progression MTT assay MDA-MB-231 Breast Cancer 30% cytotoxicity at 100 μg/mL
dbacp08152 IL-1 FKAGGFIKKLWRSLLA Synthetic Ile/Leu residues crucially mediate cytolysis MTT assay HeLa Cervical Cancer IC50 = 73.9 ± 13.6 μM
dbacp08153 IL-1 FKAGGFIKKLWRSLLA Synthetic Ile/Leu residues crucially mediate cytolysis MTT assay PC-3 Prostate Cancer IC50 = 58.4 ± 13.7 μM
dbacp08155 IL-2 FKIGGFAKKLWRSLLA Synthetic Ile/Leu residues crucially mediate cytolysis MTT assay HeLa Cervical Cancer IC50 = 52.0 ± 5.8 μM
dbacp08156 IL-2 FKIGGFAKKLWRSLLA Synthetic Ile/Leu residues crucially mediate cytolysis MTT assay PC-3 Prostate Cancer IC50 = 43.6 ± 7.9 μM
dbacp08158 IL-3 FKIGGFIKKAWRSLLA Synthetic Ile/Leu residues crucially mediate cytolysis MTT assay HeLa Cervical Cancer IC50 = 93.5 ± 19.4 μM
dbacp08159 IL-3 FKIGGFIKKAWRSLLA Synthetic Ile/Leu residues crucially mediate cytolysis MTT assay PC-3 Prostate Cancer IC50 = 74.9 ± 13.3 μM
dbacp08161 IL-4 FKIGGFIKKLWRSALA Synthetic Ile/Leu residues crucially mediate cytolysis MTT assay HeLa Cervical Cancer IC50 = 54.4 ± 3.0 μM
dbacp08162 IL-4 FKIGGFIKKLWRSALA Synthetic Ile/Leu residues crucially mediate cytolysis MTT assay PC-3 Prostate Cancer IC50 = 35.5 ± 3.9 μM
dbacp08164 IL-5 FKIGGFIKKLWRSLAA Synthetic Ile/Leu residues crucially mediate cytolysis MTT assay HeLa Cervical Cancer IC50 = 28.0 ± 4.6 μM
dbacp08165 IL-5 FKIGGFIKKLWRSLAA Synthetic Ile/Leu residues crucially mediate cytolysis MTT assay PC-3 Prostate Cancer IC50 = 22.0 ± 2.6 μM
dbacp08253 Cecropin XJ APEPRWKIFKKIEKMGRNIRDGIVKAGPAIEVLGSAKAIGK Larvae of Bombyx mori CecropinXJ induces apoptosis in HCC MTT assay Huh-7 Liver Cancer Cell viability = 50% at 50 µmol/l
dbacp08254 Tr1 Not Available Protein extraction from Spirulina platensis Not Available MTT assay MCF-7 Breast Cancer IC50 = 60.12 μg/mL
dbacp08255 Tr1 Not Available Protein extraction from Spirulina platensis Not Available MTT assay HepG-2 Liver Cancer IC50 = 147.03 μg/mL
dbacp08256 Tr2 Not Available Protein extraction from Spirulina platensis Not Available MTT assay MCF-7 Breast Cancer IC50 < 31.25 μg/mL
dbacp08257 Tr2 Not Available Protein extraction from Spirulina platensis Not Available MTT assay HepG-2 Liver Cancer IC50 = 36.42 μg/mL
dbacp08258 Tr2 Not Available Protein extraction from Spirulina platensis Not Available MTT assay SGC-7901 Gastric Cancer IC50 = 48.25 μg/mL
dbacp08259 Tr3 Not Available Protein extraction from Spirulina platensis Not Available MTT assay HT-29 Colon Cancer IC50 = 112.89 μg/mL
