1782 result(s) have been found!
| Accession | Name | Sequence | Source/Organism | Mechanism | Assay Type | Cell Line | Cancer Type | Activity |
|---|---|---|---|---|---|---|---|---|
| dbacp00303 | Temporin-SHf | FFFLSRIF* | Sahara frog | Apoptosis inducing | MTT assay | A549 | Not specified | IC50 : 24.03 ± 0.945 µM |
| dbacp00304 | Temporin-SHf | FFFLSRIF* | Sahara frog | Apoptosis inducing | MTT assay | MCF-7 | Not specified | IC50 : 32.76 ± 1.528 µM |
| dbacp00305 | Temporin-SHf | FFFLSRIF* | Sahara frog | Apoptosis inducing | MTT assay | HepG2 | Not specified | IC50 : 32.64 ± 1.350 µM |
| dbacp00306 | Temporin-SHf | FFFLSRIF* | Sahara frog | Apoptosis inducing | MTT assay | PC3 | Not specified | IC50 : 36.67 ± 0.729 µM |
| dbacp00309 | (Bl- LAAO) L-amino acid oxidases (L-AAO) | ADDRNPLEECFRETDYEEFLEIAKNGLSTT | Venom base | Apoptosis inducing | MTT assay | MKN-45 | Stomach cancer | Not found |
| dbacp00310 | (Bl- LAAO) L-amino acid oxidases (L-AAO) | ADDRNPLEECFRETDYEEFLEIAKNGLSTT | Venom base | Apoptosis inducing | MTT assay | HUTU | Adenocarcinoma | Not found |
| dbacp00311 | (Bl- LAAO) L-amino acid oxidases (L-AAO) | ADDRNPLEECFRETDYEEFLEIAKNGLSTT | Venom base | Apoptosis inducing | MTT assay | RKO | Colorectal cancer | Not found |
| dbacp00402 | [D-Ala]- nocardiotide A | Ac-cyclo(FSRM)-NH2 | Marine sponge | Cell membrane permeation | MTT assay | HeLa | Not specified | IC50 : 52 μM |
| dbacp00720 | 5-FU | NA | Not found | Cell membrane penetrating | MTT assay | UM-UC-5 | Not specified | IC50 : 4.21μM |
| dbacp00721 | 5-FU | NA | Not found | Cell membrane penetrating | MTT assay | A549 | Not specified | IC50 : 2.42 μM |
| dbacp00817 | AaeAP1 | FLFSLIPSVIAGLVSAIRN | Aeneas fattailed scorpion | Not specified | MTT assay | H460 | Prostate cancer | Not found |
| dbacp00818 | AaeAP1 | FLFSLIPSVIAGLVSAIRN | Aeneas fattailed scorpion | Not specified | MTT assay | MB435s | Prostate cancer | Not found |
| dbacp00819 | AaeAP1 | FLFSLIPSVIAGLVSAIRN | Aeneas fattailed scorpion | Not specified | MTT assay | MCF-7 | Prostate cancer | Not found |
| dbacp00820 | AaeAP1 | FLFSLIPSVIAGLVSAIRN | Aeneas fattailed scorpion | Not specified | MTT assay | PC3 | Prostate cancer | Not found |
| dbacp00821 | AaeAP1 | FLFSLIPSVIAGLVSAIRN | Venom, Aeneas fattailed scorpion, Africa | Membrane lysis | MTT assay | NCI-H460 | Human lung adenocarcinoma | MIC : 10−4 to 10−9 M |
| dbacp00822 | AaeAP1 | FLFSLIPSVIAGLVSAIRN | Venom, Aeneas fattailed scorpion, Africa | Membrane lysis | MTT assay | MB435s | Human breast carcinoma | MIC : 10−4 to 10−9 M |
| dbacp00823 | AaeAP1 | FLFSLIPSVIAGLVSAIRN | Venom, Aeneas fattailed scorpion, Africa | Membrane lysis | MTT assay | MCF-7 | Non-tumourigenic mammary gland cancer | MIC : 10−4 to 10−9 M |
| dbacp00824 | AaeAP1 | FLFSLIPSVIAGLVSAIRN | Venom, Aeneas fattailed scorpion, Africa | Membrane lysis | MTT assay | PC-3 | Human prostate carcinoma | MIC : 10−4 to 10−9 M |
| dbacp00825 | AaeAP2 | FLFSLIPSAIAGLVSAIRN | Aeneas fattailed scorpion | Not specified | MTT assay | H460 | Prostate cancer | Not found |
| dbacp00826 | AaeAP2 | FLFSLIPSAIAGLVSAIRN | Aeneas fattailed scorpion | Not specified | MTT assay | MB435s | Prostate cancer | Not found |
| dbacp00827 | AaeAP2 | FLFSLIPSAIAGLVSAIRN | Aeneas fattailed scorpion | Not specified | MTT assay | MCF-7 | Prostate cancer | Not found |
| dbacp00828 | AaeAP2 | FLFSLIPSAIAGLVSAIRN | Aeneas fattailed scorpion | Not specified | MTT assay | PC3 | Prostate cancer | Not found |
| dbacp00829 | AaeAP2 | FLFSLIPSAIAGLVSAIRN | Venom, Aeneas fattailed scorpion, Africa | Membrane lysis | MTT assay | NCI-H460 | Human lung adenocarcinoma | MIC : 10−4 to 10−9 M |
| dbacp00830 | AaeAP2 | FLFSLIPSAIAGLVSAIRN | Venom, Aeneas fattailed scorpion, Africa | Membrane lysis | MTT assay | MB435s | Human breast carcinoma | MIC : 10−4 to 10−9 M |
| dbacp00831 | AaeAP2 | FLFSLIPSAIAGLVSAIRN | Venom, Aeneas fattailed scorpion, Africa | Membrane lysis | MTT assay | MCF-7 | Non-tumourigenic mammary gland cancer | MIC : 10−4 to 10−9 M |
| dbacp00832 | AaeAP2 | FLFSLIPSAIAGLVSAIRN | Venom, Aeneas fattailed scorpion, Africa | Membrane lysis | MTT assay | PC-3 | Human prostate carcinoma | MIC : 10−4 to 10−9 M |
| dbacp00833 | AAP-H | YVPGP | Marine invertebrates | Apoptosis inducing | MTT assay | DU-145 | Prostate cancer | IC50 : 9.605 mM |
| dbacp00834 | AAP-H | YVPGP | Marine invertebrates | Apoptosis inducing | MTT assay | DU-146 | Prostate cancer | IC50 : 7.910 mM |
| dbacp00835 | AAP-H | YVPGP | Marine invertebrates | Apoptosis inducing | MTT assay | DU-147 | Prostate cancer | IC50 : 2.298 mM |
| dbacp00951 | ABP-dHC-Cecropin A | RWKIFKKIERVGQNVRDGIIKAGPAIQVLGTAKALGK | Synthetic construct | Apoptosis inducing | MTT assay | K562 cells | Leukemia | IC50 : 349.5 μM |
| dbacp00952 | ABP-dHC-Cecropin A | RWKIFKKIERVGQNVRDGIIKAGPAIQVLGTAKALGK | Synthetic construct | Apoptosis inducing | MTT assay | U937 cells | Leukemia | IC50 : 303.2 μM |
| dbacp00953 | ABP-dHC-Cecropin A | RWKIFKKIERVGQNVRDGIIKAGPAIQVLGTAKALGK | Synthetic construct | Apoptosis inducing | MTT assay | THP-1 cells | Leukemia | IC50 : 228.5 μM |
| dbacp00954 | ABP-dHC-Cecropin A-K | RWKIFKKIERVGQNVRDGIIKAGKAIQVLGTAKALGK | Synthetic construct | Apoptosis inducing | MTT assay | K562 cells | Leukemia | IC50 : 349.5 μM |
| dbacp00955 | ABP-dHC-Cecropin A-K | RWKIFKKIERVGQNVRDGIIKAGKAIQVLGTAKALGK | Synthetic construct | Apoptosis inducing | MTT assay | U937 cells | Leukemia | IC50 : 303.2 μM |
| dbacp00956 | ABP-dHC-Cecropin A-K | RWKIFKKIERVGQNVRDGIIKAGKAIQVLGTAKALGK | Synthetic construct | Apoptosis inducing | MTT assay | THP-1 cells | Leukemia | IC50 : 228.5 μM |
| dbacp01193 | ATAP-iRGD peptide-Parental | KFEPKSGWMTFLEVTGKIAEMLSLLKQYCRGDKGPDC | Anti apoptotic (MCL-1, BFL1) | Inducing apoptosis | MTT assay | DU-145 | Prostate cancer | IC50 : 1.6 μM |
| dbacp01194 | ATAP-iRGD-M1 | AFEPKSGWMTFLEVTGKIAEMLSLLKQYCRGDKGPDC | Anti apoptotic (MCL-1, BFL1) | Inducing apoptosis | MTT assay | DU-145 | Prostate cancer | IC50 : 36 μM |
| dbacp01195 | ATAP-iRGD-M2 | LFEPKSGWMTFLEVTGKIAEMLSLLKQYCRGDKGPDC | Anti apoptotic (MCL-1, BFL1) | Inducing apoptosis | MTT assay | DU-145 | Prostate cancer | IC50 : 68 μM |
| dbacp01196 | ATAP-iRGD-M3 | KFEPLSGWMTFLEVTGKIAEMLSLLKQYCRGDKGPDC | Anti apoptotic (MCL-1, BFL1) | Inducing apoptosis | MTT assay | DU-145 | Prostate cancer | IC50 : 25 μM |
| dbacp01197 | ATAP-iRGD-M5 | KFEPKSGWETFLEVTGKIAEMLSLLKQYCRGDKGPDC | Anti apoptotic (MCL-1, BFL1) | Inducing apoptosis | MTT assay | DU-145 | Prostate cancer | IC50 : 6 μM |
| dbacp01198 | ATAP-iRGD-M6 | KKFEPKSGWMTFLEVTGKIAEMLSLLKQYCRGDKGPDC | Anti apoptotic (MCL-1, BFL1) | Inducing apoptosis | MTT assay | DU-145 | Prostate cancer | IC50 : 3.1 μM |
| dbacp01199 | ATAP-iRGD-M7 | KFEPKSGWMTFLEVTGKIAEMLSLLKQYCRGDKGPDC | Anti apoptotic (MCL-1, BFL1) | Inducing apoptosis | MTT assay | DU-145 | Prostate cancer | IC50 : 2.1 μM |
| dbacp01200 | ATAP-iRGD-M8 | KKFEPKSGWMTFLEVTGKIAEMLSLLKQYCRGDKGPDC | Anti apoptotic (MCL-1, BFL1) | Inducing apoptosis | MTT assay | DU-145 | Prostate cancer | IC50 : 2.1 μM |
| dbacp01432 | B1AW | FLPLLAGLAANFLPQIICKIARKC | Wuyi torrent frog | Cell membrane penetration | MTT assay | PC-3 | Human prostatic cancer | IC50 : 33.46 μM |
| dbacp01433 | B1AW | FLPLLAGLAANFLPQIICKIARKC | Wuyi torrent frog | Cell membrane penetration | MTT assay | H838 | Non-small lung cancer | IC50 : 32.15 μM |
| dbacp01434 | B1AW | FLPLLAGLAANFLPQIICKIARKC | Wuyi torrent frog | Cell membrane penetration | MTT assay | U251MG | Glioblastoma cancer | IC50 : 33.56 μM |
| dbacp01435 | B1AW | FLPLLAGLAANFLPQIICKIARKC | Wuyi torrent frog | Cell membrane penetration | MTT assay | HMEC-1 | Glioblastoma cancer | IC50 : 32.96 μM |
| dbacp01436 | B1AW | FLPLLAGLAANFLPQIICKIARKC | Wuyi torrent frog | Cell membrane penetration | MTT assay | HaCaT | Glioblastoma cancer | IC50 : 44.09 μM |
| dbacp01437 | B1AW-K | FLPLLAGLAANFLPKIICKIARKC | Wuyi torrent frog | Cell membrane penetration | MTT assay | PC-3 | Prostate cancer | IC50 : 33.46 μM |
| dbacp01442 | Baceridin | cyclo(L-Trp-D-Ala-D-allo-Ile-L-Val-D-Leu-L-Leu-) | Synthetic construct | Apoptosis inducing | MTT assay | HCT116 | Not specified | Not found |
| dbacp01443 | Baceridin | cyclo(L-Trp-D-Ala-D-allo-Ile-L-Val-D-Leu-L-Leu-) | Synthetic construct | Apoptosis inducing | MTT assay | RKO | Not specified | Not found |
| dbacp01444 | Baceridin | cyclo(L-Trp-D-Ala-D-allo-Ile-L-Val-D-Leu-L-Leu-) | Synthetic construct | Apoptosis inducing | MTT assay | HeLa | Not specified | Not found |
| dbacp01445 | Baceridin | WAIVLL | Plant-associated rod-shaped, Gram-positive bacteria | Apoptosis inducing | MTT assay | HCT116 | Not specified | Not found |
| dbacp01446 | Baceridin | WAIVLL | Plant-associated rod-shaped, Gram-positive bacteria | Apoptosis inducing | MTT assay | RKO | Not specified | Not found |
| dbacp01447 | Baceridin | WAIVLL | Plant-associated rod-shaped, Gram-positive bacteria | Apoptosis inducing | MTT assay | HeLa | Not specified | Not found |
| dbacp01628 | BIM BH3 (E158S) | EIWIAQELRRIGDSFNAYYAR | BH3-only, Direct activators, BIM analogues | Inducing apoptosis | MTT assay | Not found | Prostate cancer | Not found |
| dbacp01629 | BIM BH3 (I155R, E158A) | EIWIAQELRRRGDAFNAYYAR | BH3-only, Direct activators, BIM analogues | Inducing apoptosis | MTT assay | Not found | Prostate cancer | Not found |
| dbacp01630 | BIM BH3 (I155R, E158S) | EIWIAQELRRRGDSFNAYYAR | BH3-only, Direct activators, BIM analogues | Inducing apoptosis | MTT assay | Not found | Prostate cancer | Not found |
| dbacp01631 | BIM BH3 (R154S, I155R, E158S) | EIWIAQELRSRGDSFNAYYAR | BH3-only, Direct activators, BIM analogues | Inducing apoptosis | MTT assay | Not found | Prostate cancer | Not found |
| dbacp01815 | BIM XXA1 | RPEIWYAQGLKRFGDEFNAYYAR | BH3-only, Direct activators, BIM analogues | Inducing apoptosis | MTT assay | Not found | Prostate cancer | Not found |
| dbacp01840 | BIRD-2 (Bcl-2 IP3R disrupter 2) | RKKRRQRRRGGNVYTEIKCNSLLPLAAIVRV | Not found | Inducing apoptosis | MTT assay | DLBCL | Leukemia | Not found |
| dbacp01841 | BIRD-2 (Bcl-2 IP3R disrupter 2) | RKKRRQRRRGGNVYTEIKCNSLLPLAAIVRV | Not found | Inducing apoptosis | MTT assay | CLL | Leukemia | Not found |
| dbacp01843 | BLP-7 | GIGGALLSAGKSALKGLAKGLAEHFAN | Oriental Fire-bellied Toad | Cell membrane Permeabilization | MTT assay | Hep G2 | Human hepatoma | IC50 : 2.83 μM |
| dbacp01844 | BLP-7 | GIGGALLSAGKSALKGLAKGLAEHFAN | Oriental Fire-bellied Toad | Cell membrane Permeabilization | MTT assay | SK-HEP-1 | Human hepatoma | IC50 : 0.61μM |
| dbacp01845 | BLP-7 | GIGGALLSAGKSALKGLAKGLAEHFAN | Oriental Fire-bellied Toad | Cell membrane Permeabilization | MTT assay | Huh7 | Human hepatoma | IC50 : 3.87 μM |
| dbacp01851 | Bombina orientalis Bombinin H-BO1 | IIGPVLGLVGKALGGLL | Oriental Fire-bellied Toad Bombinin H-BO1 | Anti-proliferative effects | MTT assay | Hep G2 | Human hepatoma | IC50 : 3.61 μM |
| dbacp01852 | Bombina orientalis Bombinin H-BO1 | IIGPVLGLVGKALGGLL | Oriental Fire-bellied Toad Bombinin H-BO1 | Anti-proliferative effects | MTT assay | SK-HEP-1 | Human hepatoma | IC50 : 8.08 μM |
| dbacp01853 | Bombina orientalis Bombinin H-BO2 | IIGPVLGLVGKALGGLL | Oriental Fire-bellied Toad Bombinin H-BO1 | Anti-proliferative effects | MTT assay | Huh7 | Human hepatoma | IC50 : 8.42 μM |
| dbacp01854 | Bombina orientalis Bombinin H-BO3 | GIGSAILSAGKSIIKGLAKGLAEHF | Oriental Fire-bellied Toad Bombinin H-BO1 | Anti-proliferative effects | MTT assay | Hep G2 | Human hepatoma | IC50 : 3.61 μM |
| dbacp01855 | Bombina orientalis Bombinin H-BO4 | GIGSAILSAGKSIIKGLAKGLAEHF | Oriental Fire-bellied Toad Bombinin H-BO1 | Anti-proliferative effects | MTT assay | SK-HEP-1 | Human hepatoma | IC50 : 8.08 μM |
| dbacp01856 | Bombina orientalis Bombinin H-BO5 | GIGSAILSAGKSIIKGLAKGLAEHF | Oriental Fire-bellied Toad Bombinin H-BO1 | Anti-proliferative effects | MTT assay | Huh7 | Human hepatoma | IC50 : 8.42 μM |
| dbacp01857 | Bombinin H-BO | IIGPVLGLIGKALGGLL | Oriental Fire-bellied Toad | Cell Membrane Permeabilization | MTT assay | Hep G2 | Human hepatoma | IC50 : 3.87μM |
| dbacp01858 | Bombinin H-BO | IIGPVLGLIGKALGGLL | Oriental Fire-bellied Toad | Cell Membrane Permeabilization | MTT assay | SK-HEP-1 | Human hepatoma | IC50 : 1.81 μM |
| dbacp01859 | Bombinin H-BO | IIGPVLGLIGKALGGLL | Oriental Fire-bellied Toad | Cell Membrane Permeabilization | MTT assay | Huh8 | Human hepatoma | IC50 : 1.81 μM |
| dbacp01860 | Bombinin H-BO1 | IIGPVLGLVGKALGGLL | Oriental Fire-bellied Toad | Anti-proliferative effects | MTT assay | Hep G2 | Human hepatoma | IC50 : 3.61 μM |
| dbacp01861 | Bombinin H-BO1 | IIGPVLGLVGKALGGLL | Oriental Fire-bellied Toad | Anti-proliferative effects | MTT assay | SK-HEP-1 | Human hepatoma | IC50 : 8.08 μM |
| dbacp01862 | Bombinin H-BO1 | IIGPVLGLVGKALGGLL | Oriental Fire-bellied Toad | Anti-proliferative effects | MTT assay | Huh8 | Human hepatoma | IC50 : 8.42 μM |
| dbacp01863 | Bombinin H-BO1 | IIGPVLGLVGKALGGLL | Skin secretion, Oriental fire-bellied toad, China, Asia | Anti-proliferative effects | MTT assay | Hep G2 | Human hepatoma cancer | IC50 : 3.61 μM |
| dbacp01864 | Bombinin H-BO1 | IIGPVLGLVGKALGGLL | Skin secretion, Oriental fire-bellied toad, China, Asia | Anti-proliferative effects | MTT assay | SK-HEP-1 | Human hepatoma cancer | IC50 : 8.08 μM |
| dbacp01865 | Bombinin H-BO1 | IIGPVLGLVGKALGGLL | Skin secretion, Oriental fire-bellied toad, China, Asia | Anti-proliferative effects | MTT assay | Huh7 | Human hepatoma cancer | IC50 : 8.42 μM |
| dbacp01867 | Bombinin-BO1 | GIGSAILSAGKSIIKGLAKGLAEHF | Oriental Fire-bellied Toad | Anti-proliferative effects | MTT assay | Hep G2 | Human hepatoma | IC50 : 3.61 μM |
| dbacp01868 | Bombinin-BO1 | GIGSAILSAGKSIIKGLAKGLAEHF | Oriental Fire-bellied Toad | Anti-proliferative effects | MTT assay | SK-HEP-1 | Human hepatoma | IC50 : 8.08 μM |
| dbacp01869 | Bombinin-BO1 | GIGSAILSAGKSIIKGLAKGLAEHF | Oriental Fire-bellied Toad | Anti-proliferative effects | MTT assay | Huh8 | Human hepatoma | IC50 : 8.42 μM |
| dbacp01870 | Bombinin-BO1 | GIGSAILSAGKSIIKGLAKGLAEHF | Skin secretion, Oriental fire-bellied toad, China, Asia | Anti-proliferative effects | MTT assay | Hep G2 | Human hepatoma cancer | IC50 : 0.76 μM |
| dbacp01871 | Bombinin-BO1 | GIGSAILSAGKSIIKGLAKGLAEHF | Skin secretion, Oriental fire-bellied toad, China, Asia | Anti-proliferative effects | MTT assay | SK-HEP-1 | Human hepatoma cancer | IC50 : 3.75 μM |
| dbacp01872 | Bombinin-BO1 | GIGSAILSAGKSIIKGLAKGLAEHF | Skin secretion, Oriental fire-bellied toad, China, Asia | Anti-proliferative effects | MTT assay | Huh7 | Human hepatoma cancer | IC50 : 3.91 μM |
| dbacp01874 | Bombinins BLP-7 GH-2 [Cleaved into: Bombinin-like peptide 7 (BLP-7); Bombinin GH-2] | MNFKYIVAVSFLIASTYARSVKNDEQSLSQRDVLEEESLREIRGIGGALLSAGKSALKGLAKGLAEHFANGKRTAEEHEVMKRLEAVMRDLDSLDYPEEASEMETRSFNQEEIANLFTKKEKRILGPVLDLVGRALRGLLKKIG | Oriental fire-bellied toad | Anti-proliferative action | MTT assay | SK-HEP-1 cells | Human hepatoma | IC50 : 0.61 μM |
| dbacp01875 | Bombinins BLP-7 GH-2 [Cleaved into: Bombinin-like peptide 7 (BLP-7); Bombinin GH-2] | MNFKYIVAVSFLIASTYARSVKNDEQSLSQRDVLEEESLREIRGIGGALLSAGKSALKGLAKGLAEHFANGKRTAEEHEVMKRLEAVMRDLDSLDYPEEASEMETRSFNQEEIANLFTKKEKRILGPVLDLVGRALRGLLKKIG | Oriental fire-bellied toad | Anti-proliferative action | MTT assay | SK-HEP-1 cells | Human hepatoma | IC50 : 0.99 μM |
| dbacp01876 | Bombinins BLP-7 GH-2 [Cleaved into: Bombinin-like peptide 7 (BLP-7); Bombinin GH-2] | MNFKYIVAVSFLIASTYARSVKNDEQSLSQRDVLEEESLREIRGIGGALLSAGKSALKGLAKGLAEHFANGKRTAEEHEVMKRLEAVMRDLDSLDYPEEASEMETRSFNQEEIANLFTKKEKRILGPVLDLVGRALRGLLKKIG | Oriental fire-bellied toad | Anti-proliferative action | MTT assay | Hep G2 cells | Human hepatoma | IC50 : 2.83 μM |
| dbacp01877 | Bombinins BLP-7 GH-2 [Cleaved into: Bombinin-like peptide 7 (BLP-7); Bombinin GH-2] | MNFKYIVAVSFLIASTYARSVKNDEQSLSQRDVLEEESLREIRGIGGALLSAGKSALKGLAKGLAEHFANGKRTAEEHEVMKRLEAVMRDLDSLDYPEEASEMETRSFNQEEIANLFTKKEKRILGPVLDLVGRALRGLLKKIG | Oriental fire-bellied toad | Anti-proliferative action | MTT assay | Hep G2 cells | Human hepatoma | IC50 : 2.88 μM |
| dbacp01878 | Bombinins BLP-7 GH-2 [Cleaved into: Bombinin-like peptide 7 (BLP-7); Bombinin GH-2] | MNFKYIVAVSFLIASTYARSVKNDEQSLSQRDVLEEESLREIRGIGGALLSAGKSALKGLAKGLAEHFANGKRTAEEHEVMKRLEAVMRDLDSLDYPEEASEMETRSFNQEEIANLFTKKEKRILGPVLDLVGRALRGLLKKIG | Oriental fire-bellied toad | Anti-proliferative action | MTT assay | Huh7 cells | Human hepatoma | IC50 : 3.87 μM |
| dbacp01879 | Bombinins BLP-7 GH-2 [Cleaved into: Bombinin-like peptide 7 (BLP-7); Bombinin GH-2] | MNFKYIVAVSFLIASTYARSVKNDEQSLSQRDVLEEESLREIRGIGGALLSAGKSALKGLAKGLAEHFANGKRTAEEHEVMKRLEAVMRDLDSLDYPEEASEMETRSFNQEEIANLFTKKEKRILGPVLDLVGRALRGLLKKIG | Oriental fire-bellied toad | Anti-proliferative action | MTT assay | Huh7 cells | Human hepatoma | IC50 : 1.81 μM |
| dbacp01880 | Bombinins BLP-7 H-BO [Cleaved into: Bombinin-like peptide 7 (BLP-7); Bombinin H-BO] | MNFKYIIAVSFLIASTYARSVKNDEQSLSQRDVLDEESLREIRGIGGALLSAGKSALKGLAKGLAEHFANGKRTAEEHEVMKRLEAVMRDLDSLDHPEEASEKETRGFNQEEIANLFTKKEKRIIGPVLGLIGKALGGLLG | Oriental fire-bellied toad | Not specified | MTT assay | SK-HEP-1 | Human hepatoma | IC50 : 0.61 μM |
| dbacp01881 | Bombinins BLP-7 H-BO [Cleaved into: Bombinin-like peptide 7 (BLP-7); Bombinin H-BO] | MNFKYIIAVSFLIASTYARSVKNDEQSLSQRDVLDEESLREIRGIGGALLSAGKSALKGLAKGLAEHFANGKRTAEEHEVMKRLEAVMRDLDSLDHPEEASEKETRGFNQEEIANLFTKKEKRIIGPVLGLIGKALGGLLG | Oriental fire-bellied toad | Not specified | MTT assay | SK-HEP-1 | Human hepatoma | IC50 : 0.99 μM |
| dbacp01882 | Bombinins BLP-7 H-BO [Cleaved into: Bombinin-like peptide 7 (BLP-7); Bombinin H-BO] | MNFKYIIAVSFLIASTYARSVKNDEQSLSQRDVLDEESLREIRGIGGALLSAGKSALKGLAKGLAEHFANGKRTAEEHEVMKRLEAVMRDLDSLDHPEEASEKETRGFNQEEIANLFTKKEKRIIGPVLGLIGKALGGLLG | Oriental fire-bellied toad | Not specified | MTT assay | Hep G2 | Human hepatoma | IC50 : 2.83μM |
| dbacp01883 | Bombinins BLP-7 H-BO [Cleaved into: Bombinin-like peptide 7 (BLP-7); Bombinin H-BO] | MNFKYIIAVSFLIASTYARSVKNDEQSLSQRDVLDEESLREIRGIGGALLSAGKSALKGLAKGLAEHFANGKRTAEEHEVMKRLEAVMRDLDSLDHPEEASEKETRGFNQEEIANLFTKKEKRIIGPVLGLIGKALGGLLG | Oriental fire-bellied toad | Not specified | MTT assay | Hep G2 | Human hepatoma | IC50 : 0.99 μM |
| dbacp01884 | Bombinins BLP-7 H-BO [Cleaved into: Bombinin-like peptide 7 (BLP-7); Bombinin H-BO] | MNFKYIIAVSFLIASTYARSVKNDEQSLSQRDVLDEESLREIRGIGGALLSAGKSALKGLAKGLAEHFANGKRTAEEHEVMKRLEAVMRDLDSLDHPEEASEKETRGFNQEEIANLFTKKEKRIIGPVLGLIGKALGGLLG | Oriental fire-bellied toad | Not specified | MTT assay | Huh7 | Human hepatoma | IC50 : 3.87μM |
| dbacp01885 | Bombinins BLP-7 H-BO [Cleaved into: Bombinin-like peptide 7 (BLP-7); Bombinin H-BO] | MNFKYIIAVSFLIASTYARSVKNDEQSLSQRDVLDEESLREIRGIGGALLSAGKSALKGLAKGLAEHFANGKRTAEEHEVMKRLEAVMRDLDSLDHPEEASEKETRGFNQEEIANLFTKKEKRIIGPVLGLIGKALGGLLG | Oriental fire-bellied toad | Not specified | MTT assay | Huh7 | Human hepatoma | IC50 : 1.81 μM |
| dbacp01892 | BPC194 | KKLKKFKKLQ | Synthetic Peptide | Inducing apoptosis | MTT assay | MDA-MB-231 | Cervical cancer | IC50 : 32.5 ± 0.5 μM |
| dbacp01893 | BPC194 | KKLKKFKKLQ | Synthetic Peptide | Inducing apoptosis | MTT assay | HeLa | Cervical cancer | IC50 : 29.5 ± 2 μM |
| dbacp01894 | BPC194 | KKLKKFKKLQ | Synthetic Peptide | Inducing apoptosis | MTT assay | HepG2 | Cervical cancer | IC50 : 46.0 ± 3 μM |
| dbacp01895 | BPC194 | KKLKKFKKLQ | Synthetic Peptide | Inducing apoptosis | MTT assay | A431 | Cervical cancer | IC50 : 50.0 ± 10 μM |
| dbacp01896 | BPC194 | KKLKKFKKLQ | Synthetic Peptide | Inducing apoptosis | MTT assay | Panc-1 | Cervical cancer | IC50 : 40.0 ± 3 Μm |
| dbacp01897 | BPC88 | KKLLKFKKLQ | Synthetic Peptide | Inducing apoptosis | MTT assay | MDA-MB-231 | Cervical cancer | IC50 : 31.2 ± 5 μM |
| dbacp01898 | BPC88 | KKLLKFKKLQ | Synthetic Peptide | Inducing apoptosis | MTT assay | HeLa | Cervical cancer | IC50 : 22.5 ± 0 μM |
| dbacp01899 | BPC88 | KKLLKFKKLQ | Synthetic Peptide | Inducing apoptosis | MTT assay | HepG2 | Cervical cancer | IC50 : 32.5 ± 4 μM |
| dbacp01900 | BPC88 | KKLLKFKKLQ | Synthetic Peptide | Inducing apoptosis | MTT assay | A431 | Cervical cancer | IC50 : 28.0 ± 3 μM |
| dbacp01901 | BPC88 | KKLLKFKKLQ | Synthetic Peptide | Inducing apoptosis | MTT assay | Panc-1 | Cervical cancer | IC50 : 32.5 ± 11 μM |
| dbacp01902 | BPC96 | LKLKKFKKLQ | Synthetic Peptide | Inducing apoptosis | MTT assay | MDA-MB-231 | Cervical cancer | IC50 : 40.0 ± 7 μM |
| dbacp01903 | BPC96 | LKLKKFKKLQ | Synthetic Peptide | Inducing apoptosis | MTT assay | HeLa | Cervical cancer | IC50 : 24.5 ± 0.7 μM |
| dbacp01904 | BPC96 | LKLKKFKKLQ | Synthetic Peptide | Inducing apoptosis | MTT assay | HepG2 | Cervical cancer | IC50 : 34.5 ± 2 μM |
| dbacp01905 | BPC96 | LKLKKFKKLQ | Synthetic Peptide | Inducing apoptosis | MTT assay | A431 | Cervical cancer | IC50 : 35.0 ± 7 μM |
| dbacp01906 | BPC96 | LKLKKFKKLQ | Synthetic Peptide | Inducing apoptosis | MTT assay | Panc-1 | Cervical cancer | IC50 : 51.0 ± 6 Μm |
| dbacp01907 | BPC98 | LLKKKFKKLQ | Synthetic Peptide | Inducing apoptosis | MTT assay | MDA-MB-231 | Cervical cancer | IC50 : 40.7 ± 3 μM |
| dbacp01908 | BPC98 | LLKKKFKKLQ | Synthetic Peptide | Inducing apoptosis | MTT assay | HeLa | Cervical cancer | IC50 : 38.5 ± 4 μM |
| dbacp01909 | BPC98 | LLKKKFKKLQ | Synthetic Peptide | Inducing apoptosis | MTT assay | HepG2 | Cervical cancer | IC50 : 44.0 ± 3 μM |
| dbacp01910 | BPC98 | LLKKKFKKLQ | Synthetic Peptide | Inducing apoptosis | MTT assay | A431 | Cervical cancer | IC50 : 47.5 ± 4 μM |
| dbacp01911 | BPC98 | LLKKKFKKLQ | Synthetic Peptide | Inducing apoptosis | MTT assay | Panc-1 | Cervical cancer | IC50 : 44.5 ± 0.7 Μm |
| dbacp01912 | BpirLAAO-I | ADDKNPLEEFRETNYEVFLEIAKNGLKATSNPKRVVIVGAGMAGLSAAY | Venom base | Inducing apoptosis | MTT assay | SKBR-3 | Breast cancer | Not found |
| dbacp01913 | BpirLAAO-I | ADDKNPLEEFRETNYEVFLEIAKNGLKATSNPKRVVIVGAGMAGLSAAY | Venom base | Inducing apoptosis | MTT assay | Jurkat | Acute T cell Leukemia | Not found |
| dbacp01914 | BpirLAAO-I | ADDKNPLEEFRETNYEVFLEIAKNGLKATSNPKRVVIVGAGMAGLSAAY | Venom base | Inducing apoptosis | MTT assay | EAT | Erlich ascitic tumor | Not found |
| dbacp01915 | BpirLAAO-I | ADDKNPLEEFRETNYEVFLEIAKNGLKATSNPKRVVIVGAGMAGLSAAY | Venom base | Inducing apoptosis | MTT assay | S180 | Tumor | Not found |
| dbacp01923 | Brevinin-1-AW | FLPLLAGLAANFLPQIICKIARKC | Skin secretion, the Wuyi torrent frog, China, Asia | Cell membrane penetration | MTT assay | PC-3 | Prostate cancer | IC50 : 33.46 μM |
| dbacp01941 | Brevinin-1H | FALGAVTKVLPKLFCLITRKC | Hainan Torrent Frog | Membrane disruption | MTT assay | H157 | Lung cancer | IC50 : 3.37 to 5.87 µM |
| dbacp01942 | Brevinin-1H | FALGAVTKVLPKLFCLITRKC | Hainan Torrent Frog | Membrane disruption | MTT assay | PC-3 | Prostate cancer | IC50 : 3.37 to 5.87 µM |
| dbacp01943 | Brevinin-1H | FALGAVTKVLPKLFCLITRKC | Hainan Torrent Frog | Membrane disruption | MTT assay | HCT116 | Human colorectal cancer | IC50 : 3.37 to 5.87 µM |
| dbacp01944 | Brevinin-1H | FALGAVTKVLPKLFCLITRKC | Hainan Torrent Frog | Membrane disruption | MTT assay | U251MG | Human glioblastoma astrocytoma | IC50 : 3.37 to 5.87 µM |
| dbacp01958 | Brevinin-2KP | GVITDALKGAAKTVAAELLKKAHCKLTNSC | Skin, the banded bullfrog, common Asian frog, Asia | Membranolytic mechanism | MTT assay | Not found | Not found | IC50 : 3.27 - 59.75 μM |
| dbacp02106 | Buthus Occitanus RK1 | IDCSKVNLTAECSS | Common yellow scorpion RK1 | Reduce cell proliferation and migration | MTT assay, Cell proliferation assay | U87 | EpCAM-expressing cells | MIC 50 : approx. 2 µM |
| dbacp02107 | Buthus Occitanus RK1 | IDCSKVNLTAECSS | Common yellow scorpion RK1 | Reduce cell proliferation and migration | MTT assay, Cell proliferation assay | IGR39 | EpCAM-expressing cells | MIC 50 : approx. 2 µM |
| dbacp02108 | cMastoparan-C(cMP-C) | CLNLKALLAVAKKILC | Synthetic construct | Apoptosis | MTT assay | H157 | Non-small cell Lung cancer | IC50 : 7.02 μM |
| dbacp02109 | cMastoparan-C(cMP-C) | CLNLKALLAVAKKILC | Synthetic construct | Apoptosis | MTT assay | MBD-MB-435S | Melanocyte | IC50 : 13.87 μM |
| dbacp02110 | cMastoparan-C(cMP-C) | CLNLKALLAVAKKILC | Synthetic construct | Apoptosis | MTT assay | PC-3 | Human prostate carcinoma | IC50 : 13.87 μM |
| dbacp02111 | cMastoparan-C(cMP-C) | CLNLKALLAVAKKILC | Synthetic construct | Apoptosis | MTT assay | U251-MG | Human glioblastoma astrocytoma | IC50 : 8.56 μM |
| dbacp02112 | cMastoparan-C(cMP-C) | CLNLKALLAVAKKILC | Synthetic construct | Apoptosis | MTT assay | MCF-7 | Human breast cancer | IC50 : 13.66 μM |
| dbacp02274 | CAMP1 | HVLFFFFNH2 | Synthetic | Cell membrane penetrating | MTT assay | UM-UC-5 | Not specified | IC50 : >100 μM |
| dbacp02275 | CAMP1 | HVLFFFFNH2 | Synthetic | Cell membrane penetrating | MTT assay | A549 | Not specified | IC50 : 12.39 μM |
| dbacp02276 | CAMP2 | HVLLFFFFNH2 | Synthetic | Cell membrane penetrating | MTT assay | UM-UC-5 | Not specified | IC50 : 21.61 μM |
| dbacp02277 | CAMP2 | HVLLFFFFNH2 | Synthetic | Cell membrane penetrating | MTT assay | A549 | Not specified | IC50 : 5.77μM |
| dbacp02278 | CAMP3 | HVLFFFFLFFNH2 | Synthetic | Cell membrane penetrating | MTT assay | UM-UC-5 | Not specified | IC50 : >100 μM |
| dbacp02279 | CAMP3 | HVLFFFFLFFNH2 | Synthetic | Cell membrane penetrating | MTT assay | A549 | Not specified | IC50 : 17.63μM |
| dbacp02280 | CAMP5 | HVLLLLLLLFNH2 | Synthetic | Cell membrane penetrating | MTT assay | UM-UC-5 | Not specified | IC50 : >100 μM |
| dbacp02281 | CAMP5 | HVLLLLLLLFNH2 | Synthetic | Cell membrane penetrating | MTT assay | A549 | Not specified | IC50 : 19.65 μM |
| dbacp02282 | CAMP7 | HVLLLLFFFFNH2 | Synthetic | Cell membrane penetrating | MTT assay | UM-UC-5 | Not specified | IC50 : >100 μM |
| dbacp02283 | CAMP7 | HVLLLLFFFFNH2 | Synthetic | Cell membrane penetrating | MTT assay | A549 | Not specified | IC50 : >100 μM |
| dbacp02431 | ChaC1 (Chassatide C1; Plant defensin) | GDACGETCFTGICFTAGCSCNPWPTCTRN | Beras-beras | Not specified | MTT assay | HeLa cells | Not found | IC50 : 9.8 µM |
| dbacp02433 | ChaC10 (Chassatide C10; Plant defensin) | GEYCGESCYLIPCFTPGCYCVSRQCVNKN | Beras-beras | Not specified | MTT assay | HeLa cells | Not found | IC50 : 5.0 µM |
| dbacp02437 | ChaC2 (Chassatide C2; Plant defensin) | GIPCAESCVWIPPCTITALMGCSCKNNVCYNN | Beras-beras | Not specified | MTT assay | HeLa cells | Not found | IC50 : 2.4 µM |
| dbacp02439 | ChaC4 (Chassatide C4; Plant defensin) | GASCGETCFTGICFTAGCSCNPWPTCTRN | Beras-beras | Not specified | MTT assay | HeLa cells | Not found | IC50 : 9.8 µM |
| dbacp02458 | Chartergellus-CP1 peptide | IIGTILGLLKSLNH2 | Social wasp | Apoptosis inducing | MTT assay | A375 | Human melanoma | IC50 : 40.5 µg/mL |
| dbacp02459 | Chartergellus-CP1 peptide | IIGTILGLLKSLNH2 | Social wasp | Apoptosis inducing; Intracellular ROS formation | MTT assay | MNT-1 | Human melanoma | IC50 : 51.6 µg/mL |
| dbacp02478 | ChMAP-28 | GRFKRFRKKLKRLWHKVGPFVGPILHY | Domestic goat | Cause cell membrane permeability; Induce necrotic death | Cytotoxic Activity assay, Lactate dehydrogenase (LDH)-Releaseassay, MTT assay | HL-60 | Acute promyelocytic leukemia | IC50 : 3.39 ± 0.15 μM |
| dbacp02479 | ChMAP-28 | GRFKRFRKKLKRLWHKVGPFVGPILHY | Domestic goat | Cause cell membrane permeability; Induce necrotic death | Cytotoxic Activity assay, Lactate dehydrogenase (LDH)-Releaseassay, MTT assay | A431 | Human epidermoid carcinoma | IC50 : 6.49 ± 0.09 μM |
| dbacp02480 | ChMAP-28 | GRFKRFRKKLKRLWHKVGPFVGPILHY | Domestic goat | Cause cell membrane permeability; Induce necrotic death | Cytotoxic Activity assay, Lactate dehydrogenase (LDH)-Releaseassay, MTT assay | B16F1 | Murine melanoma | IC50 : 4.82 ± 1.01μM |
| dbacp02481 | ChMAP-28 | GRFKRFRKKLKRLWHKVGPFVGPILHY | Domestic goat | Cause cell membrane permeability; Induce necrotic death | Cytotoxic Activity assay, Lactate dehydrogenase (LDH)-Releaseassay, MTT assay | SKBR-3 | Human breast adenocarcinoma | IC50 : 5.63 ± 1.05μM |
| dbacp02517 | Cliotide T1 (cT1; Plant defensin) | GIPCGESCVFIPCITAAIGCSCKSKVCYRN | Butterfly pea | Not specified | MTT assay | HeLa cells | Not found | IC50 : 0.6 µM |
| dbacp02523 | Cliotide T2 (cT2; Plant defensin) | GEFLKCGESCVQGECYTPGCSCDWPICKKN | Butterfly pea | Not specified | MTT assay | HeLa cells | Not found | IC50 : 8.0 µM |
| dbacp02526 | Cliotide T3 (cT3; Plant defensin) | GLPTCGETCTLGTCYVPDCSCSWPICMKN | Butterfly pea | Not specified | MTT assay | HeLa cells | Not found | IC50 : 2.0 µM |
| dbacp02529 | Cliotide T4 (cT4; Plant defensin) | GIPCGESCVFIPCITGAIGCSCKSKVCYRN | Butterfly pea | Not specified | MTT assay | HeLa cells | Not found | IC50 : 0.6 µM |
| dbacp02541 | Conotoxin Cl14.1a (Conotoxin Cal14.1a) | MNVTAMFIVLLLTMPLTDGFNIRAINGGELFGLVQRDAGNALDHGFYRRGDCPPWCVGARCRAEKC | California cone | Apoptosis | MTT assay | H1299 | Non-small cell Lung cancer | Not found |
| dbacp02542 | Conotoxin Cl14.1a (Conotoxin Cal14.1a) | MNVTAMFIVLLLTMPLTDGFNIRAINGGELFGLVQRDAGNALDHGFYRRGDCPPWCVGARCRAEKC | California cone | Apoptosis | MTT assay | H1437 | Non-small cell Lung cancer | Not found |
| dbacp02543 | Conotoxin Cl14.1a (Conotoxin Cal14.1a) | MNVTAMFIVLLLTMPLTDGFNIRAINGGELFGLVQRDAGNALDHGFYRRGDCPPWCVGARCRAEKC | California cone | Apoptosis | MTT assay | H1975 | Non-small cell Lung cancer | Not found |
| dbacp02544 | Conotoxin Cl14.1a (Conotoxin Cal14.1a) | MNVTAMFIVLLLTMPLTDGFNIRAINGGELFGLVQRDAGNALDHGFYRRGDCPPWCVGARCRAEKC | California cone | Apoptosis | MTT assay | H661 | Non-small cell Lung cancer | Not found |
| dbacp02556 | CPP2 | HVRRRRRRRNH2 | Synthetic | Cell membrane penetrating | MTT assay | UM-UC-A | Not specified | IC50 : 5.47 μM |
| dbacp02557 | CPP2 | HVRRRRRRRNH2 | Synthetic | Cell membrane penetrating | MTT assay | A549 | Not specified | IC50 : >100 μM |
| dbacp02558 | CPP4 | HVRRRRRRRRNH2 | Synthetic | Cell membrane penetrating | MTT assay | UM-UC-5 | Not specified | IC50 : >100 μM |
| dbacp02559 | CPP4 | HVRRRRRRRRNH2 | Synthetic | Cell membrane penetrating | MTT assay | A549 | Not specified | IC50 : >100 μM |
| dbacp02560 | Cr-AcACP1 | AW(Ac)KLFDDGV | Not found | Inducing apoptosis | MTT assay | Not found | Colon carcinoma | Not found |
| dbacp02562 | Cr-ACP1 | AWKLFDDGV | Not found | Inducing apoptosis | MTT assay | Hep2 | Human epidermoid cancer | IC50 : 1.5 mM |
| dbacp02564 | CRAMP-18 E2K | GKKLKKIGQKIKNFFQKL | Synthetic | Disrupt cell membrane structure | MTT assay | K-562 | Chronic myelogenous Leukemia | IC50 : 20–34 uM |
| dbacp02565 | CRAMP-18 E2K | GKKLKKIGQKIKNFFQKL | Synthetic | Disrupt cell membrane structure | MTT assay | Jurkat | Acute T cell Leukemia | IC50 : 20–34 uM |
| dbacp02566 | CRAMP-18 E2K | GKKLKKIGQKIKNFFQKL | Synthetic | Disrupt cell membrane structure | MTT assay | K-549 | Acute T cell Leukemia | IC50 : 20–34 uM |
| dbacp02577 | Crotamine | MKILYLLFAFLFLAFLSEPGNAYKQCHKKGGHCFPKEKICLPPSSDFGKMDCRWRWKCCKKGSGK | South American rattlesnake | Cell membrane penetration and lysis | MTT assay | CHO-K1 | Not specified | IC50 : 5 μM |
| dbacp02608 | Cytotoxin drCT-1 | LKCNKLVPLFYKTCPAGKNL | Not found | Inducing apoptosis | MTT assay | U937 | Leukemia | IC50 : 8.9 µg/ml |
| dbacp02609 | Cytotoxin drCT-1 | LKCNKLVPLFYKTCPAGKNL | Not found | Inducing apoptosis | MTT assay | K562 | Leukemia | IC50 : 6.7 µg/ml |