dbacp08260 Tr4 Not Available Protein extraction from Spirulina platensis Not Available MTT assay MCF-7 Breast Cancer IC50 = 238.86 μg/mL
dbacp08261 Tr4 Not Available Protein extraction from Spirulina platensis Not Available MTT assay HepG-2 Liver Cancer IC50 = 176.37 μg/mL
dbacp08262 HR HVLSRAPR Fraction identified from Tr1 Not Available MTT assay HT-29 Colon Cancer IC50 = 99.88 μg/mL
dbacp08263 HR HVLSRAPR Fraction identified from Tr1 Not Available MTT assay HepG-2 Liver Cancer 22% inhibition at 500 μg/mL
dbacp08264 HR HVLSRAPR Fraction identified from Tr1 Not Available MTT assay SGC-7901 Gastric Cancer 20% inhibition at 500 μg/mL
dbacp08265 HR HVLSRAPR Fraction identified from Tr1 Not Available MTT assay A-549 Lung Cancer 15% inhibition at 500 μg/mL
dbacp08266 ZXR-2 FKIGGFIKKLWRSLLA Synthetic Not Available MTT assay HeLa Cervical Cancer IC50 = 8.1 ± 1.6 μM
dbacp08267 ZXR-2 FKIGGFIKKLWRSLLA Synthetic Not Available MTT assay SACC-83 Salivary Cancer IC50 = 9.9 ± 1.7 μM
dbacp08268 ZXR-2 FKIGGFIKKLWRSLLA Synthetic Not Available MTT assay HepG-2 Liver Cancer IC50 = 7.5 ± 1.2 μM
dbacp08269 ZXR-2 FKIGGFIKKLWRSLLA Synthetic Not Available MTT assay Huh-7 Liver Cancer IC50 = 8.4 ± 1.1 μM
dbacp08270 ZXR-2 FKIGGFIKKLWRSLLA Synthetic Not Available MTT assay PC-3 Prostate Cancer IC50 = 14.2 ± 0.5 μM
dbacp08271 ZXR-2 FKIGGFIKKLWRSLLA Synthetic Not Available MTT assay 293T Kidney Cancer IC50 = 6.3 ± 0.7 μM
dbacp08272 [Lys5,6] TG UGLUKKLUGI Trichogin GA Not Available MTT assay T-67 Brain Tumor EC50 = 7 µM
dbacp08273 [Lys5,6] TG UGLUKKLUGI Trichogin GA Not Available MTT assay HeLa Cervical Cancer EC50 = 10 µM
dbacp08274 [Lys6] TG UGLUGKLUGI Trichogin GA Not Available MTT assay T-67 Brain Tumor EC50 = 4 µM
dbacp08275 [Lys6] TG UGLUGKLUGI Trichogin GA Not Available MTT assay HeLa Cervical Cancer EC50 = 2 µM
dbacp08276 Trichogin GA UGLUGGLUGI Trichoderma longibrachiatum Not Available MTT assay T-67 Brain Tumor EC50 = 2 µM
dbacp08277 Trichogin GA UGLUGGLUGI Trichoderma longibrachiatum Not Available MTT assay HeLa Cervical Cancer EC50 = 8 µM
dbacp08278 [TOAC1] TG XGLUGGLUGI Trichogin GA Not Available MTT assay T-67 Brain Tumor EC50 = 1 µM
dbacp08279 [TOAC1] TG XGLUGGLUGI Trichogin GA Not Available MTT assay HeLa Cervical Cancer EC50 = 3 µM
dbacp08280 [TOAC1, Lys6] TG XGLUGKLUGI Trichogin GA Not Available MTT assay T-67 Brain Tumor EC50 = 1 µM
dbacp08281 [TOAC1, Lys6] TG XGLUGKLUGI Trichogin GA Not Available MTT assay HeLa Cervical Cancer EC50 = 3 µM
dbacp08282 [Arg2] TG URLUGGLUGI Trichogin GA Not Available MTT assay T-67 Brain Tumor EC50 = 8 µM