| dbacp02637 | Decoralin | SLLSLIRKLI | Solitary eumenine wasp | Mediate necrosis | MTT assay | MCF-7 | Breast cancer | IC50 : 12.5 μmolL−1 |
| dbacp02644 | Defensin-like protein (Sesquin) | KTCENLADTY | Yard-Long bean | Anti-proliferative action | MTT assay | M1 | Breast cancer | MIC : 0.125 μg/ml |
| dbacp02645 | Defensin-like protein (Sesquin) | KTCENLADTY | Yard-Long bean | Anti-proliferative action | MTT assay | MCF-7 | Leukemia | MIC : 0.25 μg/ml |
| dbacp02651 | Dermaseptin PS4 | MDILKKSIFLVLFLGLVSLSICEEEKRENEDEEKQEDDEQSEEKRALWKTLLKHVGKAAGKAALNAVTDMVNQGEQ | Sauvage's leaf frog | Membrane disruption | Lactate dehydrogenase (LDH) cytotoxicity assay, MTT assay | MDA-MB-435S | Lung cancer | MIC : 10−9 to 10−4 M |
| dbacp02652 | Dermaseptin PS4 | MDILKKSIFLVLFLGLVSLSICEEEKRENEDEEKQEDDEQSEEKRALWKTLLKHVGKAAGKAALNAVTDMVNQGEQ | Sauvage's leaf frog | Membrane disruption | Lactate dehydrogenase (LDH) cytotoxicity assay, MTT assay | H157 | Glioma | MIC : 10−9 to 10−4 M |
| dbacp02653 | Dermaseptin PS4 | MDILKKSIFLVLFLGLVSLSICEEEKRENEDEEKQEDDEQSEEKRALWKTLLKHVGKAAGKAALNAVTDMVNQGEQ | Sauvage's leaf frog | Membrane disruption | Lactate dehydrogenase (LDH) cytotoxicity assay, MTT assay | PC-3 | Prostate cancer | MIC : 10−9 to 10−4 M |
| dbacp02654 | Dermaseptin PS4 | MDILKKSIFLVLFLGLVSLSICEEEKRENEDEEKQEDDEQSEEKRALWKTLLKHVGKAAGKAALNAVTDMVNQGEQ | Sauvage's leaf frog | Membrane disruption | Lactate dehydrogenase (LDH) cytotoxicity assay, MTT assay | MCF-7 | Breast cancer | MIC : 10−9 to 10−4 M |
| dbacp02666 | Dermaseptin-PD-1 | GMWSKIKETAMAAAKEAAKAAGKTISDMIKQ | Skin Secretion, Mexican leaf frog, Mexico, North America | Destroy plasma membrane | MTT assay | H157 | Human non-small cell Lung cancer | IC50 : 10-4 and 10-9 M |
| dbacp02667 | Dermaseptin-PD-1 | GMWSKIKETAMAAAKEAAKAAGKTISDMIKQ | Skin Secretion, Mexican leaf frog, Mexico, North America | Destroy plasma membrane | MTT assay | PC-3 | Human prostate carcinoma | IC50 : 10-4 and 10-9 M |
| dbacp02668 | Dermaseptin-PD-1 | GMWSKIKETAMAAAKEAAKAAGKTISDMIKQ | Skin Secretion, Mexican leaf frog, Mexico, North America | Destroy plasma membrane | MTT assay | U251MG | Human neuronal glioblastoma | IC50 : 15.08 μM |
| dbacp02669 | Dermaseptin-PD-2 | GMWSKIKNAGKAAAKAAAKAAGKAALDAVSEAI | Skin Secretion, Mexican leaf frog, Mexico, North America | Destroy plasma membrane | MTT assay | H157 | Human non-small cell lung cancer | IC50 : 6.43 μM |
| dbacp02670 | Dermaseptin-PD-2 | GMWSKIKNAGKAAAKAAAKAAGKAALDAVSEAI | Skin Secretion, Mexican leaf frog, Mexico, North America | Destroy plasma membrane | MTT assay | PC-3 | Human prostate carcinoma | IC50 : 3.17 μM |
| dbacp02671 | Dermaseptin-PD-2 | GMWSKIKNAGKAAAKAAAKAAGKAALDAVSEAI | Skin Secretion, Mexican leaf frog, Mexico, North America | Destroy plasma membrane | MTT assay | U251MG | Human neuronal glioblastoma | IC50 : 13.43 μM |
| dbacp02672 | Dermaseptin-PD1 | GMWSKIKETAMAAAKEAAKAAGKTISDMIKQ | Mexican leaf frog | Destroy plasma membrane | MTT assay | H157 | Neuronal glioblastoma | IC50 : 6.43 μM |
| dbacp02673 | Dermaseptin-PD1 | GMWSKIKETAMAAAKEAAKAAGKTISDMIKQ | Mexican leaf frog | Destroy plasma membrane | MTT assay | PC-3 | Prostate carcinoma | IC50 : 3.17 μM |
| dbacp02674 | Dermaseptin-PD1 | GMWSKIKETAMAAAKEAAKAAGKTISDMIKQ | Mexican leaf frog | Destroy plasma membrane | MTT assay | U251MG | Breast cancer | IC50 : 13.43 μM |
| dbacp02675 | Dermaseptin-PD2 | GMWSKIKNAGKAAAKAAAKAAGKAALDAVSEAI | Mexican leaf frog | Destroy plasma membrane | MTT assay | H157 | Neuronal glioblastoma | IC50 : 6.43 μM |
| dbacp02676 | Dermaseptin-PD2 | GMWSKIKNAGKAAAKAAAKAAGKAALDAVSEAI | Mexican leaf frog | Destroy plasma membrane | MTT assay | PC-3 | Prostate carcinoma | IC50 : 3.17 μM |
| dbacp02677 | Dermaseptin-PD2 | GMWSKIKNAGKAAAKAAAKAAGKAALDAVSEAI | Mexican leaf frog | Destroy plasma membrane | MTT assay | U251MG | Breast cancer | IC50 : 13.43 μM |
| dbacp02688 | Dermaseptin-PH | MDILKKSLFLILFLGVVSLSICEEEKRENEEEMEQDDEQSEMKRALWKEVLKNAGKAALNEINNLVQGGQ | Northern orange-legged leaf frog | Disruption of cell membranes | MTT assay, Lactate dehydrogenase (LDH) assay | U251MG | Neuronal glioblastoma | IC50 : 17.44 - 49.51 μM |
| dbacp02689 | Dermaseptin-PH | MDILKKSLFLILFLGVVSLSICEEEKRENEEEMEQDDEQSEMKRALWKEVLKNAGKAALNEINNLVQGGQ | Northern orange-legged leaf frog | Disruption of cell membranes | MTT assay, Lactate dehydrogenase (LDH) assay | MCF-7 | Breast cancer | IC50 : 17.44 - 49.51 μM |
| dbacp02690 | Dermaseptin-PH | MDILKKSLFLILFLGVVSLSICEEEKRENEEEMEQDDEQSEMKRALWKEVLKNAGKAALNEINNLVQGGQ | Northern orange-legged leaf frog | Disruption of cell membranes | MTT assay, Lactate dehydrogenase (LDH) assay | PANC-1 | Pancreatic cancer | IC50 : 17.44 - 49.51 μM |
| dbacp02691 | Dermaseptin-PH | MDILKKSLFLILFLGVVSLSICEEEKRENEEEMEQDDEQSEMKRALWKEVLKNAGKAALNEINNLVQGGQ | Northern orange-legged leaf frog | Disruption of cell membranes | MTT assay, Lactate dehydrogenase (LDH) assay | NCl-H157 | Lung cancer | IC50 : 17.44 - 49.51 μM |
| dbacp02692 | Dermaseptin-PH | MDILKKSLFLILFLGVVSLSICEEEKRENEEEMEQDDEQSEMKRALWKEVLKNAGKAALNEINNLVQGGQ | Northern orange-legged leaf frog | Disruption of cell membranes | MTT assay, Lactate dehydrogenase (LDH) assay | PC-3 | Prostate carcinoma | IC50 : 17.44 - 49.51 μM |
| dbacp02693 | Dermaseptin-PH (DRS-PH) | MDILKKSLFLILFLGVVSLSICEEEKRENEEEMEQDDEQSEMKRALWKEVLKNAGKAALNEINNLVQGGQ | Northern orange-legged leaf frog | Disruption of cell membranes | MTT assay | MCF-7 | Brain tumor | IC50 : 7.44 μM |
| dbacp02694 | Dermaseptin-PH (DRS-PH) | MDILKKSLFLILFLGVVSLSICEEEKRENEEEMEQDDEQSEMKRALWKEVLKNAGKAALNEINNLVQGGQ | Northern orange-legged leaf frog | Disruption of cell membranes | MTT assay | MCF-7 | Breast cancer | IC50 : 7.44 μM |
| dbacp02695 | Dermaseptin-PH (DRS-PH) | MDILKKSLFLILFLGVVSLSICEEEKRENEEEMEQDDEQSEMKRALWKEVLKNAGKAALNEINNLVQGGQ | Northern orange-legged leaf frog | Disruption of cell membranes | MTT assay | MCF-7 | pancreatic cancer | IC50 : 7.44 μM |
| dbacp02696 | Dermaseptin-PH (DRS-PH) | MDILKKSLFLILFLGVVSLSICEEEKRENEEEMEQDDEQSEMKRALWKEVLKNAGKAALNEINNLVQGGQ | Northern orange-legged leaf frog | Disruption of cell membranes | MTT assay | MCF-7 | Lung cancer | IC50 : 7.44 μM |
| dbacp02697 | Dermaseptin-PH (DRS-PH) | MDILKKSLFLILFLGVVSLSICEEEKRENEEEMEQDDEQSEMKRALWKEVLKNAGKAALNEINNLVQGGQ | Northern orange-legged leaf frog | Disruption of cell membranes | MTT assay | MCF-7 | Prostate cancer | IC50 : 7.44 μM |
| dbacp02698 | Dermaseptin-PH (DRS-PH) | MDILKKSLFLILFLGVVSLSICEEEKRENEEEMEQDDEQSEMKRALWKEVLKNAGKAALNEINNLVQGGQ | Northern orange-legged leaf frog | Disruption of cell membranes | MTT assay | U251MG | Brain tumor | IC50 : 49.51 μM |
| dbacp02699 | Dermaseptin-PH (DRS-PH) | MDILKKSLFLILFLGVVSLSICEEEKRENEEEMEQDDEQSEMKRALWKEVLKNAGKAALNEINNLVQGGQ | Northern orange-legged leaf frog | Disruption of cell membranes | MTT assay | U251MG | Breast cancer | IC50 : 49.51 μM |
| dbacp02700 | Dermaseptin-PH (DRS-PH) | MDILKKSLFLILFLGVVSLSICEEEKRENEEEMEQDDEQSEMKRALWKEVLKNAGKAALNEINNLVQGGQ | Northern orange-legged leaf frog | Disruption of cell membranes | MTT assay | U251MG | Pancreatic cancer | IC50 : 49.51 μM |
| dbacp02701 | Dermaseptin-PH (DRS-PH) | MDILKKSLFLILFLGVVSLSICEEEKRENEEEMEQDDEQSEMKRALWKEVLKNAGKAALNEINNLVQGGQ | Northern orange-legged leaf frog | Disruption of cell membranes | MTT assay | U251MG | Lung cancer | IC50 : 49.51 μM |
| dbacp02702 | Dermaseptin-PH (DRS-PH) | MDILKKSLFLILFLGVVSLSICEEEKRENEEEMEQDDEQSEMKRALWKEVLKNAGKAALNEINNLVQGGQ | Northern orange-legged leaf frog | Disruption of cell membranes | MTT assay | U251MG | Prostate cancer | IC50 : 49.51 μM |
| dbacp02703 | Dermaseptin-PH (DRS-PH) | MDILKKSLFLILFLGVVSLSICEEEKRENEEEMEQDDEQSEMKRALWKEVLKNAGKAALNEINNLVQGGQ | Northern orange-legged leaf frog | Disruption of cell membranes | MTT assay | H157 | Brain tumor | IC50 : 25.51 μM |
| dbacp02704 | Dermaseptin-PH (DRS-PH) | MDILKKSLFLILFLGVVSLSICEEEKRENEEEMEQDDEQSEMKRALWKEVLKNAGKAALNEINNLVQGGQ | Northern orange-legged leaf frog | Disruption of cell membranes | MTT assay | H157 | Breast cancer | IC50 : 25.51 μM |
| dbacp02705 | Dermaseptin-PH (DRS-PH) | MDILKKSLFLILFLGVVSLSICEEEKRENEEEMEQDDEQSEMKRALWKEVLKNAGKAALNEINNLVQGGQ | Northern orange-legged leaf frog | Disruption of cell membranes | MTT assay | H157 | Pancreatic cancer | IC50 : 25.51 μM |
| dbacp02706 | Dermaseptin-PH (DRS-PH) | MDILKKSLFLILFLGVVSLSICEEEKRENEEEMEQDDEQSEMKRALWKEVLKNAGKAALNEINNLVQGGQ | Northern orange-legged leaf frog | Disruption of cell membranes | MTT assay | H157 | Lung cancer | IC50 : 25.51 μM |
| dbacp02707 | Dermaseptin-PH (DRS-PH) | MDILKKSLFLILFLGVVSLSICEEEKRENEEEMEQDDEQSEMKRALWKEVLKNAGKAALNEINNLVQGGQ | Northern orange-legged leaf frog | Disruption of cell membranes | MTT assay | H157 | Prostate cancer | IC50 : 25.51 μM |
| dbacp02708 | Dermaseptin-PH (DRS-PH) | MDILKKSLFLILFLGVVSLSICEEEKRENEEEMEQDDEQSEMKRALWKEVLKNAGKAALNEINNLVQGGQ | Northern orange-legged leaf frog | Disruption of cell membranes | MTT assay | PC-3 | Brain tumor | IC50 : 21.78 μM |
| dbacp02709 | Dermaseptin-PH (DRS-PH) | MDILKKSLFLILFLGVVSLSICEEEKRENEEEMEQDDEQSEMKRALWKEVLKNAGKAALNEINNLVQGGQ | Northern orange-legged leaf frog | Disruption of cell membranes | MTT assay | PC-3 | Breast cancer | IC50 : 21.78 μM |
| dbacp02710 | Dermaseptin-PH (DRS-PH) | MDILKKSLFLILFLGVVSLSICEEEKRENEEEMEQDDEQSEMKRALWKEVLKNAGKAALNEINNLVQGGQ | Northern orange-legged leaf frog | Disruption of cell membranes | MTT assay | PC-3 | Pancreatic cancer | IC50 : 21.78 μM |
| dbacp02711 | Dermaseptin-PH (DRS-PH) | MDILKKSLFLILFLGVVSLSICEEEKRENEEEMEQDDEQSEMKRALWKEVLKNAGKAALNEINNLVQGGQ | Northern orange-legged leaf frog | Disruption of cell membranes | MTT assay | PC-3 | Lung cancer | IC50 : 21.78 μM |
| dbacp02712 | Dermaseptin-PH (DRS-PH) | MDILKKSLFLILFLGVVSLSICEEEKRENEEEMEQDDEQSEMKRALWKEVLKNAGKAALNEINNLVQGGQ | Northern orange-legged leaf frog | Disruption of cell membranes | MTT assay | PC-3 | Prostate cancer | IC50 : 21.78 μM |
| dbacp02713 | Dermaseptin-PH (DRS-PH) | MDILKKSLFLILFLGVVSLSICEEEKRENEEEMEQDDEQSEMKRALWKEVLKNAGKAALNEINNLVQGGQ | Northern orange-legged leaf frog | Disruption of cell membranes | MTT assay | PANC-1 | Brain tumor | IC50 : 28.95 μM |
| dbacp02714 | Dermaseptin-PH (DRS-PH) | MDILKKSLFLILFLGVVSLSICEEEKRENEEEMEQDDEQSEMKRALWKEVLKNAGKAALNEINNLVQGGQ | Northern orange-legged leaf frog | Disruption of cell membranes | MTT assay | PANC-1 | Breast cancer | IC50 : 28.95 μM |
| dbacp02715 | Dermaseptin-PH (DRS-PH) | MDILKKSLFLILFLGVVSLSICEEEKRENEEEMEQDDEQSEMKRALWKEVLKNAGKAALNEINNLVQGGQ | Northern orange-legged leaf frog | Disruption of cell membranes | MTT assay | PANC-1 | Pancreatic cancer | IC50 : 28.95 μM |
| dbacp02716 | Dermaseptin-PH (DRS-PH) | MDILKKSLFLILFLGVVSLSICEEEKRENEEEMEQDDEQSEMKRALWKEVLKNAGKAALNEINNLVQGGQ | Northern orange-legged leaf frog | Disruption of cell membranes | MTT assay | PANC-1 | Lung cancer | IC50 : 28.95 μM |
| dbacp02717 | Dermaseptin-PH (DRS-PH) | MDILKKSLFLILFLGVVSLSICEEEKRENEEEMEQDDEQSEMKRALWKEVLKNAGKAALNEINNLVQGGQ | Northern orange-legged leaf frog | Disruption of cell membranes | MTT assay | PANC-1 | Prostate cancer | IC50 : 28.95 μM |
| dbacp02718 | Dermaseptin-PH (DRS-PH) | MDILKKSLFLILFLGVVSLSICEEEKRENEEEMEQDDEQSEMKRALWKEVLKNAGKAALNEINNLVQGGQ | Northern orange-legged leaf frog | Disruption of cell membranes | MTT assay | HMEC-1 | Brain tumor | IC50 : 51.04 μM |
| dbacp02719 | Dermaseptin-PH (DRS-PH) | MDILKKSLFLILFLGVVSLSICEEEKRENEEEMEQDDEQSEMKRALWKEVLKNAGKAALNEINNLVQGGQ | Northern orange-legged leaf frog | Disruption of cell membranes | MTT assay | HMEC-1 | Breast cancer | IC50 : 51.04 μM |
| dbacp02720 | Dermaseptin-PH (DRS-PH) | MDILKKSLFLILFLGVVSLSICEEEKRENEEEMEQDDEQSEMKRALWKEVLKNAGKAALNEINNLVQGGQ | Northern orange-legged leaf frog | Disruption of cell membranes | MTT assay | HMEC-1 | Pancreatic cancer | IC50 : 51.04 μM |
| dbacp02721 | Dermaseptin-PH (DRS-PH) | MDILKKSLFLILFLGVVSLSICEEEKRENEEEMEQDDEQSEMKRALWKEVLKNAGKAALNEINNLVQGGQ | Northern orange-legged leaf frog | Disruption of cell membranes | MTT assay | HMEC-1 | Lung cancer | IC50 : 51.04 μM |
| dbacp02722 | Dermaseptin-PH (DRS-PH) | MDILKKSLFLILFLGVVSLSICEEEKRENEEEMEQDDEQSEMKRALWKEVLKNAGKAALNEINNLVQGGQ | Northern orange-legged leaf frog | Disruption of cell membranes | MTT assay | HMEC-1 | Prostate cancer | IC50 : 51.04 μM |
| dbacp02725 | Dermaseptin-PS3 | ALWKDILKNAGKAALNEINQIVQ | Skin, the waxy monkey tree frog, South America | Membrane rupture | MTT assay | H157 | Lung cancer | IC50 : 15.67 μM |
| dbacp02726 | Dermaseptin-PS3 | ALWKDILKNAGKAALNEINQIVQ | Skin, the waxy monkey tree frog, South America | Membrane rupture | MTT assay | PC3 | Human prostate carcinoma | IC50 : 18.20 μM |
| dbacp02727 | Dermaseptin-PS4 | ALWKTLLKHVGKAAGKAALNAVTDMVNQ | Waxy monkey tree frog | Membrane disruption | Lactate dehydrogenase (LDH) cytotoxicity assay, MTT assay | MDA-MB-435S | Lung cancer | MIC : 10−9 to 10−4 M |
| dbacp02728 | Dermaseptin-PS4 | ALWKTLLKHVGKAAGKAALNAVTDMVNQ | Waxy monkey tree frog | Membrane disruption | Lactate dehydrogenase (LDH) cytotoxicity assay, MTT assay | H157 | Glioma | MIC : 10−9 to 10−4 M |
| dbacp02729 | Dermaseptin-PS4 | ALWKTLLKHVGKAAGKAALNAVTDMVNQ | Waxy monkey tree frog | Membrane disruption | Lactate dehydrogenase (LDH) cytotoxicity assay, MTT assay | PC-3 | Prostate cancer | MIC : 10−9 to 10−4 M |
| dbacp02730 | Dermaseptin-PS4 | ALWKTLLKHVGKAAGKAALNAVTDMVNQ | Waxy monkey tree frog | Membrane disruption | Lactate dehydrogenase (LDH) cytotoxicity assay, MTT assay | MCF-7 | Breast cancer | MIC : 10−9 to 10−4 M |
| dbacp02731 | Dermaseptin-PT9 | GLWSKIKDAAKTAGKAALGFVNEMV | Brownbelly leaf frog | Disruption of cell membranes | MTT assay, Lactate dehydrogenase (LDH) assay | U251MG | Neuronal glioblastoma | IC50 : 8.64 - 18.51 μM |
| dbacp02732 | Dermaseptin-PT9 | GLWSKIKDAAKTAGKAALGFVNEMV | Brownbelly leaf frog | Disruption of cell membranes | MTT assay, Lactate dehydrogenase (LDH) assay | MCF-7 | Breast cancer | IC50 : 8.64 - 18.51 μM |
| dbacp02733 | Dermaseptin-PT9 | GLWSKIKDAAKTAGKAALGFVNEMV | Brownbelly leaf frog | Disruption of cell membranes | MTT assay, Lactate dehydrogenase (LDH) assay | PANC-1 | Pancreatic cancer | IC50 : 8.64 - 18.51 μM |
| dbacp02734 | Dermaseptin-PT9 | GLWSKIKDAAKTAGKAALGFVNEMV | Brownbelly leaf frog | Disruption of cell membranes | MTT assay, Lactate dehydrogenase (LDH) assay | NCl-H157 | Lung cancer | IC50 : 8.64 - 18.51 μM |
| dbacp02735 | Dermaseptin-PT9 | GLWSKIKDAAKTAGKAALGFVNEMV | Brownbelly leaf frog | Disruption of cell membranes | MTT assay, Lactate dehydrogenase (LDH) assay | PC-3 | Prostate carcinoma | IC50 : 8.64 - 18.51 μM |
| dbacp02736 | Dermaseptin-PT9 | GLWSKIKDAAKTAGKAALGFVNEMV | Skin secretion, Brownbelly leaf frog, Purchased in Peru, South America | Disruption of cell membranes | MTT assay, Lactate dehydrogenase (LDH) assay | U251MG | Neuronal glioblastoma | IC50 : 8.64 - 18.51 μM |
| dbacp02737 | Dermaseptin-PT9 | GLWSKIKDAAKTAGKAALGFVNEMV | Skin secretion, Brownbelly leaf frog, Purchased in Peru, South America | Disruption of cell membranes | MTT assay, Lactate dehydrogenase (LDH) assay | MCF-7 | Breast cancer | IC50 : 8.64 - 18.51 μM |
| dbacp02738 | Dermaseptin-PT9 | GLWSKIKDAAKTAGKAALGFVNEMV | Skin secretion, Brownbelly leaf frog, Purchased in Peru, South America | Disruption of cell membranes | MTT assay, Lactate dehydrogenase (LDH) assay | PANC-1 | Pancreatic cancer | IC50 : 8.64 - 18.51 μM |
| dbacp02739 | Dermaseptin-PT9 | GLWSKIKDAAKTAGKAALGFVNEMV | Skin secretion, Brownbelly leaf frog, Purchased in Peru, South America | Disruption of cell membranes | MTT assay, Lactate dehydrogenase (LDH) assay | NCl-H157 | Lung cancer | IC50 : 8.64 - 18.51 μM |