dbacp08283 [Arg2] TG URLUGGLUGI Trichogin GA Not Available MTT assay HeLa Cervical Cancer EC50 = 4 µM
dbacp08284 [TOAC1, Arg2] TG XRLUGGLUGI Trichogin GA Not Available MTT assay T-67 Brain Tumor EC50 = 8 µM
dbacp08285 [TOAC1, Arg2] TG XRLUGGLUGI Trichogin GA Not Available MTT assay HeLa Cervical Cancer EC50 = 9 µM
dbacp08286 [TOAC1, Arg9] TG XGLUGGLURI Trichogin GA Not Available MTT assay T-67 Brain Tumor EC50 = 8 µM
dbacp08287 [TOAC1, Arg9] TG XGLUGGLURI Trichogin GA Not Available MTT assay HeLa Cervical Cancer EC50 = 5 µM
dbacp08288 [TOAC1, Lys5,6] TG XGLUKKLUGI Trichogin GA Not Available MTT assay T-67 Brain Tumor EC50 = 10 µM
dbacp08289 [TOAC1, Lys5,6] TG XGLUKKLUGI Trichogin GA Not Available MTT assay HeLa Cervical Cancer EC50 = 6 µM
dbacp08290 [TOAC1, Api4] TG XGLZGGLUGI Trichogin GA Not Available MTT assay T-67 Brain Tumor EC50 = 13 µM
dbacp08291 L-Carnosine Beta-AH Synthetic Not Available MTT assay A-2780 Ovarian Cancer IC50 = 165 mM
dbacp08292 L-Carnosine Beta-AH Synthetic Not Available MTT assay OVCAR-3 Ovarian Cancer IC50 = 125 mM
dbacp08293 L-Carnosine Beta-AH Synthetic Not Available MTT assay SK-OV-3 Ovarian Cancer IC50 = 485 mM
dbacp08294 CA4 CGPCFTTDHNMARKCDECCGGKGRGKCFGPQCLCR Synthetic Not Available MTT assay U-251 Brain Tumor Graph Figure 2
dbacp08295 CTX-23 VCMPCFTTDQQMARKCSDCCGGKGRGKCYGPQCLCR Synthetic Not Available MTT assay U-251 Brain Tumor Graph Figure 2
dbacp08296 BnSP-6 SLFELGKMILQETGKNPAKSYGAYGCNCGVLGRGGPKDATDRCCYVHKCCYKKLTGCDPKKDRYSYSWKDKTIVCGENNPCLKELCECDKAVAICLRENLGTYNKKYRYHLKPFCKKADPC B. pauloensis Not Available MTT assay MDA-MB-231 Breast Cancer 45% cell cytotoxicity at 100 μg/mL
dbacp08297 DN1 ILGKIVKKLVSDF Synthetic Not Available MTT assay HepG-2 Liver Cancer 152.17 ± 7.73 μM
dbacp08298 DN4 ILGKIWKGIVSDF Synthetic Not Available MTT assay HepG-2 Liver Cancer 191.67 ± 12.02 μM
dbacp08299 SKACP003 FPLPCAYKGTYC Synthetic Not Available MTT assay MCF-7 Breast Cancer IC50 = 193 ± 0.5 µM
dbacp08300 SKACP003 FPLPCAYKGTYC Synthetic Not Available MTT assay MDA-MB-231 Breast Cancer IC50 = 212 ± 0.5 µM
dbacp08301 SKACP003 FPLPCAYKGTYC Synthetic Not Available MTT assay MDA-MB-453 Breast Cancer IC50 = 156 ± 0.5 µM
dbacp08302 RF13 RRGKGGRRVTMSF VSP26B of C. striatus Not Available MTT assay HEp-2 Larynx Cancer IC50 = 49.65 µM
dbacp08304 MAD1 KRWHWWRRHWVVW Synthetic Not Available MTT assay OVCAR-3 Ovarian Cancer IC50 = 14.2 μM
dbacp08305 MAD1 KRWHWWRRHWVVW Synthetic Not Available MTT assay A-549 Lung Cancer IC50 = 36.2 μM