| dbacp02740 | Dermaseptin-PT9 | GLWSKIKDAAKTAGKAALGFVNEMV | Skin secretion, Brownbelly leaf frog, Purchased in Peru, South America | Disruption of cell membranes | MTT assay, Lactate dehydrogenase (LDH) assay | PC-3 | Prostate carcinoma | IC50 : 8.64 - 18.51 μM |
| dbacp02836 | Emericellipsin A | PQAAIVASG | **Emericellopsis alkaline** VKPM F1428, Alkalophile, extremophile | Disrupt cell membrane structures; Apoptosis | MTT assay | HeLa | Cervical cancer | EC50 : < 0.5 µM |
| dbacp02837 | Emericellipsin A | PQAAIVASG | **Emericellopsis alkaline** VKPM F1428, Alkalophile, extremophile | Disrupt cell membrane structures; Apoptosis | MTT assay | Hep G2 | Liver cancer | EC50 : 2.8 µM |
| dbacp02871 | Epinecidin-1 | GFIFHIIKGLFHAGKMIHGLV | Not found | Inducing apoptosis | MTT assay | U937 | Leukemia | Not found |
| dbacp02962 | FK-16 | FKRIVQRIKDFLRNLV | Not found | Inducing apoptosis | MTT assay | LoVo, HCT116 | Colon cancer | Not found |
| dbacp03034 | Galaxamide derivative (Compound 3) | cyclo(WnMLLLnML) | Marine invertebrates | Inducing apoptosis | MTT assay | HepG2 | Breast cancer | IC50 : 3.98 ± 0.71 μg/mL |
| dbacp03035 | Galaxamide derivative (Compound 3) | cyclo(WnMLLLnML) | Marine invertebrates | Inducing apoptosis | MTT assay | MCF-7 | Breast cancer | IC50 : 1.72 ± 0.85 μg/mL |
| dbacp03036 | Galaxamide derivative (Compound 3) | cyclo(WnMLLLnML) | Marine invertebrates | Inducing apoptosis | MTT assay | HeLa | Breast cancer | IC50 : 5.32 ± 0.42 μg/mL |
| dbacp03037 | Galaxamide derivative (Compound 3) | cyclo(WnMLLLnML) | Marine invertebrates | Inducing apoptosis | MTT assay | MD-MBA-231 | Breast cancer | IC50 :3.51 ± 1.32 μg/Ml |
| dbacp03038 | Galaxamide derivative Compound 1 | cyclo(FnMLLLnML) | Marine invertebrates | Inducing apoptosis | MTT assay | HepG2 | Breast cancer | IC50 : 6.25 ± 1.03 μg/mL |
| dbacp03039 | Galaxamide derivative Compound 1 | cyclo(FnMLLLnML) | Marine invertebrates | Inducing apoptosis | MTT assay | MCF-7 | Breast cancer | IC50 : 4.76 ± 1.36 μg/mL |
| dbacp03040 | Galaxamide derivative Compound 1 | cyclo(FnMLLLnML) | Marine invertebrates | Inducing apoptosis | MTT assay | HeLa | Breast cancer | IC50 : 13.22 ± 1.12 μg/mL |
| dbacp03041 | Galaxamide derivative Compound 1 | cyclo(FnMLLLnML) | Marine invertebrates | Inducing apoptosis | MTT assay | MD-MBA-231 | Breast cancer | IC50 : 5.83 ± 0.45 μg/M |
| dbacp03042 | Galaxamide derivative Compound 2 | cyclo(NAl-nMLLLnML) | Marine invertebrates | Inducing apoptosis | MTT assay | HepG2 | Breast cancer | IC50 : 8.42 ± 1.82 μg/mL |
| dbacp03043 | Galaxamide derivative Compound 2 | cyclo(NAl-nMLLLnML) | Marine invertebrates | Inducing apoptosis | MTT assay | MCF-7 | Breast cancer | IC50 : 3.16 ± 0.92 μg/mL |
| dbacp03044 | Galaxamide derivative Compound 2 | cyclo(NAl-nMLLLnML) | Marine invertebrates | Inducing apoptosis | MTT assay | HeLa | Breast cancer | IC50 : 6.43 ± 1.20 μg/mL |
| dbacp03045 | Galaxamide derivative Compound 2 | cyclo(NAl-nMLLLnML) | Marine invertebrates | Inducing apoptosis | MTT assay | MD-MBA-231 | Breast cancer | IC50 : 4.48 ± 2.24 μg/mL |
| dbacp03105 | GM15 | GGTCVIRGCVPKKLM | Not found | Inducing apoptosis | MTT assay | KB | Oral cancer | Not found |
| dbacp03174 | H-0, Hymenochirin-1B | IKLSPETKDNLKKVLKGAIKGAIAVAKMV | Congo dwarf clawed frog | Inducing apoptosis | MTT assay | A549 | Not found | IC50 : 15.22 ± 0.21 μM |
| dbacp03175 | H-0, Hymenochirin-1B | IKLSPETKDNLKKVLKGAIKGAIAVAKMV | Congo dwarf clawed frog | Inducing apoptosis | MTT assay | HCT116 | Not found | IC50 : 12.76 ± 0.43 μM |
| dbacp03176 | H-0, Hymenochirin-1B | IKLSPETKDNLKKVLKGAIKGAIAVAKMV | Congo dwarf clawed frog | Inducing apoptosis | MTT assay | HepG2 | Not found | IC50 : 8.07 ± 0.21 μM |
| dbacp03177 | H-11 | IKLSPETKKNLKKVLKGAIKGAIAVAKMV | Synthetic construct | Inducing apoptosis | MTT assay | A549 | Not found | IC50 : 1.82 ± 0.23 μM |
| dbacp03178 | H-11 | IKLSPETKKNLKKVLKGAIKGAIAVAKMV | Synthetic construct | Inducing apoptosis | MTT assay | HCT116 | Not found | IC50 : 6.50 ± 0.32 μM |
| dbacp03179 | H-11 | IKLSPETKKNLKKVLKGAIKGAIAVAKMV | Synthetic construct | Inducing apoptosis | MTT assay | HepG2 | Not found | IC50 : 4.96 ± 0.43 μM |
| dbacp03180 | H-12 | IKLSKETKDNLKKVLKGAIKGAIAVAKMV | Synthetic construct | Inducing apoptosis | MTT assay | A549 | Not found | IC50 : 2.35 ± 0.31 μM |
| dbacp03181 | H-12 | IKLSKETKDNLKKVLKGAIKGAIAVAKMV | Synthetic construct | Inducing apoptosis | MTT assay | HCT116 | Not found | IC50 : 8.09 ± 0.40 μM |
| dbacp03182 | H-12 | IKLSKETKDNLKKVLKGAIKGAIAVAKMV | Synthetic construct | Inducing apoptosis | MTT assay | HepG2 | Not found | IC50 : 4.28 ± 0.38 μM |
| dbacp03183 | H-13 | IKLSKETKKNLKKVLKGAIKGAIAVAKMV | Synthetic construct | Inducing apoptosis | MTT assay | A549 | Not found | IC50 : 1.17 ± 0.23 μM |
| dbacp03184 | H-13 | IKLSKETKKNLKKVLKGAIKGAIAVAKMV | Synthetic construct | Inducing apoptosis | MTT assay | HCT116 | Not found | IC50 : 4.93 ± 0.51 μM |
| dbacp03185 | H-13 | IKLSKETKKNLKKVLKGAIKGAIAVAKMV | Synthetic construct | Inducing apoptosis | MTT assay | HepG2 | Not found | IC50 : 2.46 ± 0.32 μM |
| dbacp03186 | H-14 | IKLSKKTKKNLKKVLKGAIKGAIAVAKMV | Synthetic construct | Inducing apoptosis | MTT assay | A549 | Not found | IC50 : 0.98 ± 0.11 μM |
| dbacp03187 | H-14 | IKLSKKTKKNLKKVLKGAIKGAIAVAKMV | Synthetic construct | Inducing apoptosis | MTT assay | HCT116 | Not found | IC50 : 1.841 ± 0.34 μM |
| dbacp03188 | H-14 | IKLSKKTKKNLKKVLKGAIKGAIAVAKMV | Synthetic construct | Inducing apoptosis | MTT assay | HepG2 | Not found | IC50 : 4.54 ± 0.25 μM |
| dbacp03283 | Hc-CATH | KFFKRLLKSVRRAVKKFRKKPRLIGLSTLL | Green paddy frog | Not specified | MTT assay | HepG2 | Liver cancer | 4.70% cell death at 200 µg/ml |
| dbacp03284 | Hc-CATH | KFFKRLLKSVRRAVKKFRKKPRLIGLSTLL | Green paddy frog | Not specified | MTT assay | HepG2 | Prostate cancer | 4.70% cell death at 200 µg/ml |
| dbacp03285 | Hc-CATH | KFFKRLLKSVRRAVKKFRKKPRLIGLSTLL | Green paddy frog | Not specified | MTT assay | PC-3 | Liver cancer | 3.63% cell death at 200 µg/ml |
| dbacp03286 | Hc-CATH | KFFKRLLKSVRRAVKKFRKKPRLIGLSTLL | Green paddy frog | Not specified | MTT assay | PC-3 | Prostate cancer | 3.63% cell death at 200 µg/ml |
| dbacp03287 | Hc-CATH | KFFKRLLKSVRRAVKKFRKKPRLIGLSTLL | Green paddy frog | Not specified | MTT assay | L929 | Liver cancer | 1.30% cell death at 200 µg/ml |
| dbacp03288 | Hc-CATH | KFFKRLLKSVRRAVKKFRKKPRLIGLSTLL | Green paddy frog | Not specified | MTT assay | L929 | Prostate cancer | 1.30% cell death at 200 µg/ml |
| dbacp03329 | Human A-defensin-1 (HNP1) | ACYCRIPACIAGERRYGTCIYQGRLWAFCC | Not found | Inducing apoptosis | MTT assay | A549 | Lung cancer | Not found |
| dbacp03330 | Human A-defensin-1 (HNP1) | ACYCRIPACIAGERRYGTCIYQGRLWAFCC | Not found | Inducing apoptosis | MTT assay | COS-7 | Lung cancer | Not found |
| dbacp03356 | Hymenochirin-1B | IKLSPETKDNLKKVLKGAIKGAIAVAKMV-NH2 | Zaire dwarf clawed frog | Induce apoptosis and cell cycle arrest | LDH release assay, MTT assay | NCI-H1299 | Lung cancer | MIC : 0 - 50 μM |
| dbacp03357 | Hymenochirin-1B | IKLSPETKDNLKKVLKGAIKGAIAVAKMV-NH3 | Zaire dwarf clawed frog | Induce apoptosis and cell cycle arrest | LDH release assay, MTT assay | A549 | Lung cancer | MIC : 0 - 50 μM |
| dbacp03358 | Hymenochirin-1B | IKLSPETKDNLKKVLKGAIKGAIAVAKMV-NH4 | Zaire dwarf clawed frog | Induce apoptosis and cell cycle arrest | LDH release assay, MTT assay | H460 | Lung cancer | MIC : 0 - 50 μM |
| dbacp03359 | Hymenochirin-1B | IKLSPETKDNLKKVLKGAIKGAIAVAKMV-NH5 | Zaire dwarf clawed frog | Induce apoptosis and cell cycle arrest | LDH release assay, MTT assay | HepG2 | Human hepatocellular carcinoma | MIC : 0 - 50 μM |
| dbacp03360 | Hymenochirin-1B | IKLSPETKDNLKKVLKGAIKGAIAVAKMV-NH6 | Zaire dwarf clawed frog | Induce apoptosis and cell cycle arrest | LDH release assay, MTT assay | PLC | Human hepatocellular carcinoma | MIC : 0 - 50 μM |
| dbacp03367 | Ichthyophthirius multifiliis (strain G5) B4 | LKKLFKKILKYL | White spot disease (strain G5) B4 | Apoptosis inducing; Penetration of the cell membrane | MTT assay | MCF-7 | Breast cancer | MIC : 5 μM |
| dbacp03368 | Ichthyophthirius multifiliis (strain G5) B4 | LKKLFKKILKYL | White spot disease (strain G5) B4 | Apoptosis inducing; Penetration of the cell membrane | MTT assay | K562 | Breast cancer | MIC : 5 μM |
| dbacp03369 | Ichthyophthirius multifiliis (strain G5) B8 | LKKLFKKILKY | White spot disease (strain G5) B8 | Apoptosis inducing; Penetration of the cell membrane | MTT assay | MCF-7 | Breast cancer | MIC : 7 μM |
| dbacp03370 | Ichthyophthirius multifiliis (strain G5) B8 | LKKLFKKILKY | White spot disease (strain G5) B8 | Apoptosis inducing; Penetration of the cell membrane | MTT assay | K562 | Breast cancer | MIC : 7 μM |
| dbacp03371 | Ichthyophthirius multifiliis BP100 | KKLFKKILKYL | White spot disease BP100 | Apoptosis inducing; Penetration of the cell membrane | MTT assay | MCF-7 | Breast cancer | MIC : 25 μM |
| dbacp03372 | Ichthyophthirius multifiliis BP100 | KKLFKKILKYL | White spot disease BP100 | Apoptosis inducing; Penetration of the cell membrane | MTT assay | K562 | Breast cancer | MIC : 25 μM |
| dbacp03380 | Imcroporin | FFSLLPSLIGGLVSAIK | Lesser brown scorpion | Cell membrane disintegration | MTT assay | EK293T | Not found | MIC : 50 µg/ml |
| dbacp03381 | Imcroporin | FFSLLPSLIGGLVSAIK | Lesser brown scorpion | Cell membrane disintegration | MTT assay | SMMC-7721 | Not found | MIC : 100 µg/ml |
| dbacp03473 | K4R2-Nal2-S1 | Ac-KKKKRR-NAl-NAl-KKWRKWLAKK-NH2 | Not found | Necrosis or apoptosis | MTT assay | PC9 | Human lung cancer | MIC : 25 μM |
| dbacp03474 | K4R2-Nal2-S1 | Ac-KKKKRR-NAl-NAl-KKWRKWLAKK-NH2 | Not found | Necrosis or apoptosis | MTT assay | PC9-G | Oral cancer | MIC : 25 μM |
| dbacp03475 | K4R2-Nal2-S1 | Ac-KKKKRR-NAl-NAl-KKWRKWLAKK-NH2 | Not found | Necrosis or apoptosis | MTT assay | A549 | Human lung cancer | MIC : 25 μM |
| dbacp03476 | K4R2-Nal2-S1 | Ac-KKKKRR-NAl-NAl-KKWRKWLAKK-NH2 | Not found | Necrosis or apoptosis | MTT assay | C9 | Oral cancer | MIC : 25 μM |
| dbacp03477 | K4R2-Nal2-S1 | Ac-KKKKRR-NAl-NAl-KKWRKWLAKK-NH2 | Not found | Necrosis or apoptosis | MTT assay | OECM-1 | Human lung cancer | MIC : 25 μM |
| dbacp03478 | K4R2-Nal2-S1 | Ac-KKKKRR-NAl-NAl-KKWRKWLAKK-NH2 | Not found | Necrosis or apoptosis | MTT assay | SAS | Oral cancer | MIC : 25 μM |
| dbacp03479 | K6-Nal2-S1 | Ac-KKKKKK-NAl-NAl-KKWRKWLAKK-NH2 | Not found | Necrosis or apoptosis | MTT assay | PC9 | Human lung cancer | MIC : 3.1 μM |
| dbacp03480 | K6-Nal2-S1 | Ac-KKKKKK-NAl-NAl-KKWRKWLAKK-NH2 | Not found | Necrosis or apoptosis | MTT assay | PC9-G | Oral cancer | MIC : 3.1 μM |
| dbacp03481 | K6-Nal2-S1 | Ac-KKKKKK-NAl-NAl-KKWRKWLAKK-NH2 | Not found | Necrosis or apoptosis | MTT assay | A549 | Human lung cancer | MIC : 3.1 μM |
| dbacp03482 | K6-Nal2-S1 | Ac-KKKKKK-NAl-NAl-KKWRKWLAKK-NH2 | Not found | Necrosis or apoptosis | MTT assay | C9 | Oral cancer | MIC : 3.1 μM |
| dbacp03483 | K6-Nal2-S1 | Ac-KKKKKK-NAl-NAl-KKWRKWLAKK-NH2 | Not found | Necrosis or apoptosis | MTT assay | OECM-1 | Human lung cancer | MIC : 3.1 μM |
| dbacp03484 | K6-Nal2-S1 | Ac-KKKKKK-NAl-NAl-KKWRKWLAKK-NH2 | Not found | Necrosis or apoptosis | MTT assay | SAS | Oral cancer | MIC : 3.1 μM |
| dbacp03485 | K8, 23-DPT9 | MDILKKSKFLILFLGVVSLSICKEEKRENEEEMEQDDEQSEMKRALWKEVLKNAGKAALNEINNLVQGGQ | Northern orange-legged leaf frog | Disruption of cell membranes | MTT assay | MCF-7 | Brain tumor | IC50 : 8.64μM |
| dbacp03486 | K8, 23-DPT9 | MDILKKSKFLILFLGVVSLSICKEEKRENEEEMEQDDEQSEMKRALWKEVLKNAGKAALNEINNLVQGGQ | Northern orange-legged leaf frog | Disruption of cell membranes | MTT assay | MCF-7 | Breast cancer | IC50 : 8.64μM |
| dbacp03487 | K8, 23-DPT9 | MDILKKSKFLILFLGVVSLSICKEEKRENEEEMEQDDEQSEMKRALWKEVLKNAGKAALNEINNLVQGGQ | Northern orange-legged leaf frog | Disruption of cell membranes | MTT assay | MCF-7 | Pancreatic cancer | IC50 : 8.64μM |
| dbacp03488 | K8, 23-DPT9 | MDILKKSKFLILFLGVVSLSICKEEKRENEEEMEQDDEQSEMKRALWKEVLKNAGKAALNEINNLVQGGQ | Northern orange-legged leaf frog | Disruption of cell membranes | MTT assay | MCF-7 | Lung cancer | IC50 : 8.64μM |
| dbacp03489 | K8, 23-DPT9 | MDILKKSKFLILFLGVVSLSICKEEKRENEEEMEQDDEQSEMKRALWKEVLKNAGKAALNEINNLVQGGQ | Northern orange-legged leaf frog | Disruption of cell membranes | MTT assay | MCF-7 | Prostate cancer | IC50 : 8.64μM |
| dbacp03490 | K8, 23-DPT9 | MDILKKSKFLILFLGVVSLSICKEEKRENEEEMEQDDEQSEMKRALWKEVLKNAGKAALNEINNLVQGGQ | Northern orange-legged leaf frog | Disruption of cell membranes | MTT assay | U251MG | Brain tumor | IC50 : 18.51μM |
| dbacp03491 | K8, 23-DPT9 | MDILKKSKFLILFLGVVSLSICKEEKRENEEEMEQDDEQSEMKRALWKEVLKNAGKAALNEINNLVQGGQ | Northern orange-legged leaf frog | Disruption of cell membranes | MTT assay | U251MG | Breast cancer | IC50 : 18.51μM |
| dbacp03492 | K8, 23-DPT9 | MDILKKSKFLILFLGVVSLSICKEEKRENEEEMEQDDEQSEMKRALWKEVLKNAGKAALNEINNLVQGGQ | Northern orange-legged leaf frog | Disruption of cell membranes | MTT assay | U251MG | Pancreatic cancer | IC50 : 18.51μM |
| dbacp03493 | K8, 23-DPT9 | MDILKKSKFLILFLGVVSLSICKEEKRENEEEMEQDDEQSEMKRALWKEVLKNAGKAALNEINNLVQGGQ | Northern orange-legged leaf frog | Disruption of cell membranes | MTT assay | U251MG | Lung cancer | IC50 : 18.51μM |
| dbacp03494 | K8, 23-DPT9 | MDILKKSKFLILFLGVVSLSICKEEKRENEEEMEQDDEQSEMKRALWKEVLKNAGKAALNEINNLVQGGQ | Northern orange-legged leaf frog | Disruption of cell membranes | MTT assay | U251MG | Prostate cancer | IC50 : 18.51μM |
| dbacp03495 | K8, 23-DPT9 | MDILKKSKFLILFLGVVSLSICKEEKRENEEEMEQDDEQSEMKRALWKEVLKNAGKAALNEINNLVQGGQ | Northern orange-legged leaf frog | Disruption of cell membranes | MTT assay | H157 | Brain tumor | IC50 : 9.88μM |
| dbacp03496 | K8, 23-DPT9 | MDILKKSKFLILFLGVVSLSICKEEKRENEEEMEQDDEQSEMKRALWKEVLKNAGKAALNEINNLVQGGQ | Northern orange-legged leaf frog | Disruption of cell membranes | MTT assay | H157 | Breast cancer | IC50 : 9.88μM |
| dbacp03497 | K8, 23-DPT9 | MDILKKSKFLILFLGVVSLSICKEEKRENEEEMEQDDEQSEMKRALWKEVLKNAGKAALNEINNLVQGGQ | Northern orange-legged leaf frog | Disruption of cell membranes | MTT assay | H157 | Pancreatic cancer | IC50 : 9.88μM |
| dbacp03498 | K8, 23-DPT9 | MDILKKSKFLILFLGVVSLSICKEEKRENEEEMEQDDEQSEMKRALWKEVLKNAGKAALNEINNLVQGGQ | Northern orange-legged leaf frog | Disruption of cell membranes | MTT assay | H157 | Lung cancer | IC50 : 9.88μM |
| dbacp03499 | K8, 23-DPT9 | MDILKKSKFLILFLGVVSLSICKEEKRENEEEMEQDDEQSEMKRALWKEVLKNAGKAALNEINNLVQGGQ | Northern orange-legged leaf frog | Disruption of cell membranes | MTT assay | H157 | Prostate cancer | IC50 : 9.88μM |
| dbacp03500 | K8, 23-DPT9 | MDILKKSKFLILFLGVVSLSICKEEKRENEEEMEQDDEQSEMKRALWKEVLKNAGKAALNEINNLVQGGQ | Northern orange-legged leaf frog | Disruption of cell membranes | MTT assay | PC-3 | Brain tumor | IC50 : 9.97μM |
| dbacp03501 | K8, 23-DPT9 | MDILKKSKFLILFLGVVSLSICKEEKRENEEEMEQDDEQSEMKRALWKEVLKNAGKAALNEINNLVQGGQ | Northern orange-legged leaf frog | Disruption of cell membranes | MTT assay | PC-3 | Breast cancer | IC50 : 9.97μM |
| dbacp03502 | K8, 23-DPT9 | MDILKKSKFLILFLGVVSLSICKEEKRENEEEMEQDDEQSEMKRALWKEVLKNAGKAALNEINNLVQGGQ | Northern orange-legged leaf frog | Disruption of cell membranes | MTT assay | PC-3 | Pancreatic cancer | IC50 : 9.97μM |
| dbacp03503 | K8, 23-DPT9 | MDILKKSKFLILFLGVVSLSICKEEKRENEEEMEQDDEQSEMKRALWKEVLKNAGKAALNEINNLVQGGQ | Northern orange-legged leaf frog | Disruption of cell membranes | MTT assay | PC-3 | Lung cancer | IC50 : 9.97μM |
| dbacp03504 | K8, 23-DPT9 | MDILKKSKFLILFLGVVSLSICKEEKRENEEEMEQDDEQSEMKRALWKEVLKNAGKAALNEINNLVQGGQ | Northern orange-legged leaf frog | Disruption of cell membranes | MTT assay | PC-3 | Prostate cancer | IC50 : 9.97μM |
| dbacp03505 | K8, 23-DPT9 | MDILKKSKFLILFLGVVSLSICKEEKRENEEEMEQDDEQSEMKRALWKEVLKNAGKAALNEINNLVQGGQ | Northern orange-legged leaf frog | Disruption of cell membranes | MTT assay | PANC-1 | Brain tumor | IC50 : 11.17μM |
| dbacp03506 | K8, 23-DPT9 | MDILKKSKFLILFLGVVSLSICKEEKRENEEEMEQDDEQSEMKRALWKEVLKNAGKAALNEINNLVQGGQ | Northern orange-legged leaf frog | Disruption of cell membranes | MTT assay | PANC-1 | Breast cancer | IC50 : 11.17μM |
| dbacp03507 | K8, 23-DPT9 | MDILKKSKFLILFLGVVSLSICKEEKRENEEEMEQDDEQSEMKRALWKEVLKNAGKAALNEINNLVQGGQ | Northern orange-legged leaf frog | Disruption of cell membranes | MTT assay | PANC-1 | Pancreatic cancer | IC50 : 11.17μM |
| dbacp03508 | K8, 23-DPT9 | MDILKKSKFLILFLGVVSLSICKEEKRENEEEMEQDDEQSEMKRALWKEVLKNAGKAALNEINNLVQGGQ | Northern orange-legged leaf frog | Disruption of cell membranes | MTT assay | PANC-1 | Lung cancer | IC50 : 11.17μM |
| dbacp03509 | K8, 23-DPT9 | MDILKKSKFLILFLGVVSLSICKEEKRENEEEMEQDDEQSEMKRALWKEVLKNAGKAALNEINNLVQGGQ | Northern orange-legged leaf frog | Disruption of cell membranes | MTT assay | PANC-1 | Prostate cancer | IC50 : 11.17μM |
| dbacp03510 | K8, 23-DPT9 | MDILKKSKFLILFLGVVSLSICKEEKRENEEEMEQDDEQSEMKRALWKEVLKNAGKAALNEINNLVQGGQ | Northern orange-legged leaf frog | Disruption of cell membranes | MTT assay | HMEC-1 | Brain tumor | IC50 : 48.80μM |
| dbacp03511 | K8, 23-DPT9 | MDILKKSKFLILFLGVVSLSICKEEKRENEEEMEQDDEQSEMKRALWKEVLKNAGKAALNEINNLVQGGQ | Northern orange-legged leaf frog | Disruption of cell membranes | MTT assay | HMEC-1 | Breast cancer | IC50 : 48.80μM |
| dbacp03512 | K8, 23-DPT9 | MDILKKSKFLILFLGVVSLSICKEEKRENEEEMEQDDEQSEMKRALWKEVLKNAGKAALNEINNLVQGGQ | Northern orange-legged leaf frog | Disruption of cell membranes | MTT assay | HMEC-1 | Pancreatic cancer | IC50 : 48.80μM |
| dbacp03513 | K8, 23-DPT9 | MDILKKSKFLILFLGVVSLSICKEEKRENEEEMEQDDEQSEMKRALWKEVLKNAGKAALNEINNLVQGGQ | Northern orange-legged leaf frog | Disruption of cell membranes | MTT assay | HMEC-1 | Lung cancer | IC50 : 48.80μM |
| dbacp03514 | K8, 23-DPT9 | MDILKKSKFLILFLGVVSLSICKEEKRENEEEMEQDDEQSEMKRALWKEVLKNAGKAALNEINNLVQGGQ | Northern orange-legged leaf frog | Disruption of cell membranes | MTT assay | HMEC-1 | Prostate cancer | IC50 : 48.80μM |
| dbacp03516 | Kassiniatuerin-3 | FIQHLIPLIPHAIQGIKDIF | Senegal running frog, Africa | Membranolytic mechanism | MTT assay | NCI-H23 | Non-small cell Lung cancer | IC50 : 4.52 µM |
| dbacp03517 | Kassiniatuerin-3 | FIQHLIPLIPHAIQGIKDIF | Senegal running frog, Africa | Membranolytic mechanism | MTT assay | NCI-H157 | Non-small cell Lung cancer | IC50 : 21.54 µM |
| dbacp03518 | Kassiniatuerin-3 | FIQHLIPLIPHAIQGIKDIF | Senegal running frog, Africa | Membranolytic mechanism | MTT assay | NCI-H460 | Non-small cell Lung cancer | IC50 : 1.67 µM |
| dbacp03519 | Kassiniatuerin-3 | FIQHLIPLIPHAIQGIKDIF | Senegal running frog, Africa | Membranolytic mechanism | MTT assay | NCI-H838 | Non-small cell Lung cancer | IC50 : 10.03 µM |
| dbacp03520 | Kassiniatuerin-3 | FIQHLIPLIPHAIQGIKDIF | Senegal running frog, Africa | Membranolytic mechanism | MTT assay | LNCaP | Non-small cell Lung cancer | IC50 : 3.79 µM |
| dbacp03521 | Kassiniatuerin-3 | FIQHLIPLIPHAIQGIKDIF | Senegal running frog, Africa | Membranolytic mechanism | MTT assay | U-251 MG | Glioblastoma (astrocytoma) | IC50 : 13.20 µM |
| dbacp03531 | L-amino acid oxidase (CC-LAAO) (LAO) (EC 1.4.3.2) | MNVFFMFSLLFLAALESCADDKNPLEEEFFEADYEEFLLIAKNGLQQTSNPKRVVIVGAGMSGLSAAYVLAKTGHEVILLEASERVGGRVSTYRNDQEGWYANLGPMRLPERHRIVREYIRKFGLQLNEFSQENENAWYFIKNIRKRVGEVNKDPGVLEYPVKPSEKGKSAPQLYRDSLQKIIEEYGRSNCSYILNKYDTYSTKDYLIKEGNLSPGAVDMVGDLLNEDSGYYVSFIESLKPDDIFAYENRFDEIVGGFDKLPTSMYQAIQEKVRLNVRVIKIQQDVKEVTVTYQTPAKNLSYVTADYVIVCTTSGAARRIKFEPPLPLKKAHALRSVHYRSGTKIFLTCTKKFWEDDGIHGGKSITDRPSRLIHYPNHNFPNGIGVLVIFTIADDADFFLALDNKTIADIVIHDLSLIHQLPKEKIRDLCYVSMIQKWSLDKYAMGGITTFTPYQFQHFSEALTAPVDRIYFAGEYTAQAHGWIDSTIKSGLTAARDVNRASENPSGIHLSNDNEL | Horned desert vip | Cytotoxic effects | MTT assay | B16F10 | Not found | IC50 : 2 µg/mL |
| dbacp03532 | L-amino acid oxidase (CC-LAAO) (LAO) (EC 1.4.3.2) | MNVFFMFSLLFLAALESCADDKNPLEEEFFEADYEEFLLIAKNGLQQTSNPKRVVIVGAGMSGLSAAYVLAKTGHEVILLEASERVGGRVSTYRNDQEGWYANLGPMRLPERHRIVREYIRKFGLQLNEFSQENENAWYFIKNIRKRVGEVNKDPGVLEYPVKPSEKGKSAPQLYRDSLQKIIEEYGRSNCSYILNKYDTYSTKDYLIKEGNLSPGAVDMVGDLLNEDSGYYVSFIESLKPDDIFAYENRFDEIVGGFDKLPTSMYQAIQEKVRLNVRVIKIQQDVKEVTVTYQTPAKNLSYVTADYVIVCTTSGAARRIKFEPPLPLKKAHALRSVHYRSGTKIFLTCTKKFWEDDGIHGGKSITDRPSRLIHYPNHNFPNGIGVLVIFTIADDADFFLALDNKTIADIVIHDLSLIHQLPKEKIRDLCYVSMIQKWSLDKYAMGGITTFTPYQFQHFSEALTAPVDRIYFAGEYTAQAHGWIDSTIKSGLTAARDVNRASENPSGIHLSNDNEL | Horned desert vip | Cytotoxic effects | MTT assay | PC12 | Not found | IC50 : 3.5 µg/mL |
| dbacp03533 | L-amino acid oxidase (CC-LAAO) (LAO) (EC 1.4.3.2) | MNVFFMFSLLFLAALESCADDKNPLEEEFFEADYEEFLLIAKNGLQQTSNPKRVVIVGAGMSGLSAAYVLAKTGHEVILLEASERVGGRVSTYRNDQEGWYANLGPMRLPERHRIVREYIRKFGLQLNEFSQENENAWYFIKNIRKRVGEVNKDPGVLEYPVKPSEKGKSAPQLYRDSLQKIIEEYGRSNCSYILNKYDTYSTKDYLIKEGNLSPGAVDMVGDLLNEDSGYYVSFIESLKPDDIFAYENRFDEIVGGFDKLPTSMYQAIQEKVRLNVRVIKIQQDVKEVTVTYQTPAKNLSYVTADYVIVCTTSGAARRIKFEPPLPLKKAHALRSVHYRSGTKIFLTCTKKFWEDDGIHGGKSITDRPSRLIHYPNHNFPNGIGVLVIFTIADDADFFLALDNKTIADIVIHDLSLIHQLPKEKIRDLCYVSMIQKWSLDKYAMGGITTFTPYQFQHFSEALTAPVDRIYFAGEYTAQAHGWIDSTIKSGLTAARDVNRASENPSGIHLSNDNEL | Horned desert vip | Cytotoxic effects | MTT assay | MCF-7 | Not found | IC50 : 4 µg/mL |
| dbacp03534 | L-amino acid oxidase (CC-LAAO) (LAO) (EC 1.4.3.2) | MNVFFMFSLLFLAALESCADDKNPLEEEFFEADYEEFLLIAKNGLQQTSNPKRVVIVGAGMSGLSAAYVLAKTGHEVILLEASERVGGRVSTYRNDQEGWYANLGPMRLPERHRIVREYIRKFGLQLNEFSQENENAWYFIKNIRKRVGEVNKDPGVLEYPVKPSEKGKSAPQLYRDSLQKIIEEYGRSNCSYILNKYDTYSTKDYLIKEGNLSPGAVDMVGDLLNEDSGYYVSFIESLKPDDIFAYENRFDEIVGGFDKLPTSMYQAIQEKVRLNVRVIKIQQDVKEVTVTYQTPAKNLSYVTADYVIVCTTSGAARRIKFEPPLPLKKAHALRSVHYRSGTKIFLTCTKKFWEDDGIHGGKSITDRPSRLIHYPNHNFPNGIGVLVIFTIADDADFFLALDNKTIADIVIHDLSLIHQLPKEKIRDLCYVSMIQKWSLDKYAMGGITTFTPYQFQHFSEALTAPVDRIYFAGEYTAQAHGWIDSTIKSGLTAARDVNRASENPSGIHLSNDNEL | Horned desert vip | Cytotoxic effects | MTT assay | MDA-MB-231 | Not found | IC50 : 6 µg/mL |
| dbacp03538 | L-amino-acid oxidase (BatroxLAAO) (LAO) (EC 1.4.3.2) | MNVFFTFSLLFLAALGSCADDRNPLEECFRETDYEEFLEIAKNGLSTTSNPKRVVIVGAGMSGLSAAYVLANAGHQVTVLEASERAGGRVKTYRNEKEGWYANLGPMRLPEKHRIVREYIRKFDLQLNEFSQENENAWYFIKNIRKRVGEVNKDPGVLEYPVKPSEVGKSAGQLYEESLQKAVEELRRTNCSYMLNKYDTYSTKEYLLKEGNLSPGAVDMIGDLLNEDSGYYVSFIESLKHDDIFAYEKRFDEIVGGMDKLPTSMYQAIQEKVHLNARVIKIQQDVKEVTVTYQTSEKETLSVTADYVIVCTTSRAARRIKFEPPLPPKKAHALRSVHYRSGTKIFLTCTKKFWEDDGIHGGKSTTDLPSRFIYYPNHNFPNGVGVIIAYGIGDDANYFQALDFEDCGDIVINDLSLIHQLPKEEIQAICRPSMIQRWSLDKYAMGGITTFTPYQFQHFSEALTAPVDRIYFAGEYTAQAHGWIDSTIKSGLRAARDVNRASEIKK | Common lancehead | Inducing apoptosis | MTT assay | PC12 | Not found | Not found |
| dbacp03539 | L-amino-acid oxidase (BatroxLAAO) (LAO) (EC 1.4.3.2) | MNVFFTFSLLFLAALGSCADDRNPLEECFRETDYEEFLEIAKNGLSTTSNPKRVVIVGAGMSGLSAAYVLANAGHQVTVLEASERAGGRVKTYRNEKEGWYANLGPMRLPEKHRIVREYIRKFDLQLNEFSQENENAWYFIKNIRKRVGEVNKDPGVLEYPVKPSEVGKSAGQLYEESLQKAVEELRRTNCSYMLNKYDTYSTKEYLLKEGNLSPGAVDMIGDLLNEDSGYYVSFIESLKHDDIFAYEKRFDEIVGGMDKLPTSMYQAIQEKVHLNARVIKIQQDVKEVTVTYQTSEKETLSVTADYVIVCTTSRAARRIKFEPPLPPKKAHALRSVHYRSGTKIFLTCTKKFWEDDGIHGGKSTTDLPSRFIYYPNHNFPNGVGVIIAYGIGDDANYFQALDFEDCGDIVINDLSLIHQLPKEEIQAICRPSMIQRWSLDKYAMGGITTFTPYQFQHFSEALTAPVDRIYFAGEYTAQAHGWIDSTIKSGLRAARDVNRASEIKK | Common lancehead | Inducing apoptosis | MTT assay | B16F10 | Not found | Not found |
| dbacp03540 | L-amino-acid oxidase (BatroxLAAO) (LAO) (EC 1.4.3.2) | MNVFFTFSLLFLAALGSCADDRNPLEECFRETDYEEFLEIAKNGLSTTSNPKRVVIVGAGMSGLSAAYVLANAGHQVTVLEASERAGGRVKTYRNEKEGWYANLGPMRLPEKHRIVREYIRKFDLQLNEFSQENENAWYFIKNIRKRVGEVNKDPGVLEYPVKPSEVGKSAGQLYEESLQKAVEELRRTNCSYMLNKYDTYSTKEYLLKEGNLSPGAVDMIGDLLNEDSGYYVSFIESLKHDDIFAYEKRFDEIVGGMDKLPTSMYQAIQEKVHLNARVIKIQQDVKEVTVTYQTSEKETLSVTADYVIVCTTSRAARRIKFEPPLPPKKAHALRSVHYRSGTKIFLTCTKKFWEDDGIHGGKSTTDLPSRFIYYPNHNFPNGVGVIIAYGIGDDANYFQALDFEDCGDIVINDLSLIHQLPKEEIQAICRPSMIQRWSLDKYAMGGITTFTPYQFQHFSEALTAPVDRIYFAGEYTAQAHGWIDSTIKSGLRAARDVNRASEIKK | Common lancehead | Inducing apoptosis | MTT assay | HL-60 | Not found | Not found |
| dbacp03541 | L-amino-acid oxidase (BatroxLAAO) (LAO) (EC 1.4.3.2) | MNVFFTFSLLFLAALGSCADDRNPLEECFRETDYEEFLEIAKNGLSTTSNPKRVVIVGAGMSGLSAAYVLANAGHQVTVLEASERAGGRVKTYRNEKEGWYANLGPMRLPEKHRIVREYIRKFDLQLNEFSQENENAWYFIKNIRKRVGEVNKDPGVLEYPVKPSEVGKSAGQLYEESLQKAVEELRRTNCSYMLNKYDTYSTKEYLLKEGNLSPGAVDMIGDLLNEDSGYYVSFIESLKHDDIFAYEKRFDEIVGGMDKLPTSMYQAIQEKVHLNARVIKIQQDVKEVTVTYQTSEKETLSVTADYVIVCTTSRAARRIKFEPPLPPKKAHALRSVHYRSGTKIFLTCTKKFWEDDGIHGGKSTTDLPSRFIYYPNHNFPNGVGVIIAYGIGDDANYFQALDFEDCGDIVINDLSLIHQLPKEEIQAICRPSMIQRWSLDKYAMGGITTFTPYQFQHFSEALTAPVDRIYFAGEYTAQAHGWIDSTIKSGLRAARDVNRASEIKK | Common lancehead | Inducing apoptosis | MTT assay | Jurkat | Acute T-cell Leukemia | Not found |
| dbacp03544 | L-amino-acid oxidase ACTX-8 | ADDRNPLEEFRENNYEEFL | Venom base | Inducing apoptosis | MTT assay | HeLa | Cervical cancer | MIC : 20 μg/ml |
| dbacp03545 | L-amino-acid oxidase ACTX-8 (LAAO) (LAO) (EC 1.4.3.2) | ADDRNPLEEFRENNYEEFL | Hundred-pace Snake | Inducing apoptosis | MTT assay | HeLa | Cervical cancer | MIC : 20 μg/ml |
| dbacp03721 | LFB | GLFSVVKGVLKGVGKNVSGSLLDQLKCKISGGC | The Fujian Large Headed Frog | Cell Apoptosis | MTT assay | H460 | Colon cancer | IC50 : 3.47 μM |
| dbacp03722 | LFB | GLFSVVKGVLKGVGKNVSGSLLDQLKCKISGGC | The Fujian Large Headed Frog | Cell Apoptosis | MTT assay | MB435 | Melanocyte | IC50 : 18.99 μM |
| dbacp03723 | LFB | GLFSVVKGVLKGVGKNVSGSLLDQLKCKISGGC | The Fujian Large Headed Frog | Cell Apoptosis | MTT assay | U251MG | Breast cancer | IC50 : 2.32 μM |
| dbacp03724 | LFB | GLFSVVKGVLKGVGKNVSGSLLDQLKCKISGGC | The Fujian Large Headed Frog | Cell Apoptosis | MTT assay | HCT116 | Lung cancer | IC50 : 2.02 μM |
| dbacp03725 | LFB | GLFSVVKGVLKGVGKNVSGSLLDQLKCKISGGC | The Fujian Large Headed Frog, China, Asia | Cell Apoptosis | MTT assay | H460 | Colon cancer | IC50 : 3.47 μM |
| dbacp03726 | LFB | GLFSVVKGVLKGVGKNVSGSLLDQLKCKISGGC | The Fujian Large Headed Frog, China, Asia | Cell Apoptosis | MTT assay | MB435 | Melanocyte | IC50 : 18.99 μM |
| dbacp03727 | LFB | GLFSVVKGVLKGVGKNVSGSLLDQLKCKISGGC | The Fujian Large Headed Frog, China, Asia | Cell Apoptosis | MTT assay | U251MG | Breast cancer | IC50 : 2.32 μM |
| dbacp03728 | LFB | GLFSVVKGVLKGVGKNVSGSLLDQLKCKISGGC | The Fujian Large Headed Frog, China, Asia | Cell Apoptosis | MTT assay | HCT116 | Lung cancer | IC50 : 2.02 μM |
| dbacp03741 | LfcinB (Bovine lactoferricin) | FKCRRWQWRM | Not found | Inducing apoptosis | MTT assay | Jurkat | Leukemia | Not found |
| dbacp03742 | LfcinB (Bovine lactoferricin) | FKCRRWQWRM | Not found | Inducing apoptosis | MTT assay | MCF-7 | Leukemia | Not found |
| dbacp03743 | LfcinB (Bovine lactoferricin) | FKCRRWQWRM | Not found | Inducing apoptosis | MTT assay | Colo-35 | Leukemia | Not found |
| dbacp03744 | LfcinB (Bovine lactoferricin) | FKCRRWQWRM | Not found | Inducing apoptosis | MTT assay | MDA-MB-435 | Leukemia | Not found |
| dbacp03745 | LfcinB (Bovine lactoferricin) | FKCRRWQWRM | Not found | Inducing apoptosis | MTT assay | SKov3 | Leukemia | Not found |
| dbacp03746 | LfcinB (Bovine lactoferricin) | FKCRRWQWRM | Not found | Inducing apoptosis | MTT assay | CAov3 | Leukemia | Not found |
| dbacp03747 | LfcinB (Bovine lactoferricin) | FKCRRWQWRM | Not found | Inducing apoptosis | MTT assay | HT-29 | Leukemia | Not found |
| dbacp03748 | LfcinB (Bovine lactoferricin) | FKCRRWQWRM | Not found | Inducing apoptosis | MTT assay | T-47D | Leukemia | Not found |
| dbacp03749 | LfcinB (Bovine lactoferricin) | FKCRRWQWRM | Not found | Inducing apoptosis | MTT assay | CCRF-CEM | Leukemia | Not found |
| dbacp03750 | LfcinB (Bovine lactoferricin) | FKCRRWQWRM | Not found | Inducing apoptosis | MTT assay | K562 | Leukemia | Not found |
| dbacp03751 | LfcinB (Bovine lactoferricin) | FKCRRWQWRM | Not found | Inducing apoptosis | MTT assay | Raji | Leukemia | Not found |
| dbacp03752 | LHRH–BH3 peptide luteinizing hormone-releasing hormone (LHRH) | QHWSYGLRPGMGQVGRQLAIIGDDINRRY | Effectors (BAK, BAX) | Inducing apoptosis | Cytotoxicity assay, MTT assay | A2780 | Ovarian carcinoma | Not found |
| dbacp03753 | LHRH–BH3 peptide luteinizing hormone-releasing hormone (LHRH) | QHWSYGLRPGMGQVGRQLAIIGDDINRRY | Effectors (BAK, BAX) | Inducing apoptosis | Cytotoxicity assay, MTT assay | MCF-7 | Human breast cancer | Not found |
| dbacp03754 | LHRH–BH3 peptide luteinizing hormone-releasing hormone (LHRH) | QHWSYGLRPGMGQVGRQLAIIGDDINRRY | Effectors (BAK, BAX) | Inducing apoptosis | Cytotoxicity assay, MTT assay | PC-3 | Prostate cancer | Not found |
| dbacp03755 | LHRH–BH3 peptide luteinizing hormone-releasing hormone (LHRH) | QHWSYGLRPGMGQVGRQLAIIGDDINRRY | Effectors (BAK, BAX) | Inducing apoptosis | Cytotoxicity assay, MTT assay | SKOV-3 | LHRH negative ovarian cancer | Not found |
| dbacp04164 | LL-37(13-37)(C-terminal fragment of LL-37; Human, mammals, animals) | IGKEFKRIVQRIKDFLRNLVPRTES | Human | Not specified | MTT assay | KBv | Tumor | LC50 : 39 ± 0 μM |
| dbacp04165 | LL-37(13-37)(C-terminal fragment of LL-37; Human, mammals, animals) | IGKEFKRIVQRIKDFLRNLVPRTES | Human | Not specified | MTT assay | KB | Oral cancer | LC50 : 40 ± 0 μM |
| dbacp04166 | LL-37(13-37)(C-terminal fragment of LL-37; Human, mammals, animals) | IGKEFKRIVQRIKDFLRNLVPRTES | Human | Not specified | MTT assay | HBMEC | Prostate cancer | LC50 : 38 ± 3 μM |
| dbacp04171 | LL-37(17-29)(C-terminal fragment of LL-37; Human, mammals, animals) | FKRIVQRIKDFLRNLV | Human | Not specified | MTT assay | KBv | Tumor | LC50 : 60 ± 0 μM |
| dbacp04172 | LL-37(17-29)(C-terminal fragment of LL-37; Human, mammals, animals) | FKRIVQRIKDFLRNLV | Human | Not specified | MTT assay | KB | Oral cancer | LC50 : 57 ± 3 μM |
| dbacp04173 | LL-37(17-29)(C-terminal fragment of LL-37; Human, mammals, animals) | FKRIVQRIKDFLRNLV | Human | Not specified | MTT assay | HBMEC | Prostate cancer | LC50 : 55 ± 2 μM |
| dbacp04174 | LL-37(17-32)(C-terminal fragment of LL-37; Human, mammals, animals) | FKRIVQRIKDFLRNLV | Human | Not specified | MTT assay | KBv | Tumor | LC50 : 30 ± 0 μM |
| dbacp04175 | LL-37(17-32)(C-terminal fragment of LL-37; Human, mammals, animals) | FKRIVQRIKDFLRNLV | Human | Not specified | MTT assay | KB | Oral cancer | LC50 : 30 ± 1 μM |
| dbacp04176 | LL-37(17-32)(C-terminal fragment of LL-37; Human, mammals, animals) | FKRIVQRIKDFLRNLV | Human | Not specified | MTT assay | HBMEC | Prostate cancer | LC50 : 25 ± 1 μM |
| dbacp04309 | Lunasin | SKWQHQQDSCRKQLQGVNLTPCEKHIMEKIQGRDDDDDDDDDD | Plant sources | Inducing apoptosis | MTT assay | HCT116-derived spheres | Colorectal cancer | IC50 : 161.0 ± 2.4 μM |
| dbacp04310 | Lunasin | SKWQHQQDSCRKQLQGVNLTPCEKHIMEKIQGRDDDDDDDDDD | Plant sources | Inducing apoptosis | MTT assay | HCT-116 parentl | Colorectal cancer | IC50 : 107.5 ± 1.9 μM |
| dbacp04317 | LvHemB1 | DVNFLLHKIYGNIRY | Marine invertebrates | Inducing apoptosis | MTT assay | HeLa | Cervical cancer | Not found |
| dbacp04318 | LvHemB1 | DVNFLLHKIYGNIRY | Marine invertebrates | Inducing apoptosis | MTT assay | HeLa | Esophageal cancer | Not found |
| dbacp04319 | LvHemB1 | DVNFLLHKIYGNIRY | Marine invertebrates | Inducing apoptosis | MTT assay | HeLa | Liver cancer | Not found |
| dbacp04320 | LvHemB1 | DVNFLLHKIYGNIRY | Marine invertebrates | Inducing apoptosis | MTT assay | HeLa | Bladder cancer | Not found |
| dbacp04321 | LvHemB1 | DVNFLLHKIYGNIRY | Marine invertebrates | Inducing apoptosis | MTT assay | EC109 | Cervical cancer | Not found |
| dbacp04322 | LvHemB1 | DVNFLLHKIYGNIRY | Marine invertebrates | Inducing apoptosis | MTT assay | EC109 | Esophageal cancer | Not found |