dbacp08306 MAD1 KRWHWWRRHWVVW Synthetic Not Available MTT assay NCI/ADR-RES Ovarian Cancer IC50 = 85.6 μM
dbacp08307 DAP1 LWKRWVGVWRKWL Synthetic Not Available MTT assay A-549 Lung Cancer IC50 = 11.9 μM
dbacp08308 DAP1 LWKRWVGVWRKWL Synthetic Not Available MTT assay OVCAR-3 Ovarian Cancer IC50 = 8.6 μM
dbacp08309 DAP1 LWKRWVGVWRKWL Synthetic Not Available MTT assay NCI/ADR-RES Ovarian Cancer IC50 = 14.0 μM
dbacp08310 DAP1 LWKRWVGVWRKWL Synthetic Not Available MTT assay T-24 Bladder Cancer IC50 = 15.3 μM
dbacp08311 AMP1 WKWLKKWIK Synthetic Not Available MTT assay OVCAR-3 Ovarian Cancer IC50 = 51.1 μM
dbacp08312 AMP2 KRWWKWWRR Synthetic Not Available MTT assay OVCAR-3 Ovarian Cancer IC50 = 53.5 μM
dbacp08342 VLL-28 VLLVTLTRLHQRGVIYEKWRHFSGRKYR Sulfolobus islandicus Not Available MTT assay HEK-293T Renal Cancer IC50 = 10 μM
dbacp08417 5-2C NYPQRPCRGDKGPDC Synthetic Not Available MTT assay U343 Glioblastoma IC50 = 0.781 μM
dbacp08418 5-2C NYPQRPCRGDKGPDC Synthetic Not Available MTT assay U373MG Glioblastoma IC50 = 0.8717 μM
dbacp08419 5-2C NYPQRPCRGDKGPDC Synthetic Not Available MTT assay U251 Glioblastoma IC50 = 0.7607 μM
dbacp08420 5-2C NYPQRPCRGDKGPDC Synthetic Not Available MTT assay U87-MG Glioblastoma IC50 = 0.9164 μM
dbacp08421 5-2C NYPQRPCRGDKGPDC Synthetic Not Available MTT assay HepG-2 Liver Cancer IC50 = 3.064 μM
dbacp08422 5-2C NYPQRPCRGDKGPDC Synthetic Not Available MTT assay Hep3B Liver Cancer IC50 = 0.7847 μM
dbacp08423 5-2C NYPQRPCRGDKGPDC Synthetic Not Available MTT assay 293T Renal Cancer IC50 = 1.107 μM
dbacp08424 5-2C NYPQRPCRGDKGPDC Synthetic Not Available MTT assay MCF-7 Breast Cancer IC50 = 9.74 μM
dbacp08425 5-2C NYPQRPCRGDKGPDC Synthetic Not Available MTT assay MDA-MB-231 Breast Cancer IC50 = 0.8061 μM
dbacp08426 5-2C NYPQRPCRGDKGPDC Synthetic Not Available MTT assay HL-60 Blood Cancer IC50 = 1.111 μM
dbacp08427 5-2C NYPQRPCRGDKGPDC Synthetic Not Available MTT assay K-562 Blood Cancer IC50 = 1.103 μM
dbacp08428 5-2C NYPQRPCRGDKGPDC Synthetic Not Available MTT assay Hel Blood Cancer IC50 = 1.055 μM
dbacp08433 Alpha-gliadin peptide p31-43 LGQQQPFPPQQPY Synthetic Not Available MTT assay A-549 Lung Cancer 9.4% growth inhibition at 70 μg/mL
dbacp08434 Alpha-gliadin peptide p31-43 LGQQQPFPPQQPY Synthetic Not Available MTT assay NCI-H1975 Lung Cancer 36.3% growth inhibition at 70 μg/mL
dbacp08435 Alpha-gliadin peptide p31-43 LGQQQPFPPQQPY Synthetic Not Available MTT assay PANC-1 Pancreatic Cancer 26.2% growth inhibition at 70 μg/mL