| dbacp04323 | LvHemB1 | DVNFLLHKIYGNIRY | Marine invertebrates | Inducing apoptosis | MTT assay | EC109 | Liver cancer | Not found |
| dbacp04324 | LvHemB1 | DVNFLLHKIYGNIRY | Marine invertebrates | Inducing apoptosis | MTT assay | EC109 | Bladder cancer | Not found |
| dbacp04325 | LvHemB1 | DVNFLLHKIYGNIRY | Marine invertebrates | Inducing apoptosis | MTT assay | HepG2 | Cervical cancer | Not found |
| dbacp04326 | LvHemB1 | DVNFLLHKIYGNIRY | Marine invertebrates | Inducing apoptosis | MTT assay | HepG2 | Esophageal cancer | Not found |
| dbacp04327 | LvHemB1 | DVNFLLHKIYGNIRY | Marine invertebrates | Inducing apoptosis | MTT assay | HepG2 | Liver cancer | Not found |
| dbacp04328 | LvHemB1 | DVNFLLHKIYGNIRY | Marine invertebrates | Inducing apoptosis | MTT assay | HepG2 | Bladder cancer | Not found |
| dbacp04329 | LvHemB1 | DVNFLLHKIYGNIRY | Marine invertebrates | Inducing apoptosis | MTT assay | EJ | Cervical cancer | Not found |
| dbacp04330 | LvHemB1 | DVNFLLHKIYGNIRY | Marine invertebrates | Inducing apoptosis | MTT assay | EJ | Esophageal cancer | Not found |
| dbacp04331 | LvHemB1 | DVNFLLHKIYGNIRY | Marine invertebrates | Inducing apoptosis | MTT assay | EJ | Liver cancer | Not found |
| dbacp04332 | LvHemB1 | DVNFLLHKIYGNIRY | Marine invertebrates | Inducing apoptosis | MTT assay | EJ | Bladder cancer | Not found |
| dbacp04333 | LvHemB1 | DVNFLLHKIYGNIRY | Marine invertebrates | Inducing apoptosis | MTT assay | THLE-3 | Cervical cancer | Not found |
| dbacp04334 | LvHemB1 | DVNFLLHKIYGNIRY | Marine invertebrates | Inducing apoptosis | MTT assay | THLE-3 | Esophageal cancer | Not found |
| dbacp04335 | LvHemB1 | DVNFLLHKIYGNIRY | Marine invertebrates | Inducing apoptosis | MTT assay | THLE-3 | Liver cancer | Not found |
| dbacp04336 | LvHemB1 | DVNFLLHKIYGNIRY | Marine invertebrates | Inducing apoptosis | MTT assay | THLE-3 | Bladder cancer | Not found |
| dbacp04541 | Malanin chain A | DYPKLTFTTS | Plant sources | Inducing apoptosis | MTT assay | HeLa | Cervical cancer | IC50 : 0.15 ± 0.08 nM |
| dbacp04542 | Malanin chain A | DYPKLTFTTS | Plant sources | Inducing apoptosis | MTT assay | PC-12 | Breast cancer | IC50 : 7.71 ± 0.24 nM |
| dbacp04543 | Malanin chain A | DYPKLTFTTS | Plant sources | Inducing apoptosis | MTT assay | MCF-7 | Leukemia | IC50 : 11.20 ± 0.02 nM |
| dbacp04544 | Malanin chain A | DYPKLTFTTS | Plant sources | Inducing apoptosis | MTT assay | K562 | Not found | IC50 : 15.80 ± 0.09 nM |
| dbacp04545 | Malanin chain A | DYPKLTFTTS | Plant sources | Inducing apoptosis | MTT assay | Vero | Not found | IC50 : 2.79 ± 0.05 nM |
| dbacp04546 | Malanin chain A | DYPKLTFTTS | Plant sources | Inducing apoptosis | MTT assay | MDCK | Not found | IC50 : 3.92 ± 0.01 nM |
| dbacp04547 | Malanin chain B | DETCTDEEFN | Plant sources | Inducing apoptosis | MTT assay | HeLa | Cervical cancer | IC50 : 0.15 ± 0.08 nM |
| dbacp04548 | Malanin chain B | DETCTDEEFN | Plant sources | Inducing apoptosis | MTT assay | PC-12 | Breast cancer | IC50 : 7.71 ± 0.24 nM |
| dbacp04549 | Malanin chain B | DETCTDEEFN | Plant sources | Inducing apoptosis | MTT assay | MCF-7 | Leukemia | IC50 : 11.20 ± 0.02 nM |
| dbacp04550 | Malanin chain B | DETCTDEEFN | Plant sources | Inducing apoptosis | MTT assay | K562 | Not found | IC50 : 15.80 ± 0.09 nM |
| dbacp04551 | Malanin chain B | DETCTDEEFN | Plant sources | Inducing apoptosis | MTT assay | Vero | Not found | IC50 : 2.79 ± 0.05 nM |
| dbacp04552 | Malanin chain B | DETCTDEEFN | Plant sources | Inducing apoptosis | MTT assay | MDCK | Not found | IC50 : 3.92 ± 0.01 nM |
| dbacp04573 | Mastoparan-C | LNLKALLAVAKKIL | European hornet | Apoptosis | MTT assay | H157 | Non-small cell Lung cancer | IC50 : 13.57 μM |
| dbacp04574 | Mastoparan-C | LNLKALLAVAKKIL | European hornet | Apoptosis | MTT assay | MBD-MB-435S | Melanocyte | IC50 : 1.4 μM |
| dbacp04575 | Mastoparan-C | LNLKALLAVAKKIL | European hornet | Apoptosis | MTT assay | PC-3 | Human prostate carcinoma | IC50 : 1.4 μM |
| dbacp04576 | Mastoparan-C | LNLKALLAVAKKIL | European hornet | Apoptosis | MTT assay | U251-MG | Human glioblastoma astrocytoma | IC50 : 1.4 μM |
| dbacp04577 | Mastoparan-C | LNLKALLAVAKKIL | European hornet | Apoptosis | MTT assay | MCF-7 | Human Breast cancer | IC50 : 1.4 μM |
| dbacp04592 | Mauriporin | MNKKTLLVIFFITMLIVDEVNSFKIGGFIKKLWRSKLAKKLRAKGRELLKDYANRVINGGPEEEAAVPAERRR | Fat-tailed scorpion | Induce cell apoptosis; Targets on the cell membranes and caused membrane lysis | MTT assay, Lactate dehydrogenase (LDH) Release assay | Hela | Human cervical cancer | IC50 : 27.9 μM - 283.3 μM |
| dbacp04593 | Mauriporin | MNKKTLLVIFFITMLIVDEVNSFKIGGFIKKLWRSKLAKKLRAKGRELLKDYANRVINGGPEEEAAVPAERRR | Fat-tailed scorpion | Induce cell apoptosis; Targets on the cell membranes and caused membrane lysis | MTT assay, Lactate dehydrogenase (LDH) Release assay | SACC-83 | Human salivary adenoid cystic carcinoma | IC50 : 27.9 μM - 283.3 μM |
| dbacp04594 | Mauriporin | MNKKTLLVIFFITMLIVDEVNSFKIGGFIKKLWRSKLAKKLRAKGRELLKDYANRVINGGPEEEAAVPAERRR | Fat-tailed scorpion | Induce cell apoptosis; Targets on the cell membranes and caused membrane lysis | MTT assay, Lactate dehydrogenase (LDH) Release assay | HepG2 | Human liver cancer | IC50 : 27.9 μM - 283.3 μM |
| dbacp04595 | Mauriporin | MNKKTLLVIFFITMLIVDEVNSFKIGGFIKKLWRSKLAKKLRAKGRELLKDYANRVINGGPEEEAAVPAERRR | Fat-tailed scorpion | Induce cell apoptosis; Targets on the cell membranes and caused membrane lysis | MTT assay, Lactate dehydrogenase (LDH) Release assay | PC-3 | Human Prostate cancer | IC50 : 27.9 μM - 283.3 μM |
| dbacp04603 | Maximin H1 | ILGPVISTIGGVLGGLLKNL | Yunnan firebelly toad, China, Asia | Not specified | MTT assay | C8166 | Bladder cancer | Not found |
| dbacp04604 | Maximin H1 | ILGPVISTIGGVLGGLLKNL | Yunnan firebelly toad, China, Asia | Not specified | MTT assay | BIU-87 | Bladder cancer | Not found |
| dbacp04605 | Maximin H1 | ILGPVISTIGGVLGGLLKNL | Yunnan firebelly toad, China, Asia | Not specified | MTT assay | T27 | Bladder cancer | Not found |
| dbacp04653 | Melittin | GIGAVLKVLTTGLPALISWIKRKRQQ | Venom base | Inducing apoptosis | MTT assay | SGC-7901 | Gastric cancer | Not found |
| dbacp04658 | Melittin-N (MEL-N) (MLT) | MKFLVNVALVFMVVYISYIYAAPEPEPAPEPEAEADAEADPEAGIGAVLKVLTTGLPALINWIKRKRQQG | Indian honeybee | Cytotoxic | MTT assay | SKOV-3 | Ovarian cancer | IC50 : 0.5 μM |
| dbacp04659 | Melittin-N (MEL-N) (MLT) | MKFLVNVALVFMVVYISYIYAAPEPEPAPEPEAEADAEADPEAGIGAVLKVLTTGLPALINWIKRKRQQG | Indian honeybee | Cytotoxic | MTT assay | SKOV-3 | Ovarian cancer | IC50 : 0.25 μM |
| dbacp04660 | Melittin-N (MEL-N) (MLT) | MKFLVNVALVFMVVYISYIYAAPEPEPAPEPEAEADAEADPEAGIGAVLKVLTTGLPALINWIKRKRQQG | Indian honeybee | Cytotoxic | MTT assay | PA-1 | Ovarian cancer | IC50 : 1 μM |
| dbacp04661 | Melittin-N (MEL-N) (MLT) | MKFLVNVALVFMVVYISYIYAAPEPEPAPEPEAEADAEADPEAGIGAVLKVLTTGLPALINWIKRKRQQG | Indian honeybee | Cytotoxic | MTT assay | PA-1 | Ovarian cancer | IC50 : 1 μM |
| dbacp04699 | MP12 | MDNHVCIPLCPP | Not found | Inducing apoptosis | MTT assay | Hep-2 | Laryngeal cancer | IC50 : 24.7 ± 0.34 Μm |
| dbacp04820 | Nal2-S1 | Ac-KKWRKWLAKK-NH2 | Not found | Necrosis; Apoptosis | MTT assay | PC9 | Human Lung cancer | MIC : 25 μM |
| dbacp04821 | Nal2-S1 | Ac-KKWRKWLAKK-NH2 | Not found | Necrosis; Apoptosis | MTT assay | PC9-G | Oral cancer | MIC : 25 μM |
| dbacp04822 | Nal2-S1 | Ac-KKWRKWLAKK-NH2 | Not found | Necrosis; Apoptosis | MTT assay | A549 | Human Lung cancer | MIC : 25 μM |
| dbacp04823 | Nal2-S1 | Ac-KKWRKWLAKK-NH2 | Not found | Necrosis; Apoptosis | MTT assay | C9 | Oral cancer | MIC : 25 μM |
| dbacp04824 | Nal2-S1 | Ac-KKWRKWLAKK-NH2 | Not found | Necrosis; Apoptosis | MTT assay | OECM-1 | Human Lung cancer | MIC : 25 μM |
| dbacp04825 | Nal2-S1 | Ac-KKWRKWLAKK-NH2 | Not found | Necrosis; Apoptosis | MTT assay | SAS | Oral cancer | MIC : 25 μM |
| dbacp04868 | NK-2 (Mammals, Animals) | KILRGVCKKIMRTFLRRISKDILTGKK | Mammal | Not specified | MTT assay | EJ | Not found | IC50 : 8.4 μM |
| dbacp04869 | NK-2 (Mammals, Animals) | KILRGVCKKIMRTFLRRISKDILTGKK | Mammal | Not specified | MTT assay | PC-3 | Not found | IC50 : 4.1 μM |
| dbacp04870 | NK-2 (Mammals, Animals) | KILRGVCKKIMRTFLRRISKDILTGKK | Mammal | Not specified | MTT assay | T24 | Not found | IC50 : 10.1 μM |
| dbacp04871 | NK-2 (Mammals, Animals) | KILRGVCKKIMRTFLRRISKDILTGKK | Mammal | Not specified | MTT assay | HL-60 | Not found | IC50 : 13.7 μM |
| dbacp04872 | NK-dpro (Derived from NK-2) | KILPGVCKKIMRPFLRRISKDILTGKK | Synthetic construct | Not specified | MTT assay | EJ | Not found | IC50 : 28.7 μM |
| dbacp04873 | NK-dpro (Derived from NK-2) | KILPGVCKKIMRPFLRRISKDILTGKK | Synthetic construct | Not specified | MTT assay | PC-3 | Not found | IC50 : 9.6 μM |
| dbacp04874 | NK-dpro (Derived from NK-2) | KILPGVCKKIMRPFLRRISKDILTGKK | Synthetic construct | Not specified | MTT assay | T24 | Not found | IC50 : 39.6 μM |
| dbacp04875 | NK-dpro (Derived from NK-2) | KILPGVCKKIMRPFLRRISKDILTGKK | Synthetic construct | Not specified | MTT assay | HL-60 | Not found | IC50 : 48.4 μM |
| dbacp04876 | NK-pro (Derived from NK-2) | KILRGVCKKIMRPFLRRISKDILTGKK | Synthetic construct | Not specified | MTT assay | EJ | Not found | IC50 : 23.3 μM |
| dbacp04877 | NK-pro (Derived from NK-2) | KILRGVCKKIMRPFLRRISKDILTGKK | Synthetic construct | Not specified | MTT assay | PC-3 | Not found | IC50 : 9.3 μM |
| dbacp04878 | NK-pro (Derived from NK-2) | KILRGVCKKIMRPFLRRISKDILTGKK | Synthetic construct | Not specified | MTT assay | T24 | Not found | IC50 : 33.0 μM |
| dbacp04879 | NK-pro (Derived from NK-2) | KILRGVCKKIMRPFLRRISKDILTGKK | Synthetic construct | Not specified | MTT assay | HL-60 | Not found | IC50 : 26.1 μM |
| dbacp05009 | Okinawa Habu apoxin protein-1(OHAP-1) | ADDRNPLEECFRETDYEEFLEIARNGLKKT | Venom base | Inducing apoptosis | DNA gel electrophoresis assay,TUNEL assay, MTT assay | RBR17T | Glioma | IC50 : 2.1 ± 0.58 µg/ml |
| dbacp05010 | Okinawa Habu apoxin protein-1(OHAP-1) | ADDRNPLEECFRETDYEEFLEIARNGLKKT | Venom base | Inducing apoptosis | DNA gel electrophoresis assay,TUNEL assay, MTT assay | OHAP-1 | Glioma | IC50 : 1.9 ± 0.31 µg/ml |
| dbacp05011 | Okinawa Habu apoxin protein-1(OHAP-1) | ADDRNPLEECFRETDYEEFLEIARNGLKKT | Venom base | Inducing apoptosis | DNA gel electrophoresis assay,TUNEL assay, MTT assay | C6 | Glioma | IC50 : 2.48 ± 0.26 µg/ml |
| dbacp05029 | p-BIM BH3 (I155R, E158S) | EIWIAQELRRRGDpSFNAYYAR‘pS’standsforthephosphorylatedserine | BH3-only, Direct activators, BIM analogues | Inducing apoptosis | MTT assay | Not found | Prostate cancer | Not found |
| dbacp05030 | p-BIM BH3 (R154S, I155R, E158S) | EIWIAQELRSRGDpSFNAYYAR‘pS’standsforthephosphorylatedserine | BH3-only, Direct activators, BIM analogues | Inducing apoptosis | MTT assay | Not found | Prostate cancer | Not found |
| dbacp05031 | P04 | IGEHTPSALAIMENANVLAR | Aldolase A derived | Apoptosis inducing | MTT assay | PDAC | Pancreatic ductal adenocarcinoma | MIC : 25 µg/mL |
| dbacp05089 | P6 | WYIRKIRRFFKWLKKKLKKK | Marine invertebrates | Inducing apoptosis | MTT assay | HT-29 | Colorectal cancer | Not found |
| dbacp05090 | P6 | WYIRKIRRFFKWLKKKLKKK | Marine invertebrates | Inducing apoptosis | MTT assay | DLD-1 | Colorectal cancer | Not found |
| dbacp05091 | P6 | WYIRKIRRFFKWLKKKLKKK | Marine invertebrates | Inducing apoptosis | MTT assay | HCT116 | Colorectal cancer | Not found |
| dbacp05092 | P6 | WYIRKIRRFFKWLKKKLKKK | Marine invertebrates | Inducing apoptosis | MTT assay | SW-620 | Colorectal cancer | Not found |
| dbacp05093 | P6 | WYIRKIRRFFKWLKKKLKKK | Marine invertebrates | Inducing apoptosis | MTT assay | L02 | Colorectal cancer | Not found |
| dbacp05127 | PaDef | ATCETPSKHFNGLCIRSSNCASVCHGEHFTDGRCQGVRRRCMCLKPC | Plant sources | Inducing apoptosis | MTT assay | Jurkat | Leukemia | Not found |
| dbacp05130 | Pal-pFL-N-Ter-TAT | FPWWWPFLRDVFTKGYGFGLGRKKRRQRRRPQ | VDAC1(voltage-dependent anion channel1) | Inducing apoptosis | MTT assay | A375 | Leukemia | IC50 : 5.5 ± 1.1 μM |
| dbacp05216 | PD-L1ip3 | GTRLKPLIICVQWPGL | Not found | Inducing apoptosis | MTT assay | CT26 | Colon cacer | Not found |
| dbacp05217 | PE-BBI | GALKGCWTKSIPPKPC | Edible frog | Cell membrane permeabilisation | MTT assay | DLD-1 | Human colorectal cancer | IC50 : 50.1 µM |
| dbacp05218 | PE-BBI | GALKGCWTKSIPPKPC | Edible frog | Cell membrane permeabilisation | MTT assay | DKS8 | Human colorectal cancer | IC50 : 9.8 µM |
| dbacp05219 | PE-BBI | GALKGCWTKSIPPKPC | Edible frog | Cell membrane permeabilisation | MTT assay | HCT116 | Human colorectal cancer | IC50 : 35.4 µM |
| dbacp05220 | PE-BBI | GALKGCWTKSIPPKPC | Edible frog | Cell membrane permeabilisation | MTT assay | HKE3 | Human colorectal cancer | IC50 : 50.2 µM |
| dbacp05222 | Penaeidin-2 | YRGGYTGPIPRPPPIGRPPLPRVVCACYRLSVSDARNCCIKFGSCCHLVK | Pacific white shrimp | Induction of apoptosis | MTT assay | HK-2 | Kidney cancer | MIC : 100 μg/mL |
| dbacp05223 | Penaeidin-2 | YRGGYTGPIPRPPPIGRPPLPRVVCACYRLSVSDARNCCIKFGSCCHLVK | Pacific white shrimp | Induction of apoptosis | MTT assay | ACHN | Kidney cancer | MIC : 100 μg/mL |
| dbacp05224 | Penaeidin-2 | YRGGYTGPIPRPPPIGRPPLPRVVCACYRLSVSDARNCCIKFGSCCHLVK | Pacific white shrimp | Induction of apoptosis | MTT assay | A498 | Kidney cancer | MIC : 100 μg/mL |
| dbacp05241 | pentadactylin | GLLDTLKGAAKNVVGSLASKVMEKL | Not found | Inducing apoptosis | MTT assay | B16F10 | Melanoma | IC50 : 25.7 µM |
| dbacp05242 | pentadactylin | GLLDTLKGAAKNVVGSLASKVMEKL | Not found | Inducing apoptosis | MTT assay | FHN | Melanoma | IC50 : 35.9 µM |
| dbacp05244 | Pentapeptide (ILYMP) | ILYMP | Marine invertebrates | Inducing apoptosis | MTT assay | DU-145 | Prostate cancer | IC50 :11.25 mM |
| dbacp05251 | Pep27 | MRKEFHNVLSSGQLLADKRPARDYNRK | Not found | Inducing apoptosis | MTT assay | AML-2 | Acute myelogenous leukemia | IC50 : > 70 µM |
| dbacp05252 | Pep27 | MRKEFHNVLSSGQLLADKRPARDYNRK | Not found | Inducing apoptosis | MTT assay | HL-60 | Acute promyelocytic leukemia | IC50 : > 70 µM |
| dbacp05253 | Pep27 | MRKEFHNVLSSGQLLADKRPARDYNRK | Not found | Inducing apoptosis | MTT assay | Jurkat | T-cell leukemia | IC50 : > 70 µM |
| dbacp05254 | Pep27 | MRKEFHNVLSSGQLLADKRPARDYNRK | Not found | Inducing apoptosis | MTT assay | SNU-601 | Gastric cancer | IC50 : > 70 µM |
| dbacp05255 | Pep27 | MRKEFHNVLSSGQLLADKRPARDYNRK | Not found | Inducing apoptosis | MTT assay | MCF-7 | Breast cancer | IC50 : > 70 µM |
| dbacp05257 | Pep27 anal1 | MWKWFHNVLSSWQLLADKRPARDYNRK | Not found | Inducing apoptosis | MTT assay | AML-2 | Acute myelogenous leukemia | IC50 : 50 µM |
| dbacp05258 | Pep27 anal1 | MWKWFHNVLSSWQLLADKRPARDYNRK | Not found | Inducing apoptosis | MTT assay | HL-60 | Acute promyelocytic leukemia | IC50 : 53 µM |
| dbacp05259 | Pep27 anal1 | MWKWFHNVLSSWQLLADKRPARDYNRK | Not found | Inducing apoptosis | MTT assay | Jurkat | T-cell leukemia | IC50 : 47 µM |
| dbacp05260 | Pep27 anal1 | MWKWFHNVLSSWQLLADKRPARDYNRK | Not found | Inducing apoptosis | MTT assay | SNU-601 | Gastric cancer | IC50 : 37 µM |
| dbacp05261 | Pep27 anal1 | MWKWFHNVLSSWQLLADKRPARDYNRK | Not found | Inducing apoptosis | MTT assay | MCF-7 | Breast cancer | IC50 : 55 µM |
| dbacp05262 | Pep27 anal2 | MWKWFHNVLSWWWLLADKRPARDYNRK | Not found | Inducing apoptosis | MTT assay | AML-2 | Acute myelogenous leukemia | IC50 : 29 µM |
| dbacp05263 | Pep27 anal2 | MWKWFHNVLSWWWLLADKRPARDYNRK | Not found | Inducing apoptosis | MTT assay | HL-60 | Acute promyelocytic leukemia | IC50 : 20 µM |
| dbacp05264 | Pep27 anal2 | MWKWFHNVLSWWWLLADKRPARDYNRK | Not found | Inducing apoptosis | MTT assay | Jurkat | T cell leukemia | IC50 : 23 µM |
| dbacp05265 | Pep27 anal2 | MWKWFHNVLSWWWLLADKRPARDYNRK | Not found | Inducing apoptosis | MTT assay | SNU-601 | Gastric cancer | IC50 : 25 µM |
| dbacp05266 | Pep27 anal2 | MWKWFHNVLSWWWLLADKRPARDYNRK | Not found | Inducing apoptosis | MTT assay | MCF-7 | Breast cancer | IC50 : < 10 µM |
| dbacp05267 | Pep27 anal3 | MRKWFHNVLSSGQLLADKWPAWDYNRK | Not found | Inducing apoptosis | MTT assay | AML-2 | Acute myelogenous leukemia | IC50 : 67 µM |
| dbacp05268 | Pep27 anal3 | MRKWFHNVLSSGQLLADKWPAWDYNRK | Not found | Inducing apoptosis | MTT assay | HL-60 | Acute promyelocytic leukemia | IC50 : 52 µM |
| dbacp05269 | Pep27 anal3 | MRKWFHNVLSSGQLLADKWPAWDYNRK | Not found | Inducing apoptosis | MTT assay | Jurkat | T cell leukemia | IC50 : 50 µM |
| dbacp05270 | Pep27 anal3 | MRKWFHNVLSSGQLLADKWPAWDYNRK | Not found | Inducing apoptosis | MTT assay | SNU-601 | Gastric cancer | IC50 : 50 µM |
| dbacp05271 | Pep27 anal3 | MRKWFHNVLSSGQLLADKWPAWDYNRK | Not found | Inducing apoptosis | MTT assay | MCF-7 | Breast cancer | IC50 : 38 µM |
| dbacp05272 | Pep27 anal4 | MWKEFHNVLSSGQLLADKRWARWYNRW | Not found | Inducing apoptosis | MTT assay | AML-2 | Acute myelogenous leukemia | IC50 : 50 µM |
| dbacp05273 | Pep27 anal4 | MWKEFHNVLSSGQLLADKRWARWYNRW | Not found | Inducing apoptosis | MTT assay | HL-60 | Acute promyelocytic leukemia | IC50 : 51 µM |
| dbacp05274 | Pep27 anal4 | MWKEFHNVLSSGQLLADKRWARWYNRW | Not found | Inducing apoptosis | MTT assay | Jurkat | T-cell Leukemia | IC50 : 46 µM |
| dbacp05275 | Pep27 anal4 | MWKEFHNVLSSGQLLADKRWARWYNRW | Not found | Inducing apoptosis | MTT assay | SNU-601 | Gastric cancer | IC50 : 46 µM |
| dbacp05276 | Pep27 anal4 | MWKEFHNVLSSGQLLADKRWARWYNRW | Not found | Inducing apoptosis | MTT assay | MCF-7 | Breast cancer | IC50 : 29 µM |
| dbacp05277 | Pep27 anal5 | MWKWFHNVLSSGQLLADKWWAWWYNWW | Not found | Inducing apoptosis | MTT assay | AML-2 | Acute myelogenous leukemia | IC50 : > 70 µM |
| dbacp05278 | Pep27 anal5 | MWKWFHNVLSSGQLLADKWWAWWYNWW | Not found | Inducing apoptosis | MTT assay | HL-60 | Acute promyelocytic leukemia | IC50 : > 70 µM |
| dbacp05279 | Pep27 anal5 | MWKWFHNVLSSGQLLADKWWAWWYNWW | Not found | Inducing apoptosis | MTT assay | Jurkat | T cell leukemia | IC50 : > 70 µM |
| dbacp05280 | Pep27 anal5 | MWKWFHNVLSSGQLLADKWWAWWYNWW | Not found | Inducing apoptosis | MTT assay | SNU-601 | Gastric cancer | IC50 : > 70 µM |
| dbacp05281 | Pep27 anal5 | MWKWFHNVLSSGQLLADKWWAWWYNWW | Not found | Inducing apoptosis | MTT assay | MCF-7 | Breast cancer | IC50 : > 70 µM |
| dbacp05400 | Peptide from Lentinus Squarrosulus | RYGFTEVAGNFQQHNFGRG | Plant sources | Inducing apoptosis | MTT assay | H460 | Breast cancer | Not found |
| dbacp05401 | Peptide from Lentinus Squarrosulus | RYGFTEVAGNFQQHNFGRG | Plant sources | Inducing apoptosis | MTT assay | DPCs | Breast cancer | Not found |
| dbacp05402 | Peptide from Lentinus Squarrosulus | RYGFTEVAGNFQQHNFGRG | Plant sources | Inducing apoptosis | MTT assay | HK-2 | Breast cancer | Not found |
| dbacp05502 | PHP | ITCPQVTQSLAPCVPYLISG | Plant sources | Inducing apoptosis | MTT assay | Eca-109 | Not found | IC50 : 0.7 µM |
| dbacp05503 | PHP | ITCPQVTQSLAPCVPYLISG | Plant sources | Inducing apoptosis | MTT assay | HeLa | Not found | IC50 : 2.74 µM |
| dbacp05504 | PHP | ITCPQVTQSLAPCVPYLISG | Plant sources | Inducing apoptosis | MTT assay | MGC-7 | Not found | IC50 : 3.13 µM |
| dbacp05505 | PHP | ITCPQVTQSLAPCVPYLISG | Plant sources | Inducing apoptosis | MTT assay | B16 | Not found | IC50 : 1.47 µM |
| dbacp05548 | Phylloseptin-PHa | FLSLIPAAISAVSALANHF | Northern orange-legged leaf frog | Disruption of the membrane | MTT assay, Lactate dehydrogenase (LDH) assay | MDA-MB-435 | Melanocyte | LD50 : < 5 µM |
| dbacp05549 | Phylloseptin-PHa | FLSLIPAAISAVSALANHF | Northern orange-legged leaf frog | Disruption of the membrane | MTT assay, Lactate dehydrogenase (LDH) assay | NCI-H157 | Non-small-cell Lung cancer | LD50 : < 5 µM |
| dbacp05550 | Phylloseptin-PHa | FLSLIPAAISAVSALANHF | Northern orange-legged leaf frog | Disruption of the membrane | MTT assay, Lactate dehydrogenase (LDH) assay | PC-3 | Human prostate carcinoma | LD50 : < 5 µM |
| dbacp05551 | Phylloseptin-PHa | FLSLIPAAISAVSALANHF | Northern orange-legged leaf frog | Disruption of the membrane | MTT assay, Lactate dehydrogenase (LDH) assay | HCT116 | Human colon cancer | LD50 : < 5 µM |
| dbacp05552 | Phylloseptin-PHa | FLSLIPAAISAVSALANHF | Northern orange-legged leaf frog | Disruption of the membrane | MTT assay, Lactate dehydrogenase (LDH) assay | MCF-7 | Human breast cancer | LD50 : < 5 µM |
| dbacp05553 | Phylloseptin-PHa | FLSLIPAAISAVSALANHF | Northern orange-legged leaf frog | Disruption of the membrane | MTT assay, Lactate dehydrogenase (LDH) assay | U251MG | Human glioblastoma astrocytoma | LD50 : < 5 µM |
| dbacp05576 | Pleurocidin | GWGSFFKKAAHVGKHVGKAALTHYL | Winter flounder | Apoptosis inducing; Anti-proliferative activity | MTT assay | J5 | Hepatocellular carcinoma | IC50 : 54.9 µM |
| dbacp05577 | Pleurocidin | GWGSFFKKAAHVGKHVGKAALTHYL | Winter flounder | Apoptosis inducing; Anti-proliferative activity | MTT assay | Hep3B | Hepatocellular carcinoma | IC50 : 340.9 µM |
| dbacp05578 | Pleurocidin | GWGSFFKKAAHVGKHVGKAALTHYL | Winter flounder | Apoptosis inducing; Anti-proliferative activity | MTT assay | A549 | Non-small cell lung adenocarcinoma | IC50 : 300.8 µM |
| dbacp05579 | Pleurocidin | GWGSFFKKAAHVGKHVGKAALTHYL | Winter flounder | Apoptosis inducing; Anti-proliferative activity | MTT assay | AGS | Stomach adenocarcinoma | IC50 : 186.5 µM |
| dbacp05580 | Pleurocidin-a | GWGSFFKKAAHVGKHVGKAALTHYL-NH2 | Winter flounder | Apoptosis inducing; Anti-proliferative activity | MTT assay | J5 | Hepatocellular carcinoma | IC50 :1 1 µM |
| dbacp05581 | Pleurocidin-a | GWGSFFKKAAHVGKHVGKAALTHYL-NH3 | Winter flounder | Apoptosis inducing; Anti-proliferative activity | MTT assay | Huh7 | Hepatocellular carcinoma | IC50 : 60 µM |
| dbacp05582 | Pleurocidin-a | GWGSFFKKAAHVGKHVGKAALTHYL-NH4 | Winter flounder | Apoptosis inducing; Anti-proliferative activity | MTT assay | Hep3B | Hepatocellular carcinoma | IC50 : 77.5 µM |
| dbacp05583 | Pleurocidin-a | GWGSFFKKAAHVGKHVGKAALTHYL-NH5 | Winter flounder | Apoptosis inducing; Anti-proliferative activity | MTT assay | A549 | Non-small cell lung adenocarcinoma | IC50 : 42.1 µM |
| dbacp05584 | Pleurocidin-a | GWGSFFKKAAHVGKHVGKAALTHYL-NH6 | Winter flounder | Apoptosis inducing; Anti-proliferative activity | MTT assay | AGS | Stomach adenocarcinoma | IC50 : 29.8 µM |
| dbacp05585 | Pleurocidin-a | GWGSFFKKAAHVGKHVGKAALTHYL-NH7 | Winter flounder | Apoptosis inducing; Anti-proliferative activity | MTT assay | WiDr | Colon adenocarcinoma | IC50 : 197.3 µM |
| dbacp05586 | Pleurocidin-a | GWGSFFKKAAHVGKHVGKAALTHYL-NH8 | Winter flounder | Apoptosis inducing; Anti-proliferative activity | MTT assay | NIH-3T3 | Mouse fibroblast | IC50 : 313 µM |
| dbacp05863 | RA-V | cyclopeptideRA-V-,cyclo(YAAYAY) | Plant sources | Inducing apoptosis | MTT assay | MCF-7 | Breast cancer | Not found |
| dbacp05864 | RA-V | cyclopeptideRA-V-,cyclo(YAAYAY) | Plant sources | Inducing apoptosis | MTT assay | MDA-MB-231 | Breast cancer | Not found |
| dbacp05865 | RA-V | cyclopeptideRA-V-,cyclo(YAAYAY) | Plant sources | Inducing apoptosis | MTT assay | 4T1 | Breast cancer | Not found |
| dbacp05873 | Radical SAM domain protein | MEAVLYVTRKCNLSCGHCIVDKEDNSDLPTDKVETLASDYPIDRTILSGGEPFLHDNFEELVALVPEPTVLSNGLVLSDEEYVGENSDMLEELNGIQLSVEGKEETTDARRGEGVWDRVMEAHQNLSEIGVESYLRSTYSREMMEEVGELMEFCDAEGISLVLFPEIGKPPLSPTENASFFDYAVEKGVVVATPDFHSYIGEGGECPAARTRISVDVNGEIYPCQFNWDYCLGEVGDEWGLIESRIERFDRTEPVPRTCSRCDFANKCRGCGVADTWSGCPIARGLSHSESPSRRPLKRVQETMNTLEDVGAPRGCHGC | Uncultured archaeon | Apoptosis inducing | MTT assay | MCF-7 | Breast cancer | MIC : 42% ± 8.1 μM |
| dbacp05874 | Radical SAM domain protein | MEAVLYVTRKCNLSCGHCIVDKEDNSDLPTDKVETLASDYPIDRTILSGGEPFLHDNFEELVALVPEPTVLSNGLVLSDEEYVGENSDMLEELNGIQLSVEGKEETTDARRGEGVWDRVMEAHQNLSEIGVESYLRSTYSREMMEEVGELMEFCDAEGISLVLFPEIGKPPLSPTENASFFDYAVEKGVVVATPDFHSYIGEGGECPAARTRISVDVNGEIYPCQFNWDYCLGEVGDEWGLIESRIERFDRTEPVPRTCSRCDFANKCRGCGVADTWSGCPIARGLSHSESPSRRPLKRVQETMNTLEDVGAPRGCHGC | Uncultured archaeon | Apoptosis inducing | MTT assay | U2OS | Osteosarcoma | No significant effect |
| dbacp05971 | Ribosome-inactivating protein lyophyllin (EC 3.2.2.22) | ITFQGCSPARQTVITNAITRARADVRAAVSALPTKAPVSTFSTWFGVYND | Hon-shimeji | Cytotoxicity | MTT assay | Hela | Not found | IC50 : 358.8 μM |
| dbacp05972 | Ribosome-inactivating protein lyophyllin (EC 3.2.2.22) | ITFQGCSPARQTVITNAITRARADVRAAVSALPTKAPVSTFSTWFGVYND | Hon-shimeji | Cytotoxicity | MTT assay | HepG2 | Not found | IC50 : 489.8 μM |
| dbacp05973 | Ribosome-inactivating protein lyophyllin (EC 3.2.2.22) | ITFQGCSPARQTVITNAITRARADVRAAVSALPTKAPVSTFSTWFGVYND | Hon-shimeji | Cytotoxicity | MTT assay | JAR | Not found | IC50 : 926.9 μM |
| dbacp06008 | S1 (Ac-KKWRKWLAKK-NH2) | Ac-NAl-NAl-KKWRKWLAKK-NH2 | Not found | Necrosis or apoptosis | MTT assay | PC9 | Human Lung cancer | Not found |
| dbacp06009 | S1 (Ac-KKWRKWLAKK-NH2) | Ac-NAl-NAl-KKWRKWLAKK-NH2 | Not found | Necrosis or apoptosis | MTT assay | PC9-G | Oral cancer | Not found |
| dbacp06010 | S1 (Ac-KKWRKWLAKK-NH2) | Ac-NAl-NAl-KKWRKWLAKK-NH2 | Not found | Necrosis or apoptosis | MTT assay | A549 | Human lung cancer | Not found |
| dbacp06011 | S1 (Ac-KKWRKWLAKK-NH2) | Ac-NAl-NAl-KKWRKWLAKK-NH2 | Not found | Necrosis or apoptosis | MTT assay | C9 | Oral cancer | Not found |
| dbacp06012 | S1 (Ac-KKWRKWLAKK-NH2) | Ac-NAl-NAl-KKWRKWLAKK-NH2 | Not found | Necrosis or apoptosis | MTT assay | OECM-1 | Human lung cancer | Not found |
| dbacp06013 | S1 (Ac-KKWRKWLAKK-NH2) | Ac-NAl-NAl-KKWRKWLAKK-NH2 | Not found | Necrosis or apoptosis | MTT assay | SAS | Oral cancer | Not found |
| dbacp06021 | SALF | Ac-ECKFTVKPYLKRFQVYYKGRMWCPNH2 | Giant tiger prawn | Regulate apoptosis related death receptor/NF-κB signaling pathway | MTT assay | HeLa | Human lung cancer | MIC : 100 µg/ml |
| dbacp06027 | SCH-P10 | DYVP | Marine invertebrates | Inducing apoptosis | MTT assay | DU-145 | Prostate cancer | IC50 : 1.21 mg/mL |
| dbacp06028 | SCH-P10 | DYVP | Marine invertebrates | Inducing apoptosis | MTT assay | PC-3 | Prostate cancer | IC50 : 1.09 mg/mL |
| dbacp06029 | SCH-P9 | LPGP | Marine invertebrates | Inducing apoptosis | MTT assay | DU-145 | Prostate cancer | IC50 : 1.21 mg/mL |
| dbacp06030 | SCH-P9 | LPGP | Marine invertebrates | Inducing apoptosis | MTT assay | PC-3 | Prostate cancer | IC50 : 1.09 mg/mL |
| dbacp06035 | Scolopin-2 | ILKKFMLHRGTKVYKMRTLSKRSH | Chinese red-headed centipede | Regulate caspase-related apoptosis pathways | MTT assay | Hela | Cervical cancer | IC50 : 35 μM |
| dbacp06063 | Shepherdin | KHSSGCAFL | Not found | Inducing apoptosis | MTT assay | HeLa | Cervical carcinoma | IC50 : 25–75 µM |
| dbacp06064 | Shepherdin | KHSSGCAFL | Not found | Inducing apoptosis | MTT assay | PC3 | Prostate adenocarcinoma | IC50 : 25–75 µM |
| dbacp06065 | Shepherdin | KHSSGCAFL | Not found | Inducing apoptosis | MTT assay | p53+/+ HCT116 | Colorectal carcinoma | IC50 : 25–75 µM |
| dbacp06066 | Shepherdin | KHSSGCAFL | Not found | Inducing apoptosis | MTT assay | p53+/+ HCT116 | Colorectal carcinoma | IC50 : 25–75 µM |
| dbacp06067 | Shepherdin (ATP) | RQIKIWFQNRRMKWKKKHSSGCAFL | Not found | Inducing apoptosis | MTT assay | HeLa | Cervical carcinoma | IC50 : 50–75 μM |
| dbacp06068 | Shepherdin (ATP) | RQIKIWFQNRRMKWKKKHSSGCAFL | Not found | Inducing apoptosis | MTT assay | PC3 | Prostate adenocarcinoma | IC50 : 50–75 μM |
| dbacp06069 | Shepherdin (ATP) | RQIKIWFQNRRMKWKKKHSSGCAFL | Not found | Inducing apoptosis | MTT assay | p53+/+ HCT116 | Colorectal carcinoma | IC50 : 50–75 μM |
| dbacp06070 | Shepherdin (ATP) | RQIKIWFQNRRMKWKKKHSSGCAFL | Not found | Inducing apoptosis | MTT assay | p53+/+ HCT116 | Colorectal carcinoma | IC50 : 50–75 μM |
| dbacp06071 | Shepherdin (TAT) | YGRKKRRQRRRKHSSGCAFL | Not found | Inducing apoptosis | MTT assay | HeLa | Cervical carcinoma | IC50 : 50–75 μM |
| dbacp06072 | Shepherdin (TAT) | YGRKKRRQRRRKHSSGCAFL | Not found | Inducing apoptosis | MTT assay | PC3 | Prostate adenocarcinoma | IC50 : 50–75 μM |
| dbacp06073 | Shepherdin (TAT) | YGRKKRRQRRRKHSSGCAFL | Not found | Inducing apoptosis | MTT assay | p53+/+ HCT116 | Colorectal carcinoma | IC50 : 50–75 μM |
| dbacp06074 | Shepherdin (TAT) | YGRKKRRQRRRKHSSGCAFL | Not found | Inducing apoptosis | MTT assay | p53+/+ HCT116 | Colorectal carcinoma | IC50 : 50–75 μM |
| dbacp06144 | Ss-arasin | MERTLLIVLLVCFLLLAVTAEA | The Indian mud crab | Membrane disruption by pore-formation or by permeating the membrane and acting on intracellular targets | MTT assay | HeLa | Human cervical carcinoma | IC 50 : 3.06 μM |
| dbacp06145 | Ss-arasin | MERTLLIVLLVCFLLLAVTAEA | The Indian mud crab | Membrane disruption by pore-formation or by permeating the membrane and acting on intracellular targets | MTT assay | HT-29 | Colon carcinoma | IC 50 : 2.90 μM |
| dbacp06146 | Ss-arasin | SPRVRRRYGRPFGGRPFVGGQFGGRPGCVCIRSPCPCANYG | The Indian mud crab | Membrane disruption by pore-formation or by permeating the membrane and acting on intracellular targets | MTT assay | HT-29 | Human cervical carcinoma | IC 50 : 2.90 μM |
| dbacp06147 | Ss-arasin | SPRVRRRYGRPFGGRPFVGGQFGGRPGCVCIRSPCPCANYG | The Indian mud crab | Membrane disruption by pore-formation or by permeating the membrane and acting on intracellular targets | MTT assay | HeLa | Colon carcinoma | IC 50 : 3.06 μM |
| dbacp06154 | StigA16 | FFKLIPKLVKGLISAF | Amino acid substitution, amino acid truncation, animal-derived, natural derivative | Disruption of cell membrane | MTT assay | 3T3 | Renal cell adenocarcinoma | IC 50 : 13.01 μM |
| dbacp06155 | StigA16 | FFKLIPKLVKGLISAF | Amino acid substitution, amino acid truncation, animal-derived, natural derivative | Disruption of cell membrane | MTT assay | HeLa | Mouse melanoma | IC 50 : 13.01 μM |
| dbacp06156 | StigA16 | FFKLIPKLVKGLISAF | Amino acid substitution, amino acid truncation, animal-derived, natural derivative | Disruption of cell membrane | MTT assay | 786-0 | Human cervix adenocarcinoma | IC 50 : 13.01 μM |
| dbacp06157 | StigA16 | FFKLIPKLVKGLISAF | Amino acid substitution, amino acid truncation, animal-derived, natural derivative | Disruption of cell membrane | MTT assay | B16 | Human pancreas adenocarcinoma | IC 50 : 13.01 μM |
| dbacp06158 | StigA16 | FFKLIPKLVKGLISAF | Amino acid substitution, amino acid truncation, animal-derived, natural derivative | Disruption of cell membrane | MTT assay | Panc | Mouse fibroblast | IC 50 : 13.01 μM |
| dbacp06159 | StigA6 | FFSLIPKLVKGLISAFK | Amino acid substitution, animal-derived, natural derivative | Disruption of cell membrane | MTT assay | 3T3 | Renal cell adenocarcinoma | IC 50 : 14.01 μM |
| dbacp06160 | StigA6 | FFSLIPKLVKGLISAFK | Amino acid substitution, animal-derived, natural derivative | Disruption of cell membrane | MTT assay | HeLa | Mouse melanoma | IC 50 : 14.01 μM |
| dbacp06161 | StigA6 | FFSLIPKLVKGLISAFK | Amino acid substitution, animal-derived, natural derivative | Disruption of cell membrane | MTT assay | 786-0 | Human cervix adenocarcinoma | IC 50 : 14.01 μM |
| dbacp06162 | StigA6 | FFSLIPKLVKGLISAFK | Amino acid substitution, animal-derived, natural derivative | Disruption of cell membrane | MTT assay | B16 | Human pancreas adenocarcinoma | IC 50 : 14.01 μM |
| dbacp06163 | StigA6 | FFSLIPKLVKGLISAFK | Amino acid substitution, animal-derived, natural derivative | Disruption of cell membrane | MTT assay | Panc | Mouse fibroblast | IC 50 : 14.01 μM |
| dbacp06164 | Stigmurin | FFSLIPSLVGGLISAFK | Venom gland, Yellow scorpion of the Northeast | Cell membrane degradation | MTT assay | SiHa cells | Cervical cancer | IC50 : 118 μM |
| dbacp06165 | Styelin D | GW*LR**K**AAK**SVGK**FY*Y*K**HK*Y*Y*IK*AAWQIGKHAL-NH2 | Asian sea squirt | Disruption of cellular membranes | MTT assay | HCT-116 | Human melanoma cancer | IC50 : 10.1 mg/ml |
| dbacp06183 | t Mastoparan-C(tMP-C, Tat (49-57)-Mastoparan-C) | RKKRRQRRRLNLKALLAVAKKIL | Synthetic construct | Apoptosis inducing | MTT assay | H157 | Non-small cell Lung cancer | IC50 : 2.79 μM |
| dbacp06184 | t Mastoparan-C(tMP-C, Tat (49-57)-Mastoparan-C) | RKKRRQRRRLNLKALLAVAKKIL | Synthetic construct | Apoptosis inducing | MTT assay | MBD-MB-435S | Melanocyte | IC50 : 3.86 μM |
| dbacp06185 | t Mastoparan-C(tMP-C, Tat (49-57)-Mastoparan-C) | RKKRRQRRRLNLKALLAVAKKIL | Synthetic construct | Apoptosis inducing | MTT assay | PC-3 | Human prostate carcinoma | IC50 : 3.86 μM |
| dbacp06186 | t Mastoparan-C(tMP-C, Tat (49-57)-Mastoparan-C) | RKKRRQRRRLNLKALLAVAKKIL | Synthetic construct | Apoptosis inducing | MTT assay | U251-MG | Human glioblastoma astrocytoma | IC50 : 3.36 μM |
| dbacp06187 | t Mastoparan-C(tMP-C, Tat (49-57)-Mastoparan-C) | RKKRRQRRRLNLKALLAVAKKIL | Synthetic construct | Apoptosis inducing | MTT assay | MCF-7 | Human breast cancer | IC50 : 3.70 μM |
| dbacp06267 | Temporin-PE | FLPIVAKLLSGLL | Skin secretions, Common water frog or green frog, Europe | Destabilization of membranes | MTT assay | NCI-H157 | Lung cancer | TI : 10μM |
| dbacp06268 | Temporin-PE | FLPIVAKLLSGLL | Skin secretions, Common water frog or green frog, Europe | Destabilization of membranes | MTT assay | U251MG | Lung cancer | TI : 10μM |
| dbacp06269 | Temporin-PE | FLPIVAKLLSGLL | Skin secretions, Common water frog or green frog, Europe | Destabilization of membranes | MTT assay | PC-3 | Lung cancer | TI : 10μM |
| dbacp06270 | Temporin-PE | FLPIVAKLLSGLL | Skin secretions, Common water frog or green frog, Europe | Destabilization of membranes | MTT assay | MDA-MB-435s | Lung cancer | TI : 10μM |
| dbacp06271 | Temporin-PE | FLPIVAKLLSGLL | Skin secretions, Common water frog or green frog, Europe | Destabilization of membranes | MTT assay | NCI-H157 | Human neuronal glioblastoma | TI : 10μM |
| dbacp06272 | Temporin-PE | FLPIVAKLLSGLL | Skin secretions, Common water frog or green frog, Europe | Destabilization of membranes | MTT assay | U251MG | Human neuronal glioblastoma | TI : 10μM |
| dbacp06273 | Temporin-PE | FLPIVAKLLSGLL | Skin secretions, Common water frog or green frog, Europe | Destabilization of membranes | MTT assay | PC-3 | Human neuronal glioblastoma | TI : 10μM |
| dbacp06274 | Temporin-PE | FLPIVAKLLSGLL | Skin secretions, Common water frog or green frog, Europe | Destabilization of membranes | MTT assay | MDA-MB-435s | Human neuronal glioblastoma | TI : 10μM |
| dbacp06275 | Temporin-PE | FLPIVAKLLSGLL | Skin secretions, Common water frog or green frog, Europe | Destabilization of membranes | MTT assay | NCI-H157 | Human neuronal glioblastoma | TI : 10μM |
| dbacp06276 | Temporin-PE | FLPIVAKLLSGLL | Skin secretions, Common water frog or green frog, Europe | Destabilization of membranes | MTT assay | U251MG | Human prostate carcinoma | TI : 10μM |
| dbacp06277 | Temporin-PE | FLPIVAKLLSGLL | Skin secretions, Common water frog or green frog, Europe | Destabilization of membranes | MTT assay | PC-3 | Human prostate carcinoma | TI : 10μM |
| dbacp06278 | Temporin-PE | FLPIVAKLLSGLL | Skin secretions, Common water frog or green frog, Europe | Destabilization of membranes | MTT assay | MDA-MB-435s | Human prostate carcinoma | TI : 10μM |
| dbacp06279 | Temporin-PE | FLPIVAKLLSGLL | Skin secretions, Common water frog or green frog, Europe | Destabilization of membranes | MTT assay | NCI-H157 | Melanoma | TI : 10μM |
| dbacp06280 | Temporin-PE | FLPIVAKLLSGLL | Skin secretions, Common water frog or green frog, Europe | Destabilization of membranes | MTT assay | U251MG | Melanoma | TI : 10μM |
| dbacp06281 | Temporin-PE | FLPIVAKLLSGLL | Skin secretions, Common water frog or green frog, Europe | Destabilization of membranes | MTT assay | PC-3 | Melanoma | TI : 10μM |
| dbacp06282 | Temporin-PE | FLPIVAKLLSGLL | Skin secretions, Common water frog or green frog, Europe | Destabilization of membranes | MTT assay | MDA-MB-435s | Melanoma | TI : 10μM |
| dbacp06283 | Temporin-PE | FLPIVAKLLSGLL | Skin secretions, Common water frog or green frog, Europe | Destabilization of membranes | MTT assay | NCI-H157 | Lung cancer | TI : approx. 10μM |
| dbacp06284 | Temporin-PE | FLPIVAKLLSGLL | Skin secretions, Common water frog or green frog, Europe | Destabilization of membranes | MTT assay | U251MG | Human neuronal glioblastoma | TI : approx. 10μM |
| dbacp06285 | Temporin-PE | FLPIVAKLLSGLL | Skin secretions, Common water frog or green frog, Europe | Destabilization of membranes | MTT assay | PC-3 | Human prostate carcinoma | TI : approx. 10μM |
| dbacp06286 | Temporin-PE | FLPIVAKLLSGLL | Skin secretions, Common water frog or green frog, Europe | Destabilization of membranes | MTT assay | MDA-MB-435s | Melanoma | TI : approx. 10μM |
| dbacp06306 | Tilapia piscidin 4 | FIHHIIGGLFSAGKAIHRLIRRRRR | Not found | Inducing apoptosis | MTT assay | MG63 | Bone cancer | IC50 : 1–5 µM |
| dbacp06320 | TP | ASVVNKLTGGVAGLLK | Caecum-derived strain TS | Cell membrane permeabilisation | MTT assay | MKN-45 | Gastric cancer | IC 50: 4.686 μM |
| dbacp06321 | TP | ASVVNKLTGGVAGLLK | Caecum-derived strain TS | Cell membrane permeabilisation | MTT assay | NB4 | Acute promyelocytic leukaemia | IC 50: 11.479 μM |
| dbacp06322 | TP3 | FIHHIIGGLFSVGKHIHSLIHGH | Not found | Inducing apoptosis | MTT assay | MG63 | Bone cancer | 10.02 ± 1.10 μM |
| dbacp06381 | TT 1 | KIKAVLKVLTT | Venom base | Inducing apoptosis | MTT assay | TT | Thyroid cancer | IC50 : 18.23 ± 2.81 μg/ml |
| dbacp06382 | TT 1 | KIKAVLKVLTT | Venom base | Inducing apoptosis | MTT assay | TT | Thyroid cancer | IC50 : 3.87 ± 0.34 μg/ml |
| dbacp06383 | TT 1 | KIKAVLKVLTT | Venom base | Inducing apoptosis | MTT assay | TT | Thyroid cancer | IC50 : 2.76 ± 0.32 μg/ml |
| dbacp06500 | Vigno 5 | GLPLCGETCVGGTCNTPGCSCGWPVCVRN | Viola ignobilis | Apoptosis inducing | MTT assay, AO/EB and DAPI staining assay | HeLa cells | Cervical cancer | IC50 : 2.5 – 10 μM |
| dbacp06501 | Vigno 5 | GLPLCGETCVGGTCNTPGCSCGWPVCVRN | Viola ignobilis | Apoptosis inducing | MTT assay, AO/EB and DAPI staining assay | L929 | Cervical cancer | IC50 : 2.5 – 10 μM |
| dbacp06532 | VS-9 | VKLRSLLCS | Plant sources | Inducing apoptosis | MTT assay | MOLT4 | Leukemia | Not found |
| dbacp06533 | VS-9 | VKLRSLLCS | Plant sources | Inducing apoptosis | MTT assay | K562 | Leukemia | Not found |
| dbacp06543 | XLAsp-P1 | DEDDD | Skin, African clawed frog, Africa | Destruction of the cell membrane | MTT assay | MCF-7 cells | Breast cancer | LC50 : < 5 μg/mL |
| dbacp06598 | ZXR-1 | FKIGGFIKKLWRSKLA | Venom base | Inducing apoptosis | MTT assay | Hela | Not found | IC50 : 62.6 ± 8.4 µM |
| dbacp06599 | ZXR-1 | FKIGGFIKKLWRSKLA | Venom base | Inducing apoptosis | MTT assay | SACC-83 | Not found | IC50 : 27.9 ± 7.7 µM |
| dbacp06600 | ZXR-1 | FKIGGFIKKLWRSKLA | Venom base | Inducing apoptosis | MTT assay | PC-3 | Not found | IC50 : 69.1 ± 1.6 µM |
| dbacp06601 | ZXR-1 | FKIGGFIKKLWRSKLA | Venom base | Inducing apoptosis | MTT assay | HuH-7 | Not found | IC50 : 77.9 ± 0.9 µM |
| dbacp06602 | ZXR-1 | FKIGGFIKKLWRSKLA | Venom base | Inducing apoptosis | MTT assay | HepG2 | Not found | IC50 : 141.7 ± 12.2 µM |
| dbacp06603 | ZXR-1 | FKIGGFIKKLWRSKLA | Venom base | Inducing apoptosis | MTT assay | 293T | Not found | IC50 : 186.7 ± 13.1 µM |
| dbacp06604 | ZXR-1 | FKIGGFIKKLWRSKLA | Venom base | Inducing apoptosis | MTT assay | WPMY-1 | Not found | IC50 : 283.3 ± 19.0 µM |
| dbacp06615 | LA3IK | LAIAVK | Migration and invasion enhancer 1 (MIEN1) | Targeting the MIEN1 signaling pathway | MTT assay | MDA-MB-231 | Breast Cancer | IC50 = 223.6 ± 5.62 µM |
| dbacp06616 | LA3IK | LAIAVK | Migration and invasion enhancer 1 (MIEN1) | Targeting the MIEN1 signaling pathway | MTT assay | MCF-7 | Breast Cancer | IC50 = 90.23 ± 7.32 µM |
| dbacp06617 | LA3IK | LAIAVK | Migration and invasion enhancer 1 (MIEN1) | Targeting the MIEN1 signaling pathway | MTT assay | PC-3 | Prostate Cancer | IC50 = 321.4 ± 11.79 µM |
| dbacp06618 | LA3IK | LAIAVK | Migration and invasion enhancer 1 (MIEN1) | Targeting the MIEN1 signaling pathway | MTT assay | DU-145 | Prostate Cancer | IC50 = 335.7 ± 3.09 µM |
| dbacp06619 | D-LA3IK | laiavk | Migration and invasion enhancer 1 (MIEN1) | Targeting the MIEN1 signaling pathway | MTT assay | MDA-MB-231 | Breast Cancer | IC50 = 197.72 ± 5.42 µM |
| dbacp06620 | D-LA3IK | laiavk | Migration and invasion enhancer 1 (MIEN1) | Targeting the MIEN1 signaling pathway | MTT assay | MCF-7 | Breast Cancer | IC50 = 91.2 ± 8.21 µM |
| dbacp06621 | D-LA3IK | laiavk | Migration and invasion enhancer 1 (MIEN1) | Targeting the MIEN1 signaling pathway | MTT assay | PC-3 | Prostate Cancer | IC50 = 98.71 ± 6.17 µM |
| dbacp06622 | D-LA3IK | laiavk | Migration and invasion enhancer 1 (MIEN1) | Targeting the MIEN1 signaling pathway | MTT assay | DU-145 | Prostate Cancer | IC50 = 89.11 ± 8.12 µM |
| dbacp06623 | LA3IK-SCR | LAKAVI | Migration and invasion enhancer 1 (MIEN1) | Targeting the MIEN1 signaling pathway | MTT assay | MDA-MB-231 | Breast Cancer | IC50 = 243 ± 8.16 µM |
| dbacp06624 | LA3IK-SCR | LAKAVI | Migration and invasion enhancer 1 (MIEN1) | Targeting the MIEN1 signaling pathway | MTT assay | MCF-7 | Breast Cancer | IC50 = 133 ± 9.52 µM |
| dbacp06625 | LA3IK-SCR | LAKAVI | Migration and invasion enhancer 1 (MIEN1) | Targeting the MIEN1 signaling pathway | MTT assay | PC-3 | Prostate Cancer | IC50 = 319 ± 13.64 µM |
| dbacp06626 | LA3IK-SCR | LAKAVI | Migration and invasion enhancer 1 (MIEN1) | Targeting the MIEN1 signaling pathway | MTT assay | DU-145 | Prostate Cancer | IC50 = 351.76 ± 7.18 µM |
| dbacp06627 | RP-7 | RPPCVIL | Migration and invasion enhancer 1 (MIEN1) | Targeting the MIEN1 signaling pathway | MTT assay | MDA-MB-231 | Breast Cancer | IC50 = 139.03 ± 8.41 µM |
| dbacp06628 | RP-7 | RPPCVIL | Migration and invasion enhancer 1 (MIEN1) | Targeting the MIEN1 signaling pathway | MTT assay | MCF-7 | Breast Cancer | IC50 = 110.12 ± 4.23 µM |
| dbacp06629 | RP-7 | RPPCVIL | Migration and invasion enhancer 1 (MIEN1) | Targeting the MIEN1 signaling pathway | MTT assay | PC-3 | Prostate Cancer | IC50 = 113 ± 8.02 µM |
| dbacp06630 | RP-7 | RPPCVIL | Migration and invasion enhancer 1 (MIEN1) | Targeting the MIEN1 signaling pathway | MTT assay | DU-145 | Prostate Cancer | IC50 = 120.72 ± 7.08 µM |
| dbacp06631 | D-RP-7 | rppcvil | Migration and invasion enhancer 1 (MIEN1) | Targeting the MIEN1 signaling pathway | MTT assay | MDA-MB-231 | Breast Cancer | IC50 = 95 ± 7.71 µM |
| dbacp06632 | D-RP-7 | rppcvil | Migration and invasion enhancer 1 (MIEN1) | Targeting the MIEN1 signaling pathway | MTT assay | MCF-7 | Breast Cancer | IC50 = 90 ± 10.31 µM |
| dbacp06633 | D-RP-7 | rppcvil | Migration and invasion enhancer 1 (MIEN1) | Targeting the MIEN1 signaling pathway | MTT assay | PC-3 | Prostate Cancer | IC50 = 101 ± 5.73 µM |
| dbacp06634 | D-RP-7 | rppcvil | Migration and invasion enhancer 1 (MIEN1) | Targeting the MIEN1 signaling pathway | MTT assay | DU-145 | Prostate Cancer | IC50 = 121.59 ± 6.56 µM |
| dbacp06635 | RP7 SCR | RPPLVIC | Migration and invasion enhancer 1 (MIEN1) | Targeting the MIEN1 signaling pathway | MTT assay | MDA-MB-231 | Breast Cancer | IC50 = 156 ± 8.15 µM |
| dbacp06636 | RP7 SCR | RPPLVIC | Migration and invasion enhancer 1 (MIEN1) | Targeting the MIEN1 signaling pathway | MTT assay | MCF-7 | Breast Cancer | IC50 = 150 ± 10.32 µM |
| dbacp06637 | RP7 SCR | RPPLVIC | Migration and invasion enhancer 1 (MIEN1) | Targeting the MIEN1 signaling pathway | MTT assay | PC-3 | Prostate Cancer | IC50 = 128 ± 11.65 µM |
| dbacp06638 | RP7 SCR | RPPLVIC | Migration and invasion enhancer 1 (MIEN1) | Targeting the MIEN1 signaling pathway | MTT assay | DU-145 | Prostate Cancer | IC50 = 137 ± 5.98 µM |
| dbacp06639 | C-Mel | CGIGAVLKVLTTGLPALISWIKRKRQQ | Synthetic analogue | Plasma memberane pore formation | MTT assay | HeLa | Cervical Cancer | IC50 = 64.15 µg/mL |
| dbacp06640 | C-Mel | CGIGAVLKVLTTGLPALISWIKRKRQQ | Synthetic analogue | Plasma memberane pore formation | MTT assay | C-33A | Cervical Cancer | IC50 = 44.76 µg/mL |
| dbacp06641 | C-Mel | CGIGAVLKVLTTGLPALISWIKRKRQQ | Synthetic analogue | Plasma memberane pore formation | MTT assay | MCF-7 | Breast Cancer | IC50 = 110.59 µg/mL |
| dbacp06642 | CM–FA | CGIGAVLKVLTTGLPALISWIKRKRQQ | Synthetic analogue | Plasma memberane pore formation | MTT assay | HeLa | Cervical Cancer | IC50 = 67.34 µg/mL |
| dbacp06643 | CM–FA | CGIGAVLKVLTTGLPALISWIKRKRQQ | Synthetic analogue | Plasma memberane pore formation | MTT assay | C-33A | Cervical Cancer | IC50 = 35.75 µg/mL |
| dbacp06644 | CM–FA | CGIGAVLKVLTTGLPALISWIKRKRQQ | Synthetic analogue | Plasma memberane pore formation | MTT assay | MCF-7 | Breast Cancer | IC50 = 10.38 µg/mL |
| dbacp06645 | Mel-C | GIGAVLKVLTTGLPALISWIKRKRQQC | Synthetic analogue | Plasma memberane pore formation | MTT assay | HeLa | Cervical Cancer | IC50 = 50.72 µg/mL |
| dbacp06646 | Mel-C | GIGAVLKVLTTGLPALISWIKRKRQQC | Synthetic analogue | Plasma memberane pore formation | MTT assay | C-33A | Cervical Cancer | IC50 = 58.63 µg/mL |
| dbacp06647 | Mel-C | GIGAVLKVLTTGLPALISWIKRKRQQC | Synthetic analogue | Plasma memberane pore formation | MTT assay | MCF-7 | Breast Cancer | IC50 = 160.62 µg/mL |
| dbacp06648 | MC–FA | GIGAVLKVLTTGLPALISWIKRKRQQC | Synthetic analogue | Plasma memberane pore formation | MTT assay | HeLa | Cervical Cancer | IC50 = 66.43 µg/mL |
| dbacp06649 | MC–FA | GIGAVLKVLTTGLPALISWIKRKRQQC | Synthetic analogue | Plasma memberane pore formation | MTT assay | C-33A | Cervical Cancer | IC50 = 35.22 µg/ mL |
| dbacp06650 | MC–FA | GIGAVLKVLTTGLPALISWIKRKRQQC | Synthetic analogue | Plasma memberane pore formation | MTT assay | MCF-7 | Breast Cancer | IC50 = 12.63 µg/mL |
| dbacp06656 | LfcinB (21-25)Pal | RWQWRWQWR | LfcinB | Apoptosis inducing | MTT assay | CaCo-2 | Colorectal Cancer | IC50 = 86 μM |
| dbacp06657 | LfcinB (21-25)Pal | RWQWRWQWR | LfcinB | Apoptosis inducing | MTT assay | HT-29 | Colon Cancer | IC50 = 100 μM |
| dbacp06658 | LfcinB (21-25)Pal | RWQWRWQWR | LfcinB | Apoptosis inducing | MTT assay | DU-145 | Prostrate Cancer | IC50 = 40 μM |
| dbacp06659 | Ahx-[Pal] | Ahx-RWQWRWQWR | Synthetic | Apoptosis inducing | MTT assay | HT-29 | Colon Cancer | IC50 = 119 μM |
| dbacp06660 | Ahx-[Pal] | Ahx-RWQWRWQWR | Synthetic | Apoptosis inducing | MTT assay | CaCo-2 | Colorectal Cancer | IC50 = 40 μM |
| dbacp06661 | 9[Orn] [Pal] | RWQWRWQWO | Synthetic | Apoptosis inducing | MTT assay | HT-29 | Colon Cancer | IC50 = 109 μM |
| dbacp06662 | 9[Orn] [Pal] | RWQWRWQWO | Synthetic | Apoptosis inducing | MTT assay | CaCo-2 | Colorectal Cancer | IC50 = 40 μM |
| dbacp06663 | 9[Orn] [Pal] | RWQWRWQWO | Synthetic | Apoptosis inducing | MTT assay | DU-145 | Prostrate Cancer | IC50 = 62 μM |
| dbacp06664 | CH3CO-Ahx-[Pal] | CH3-CO-Ahx-RWQWRWQWR | Synthetic | Apoptosis inducing | MTT assay | CaCo-2 | Colorectal Cancer | IC50 = 31 μM |
| dbacp06665 | 1[dR][Pal] | rWQWRWQWR | Synthetic | Apoptosis inducing | MTT assay | CaCo-2 | Colorectal Cancer | IC50 = 105 μM |
| dbacp06666 | 1[Orn] [Pal] | OWQWRWQWR | Synthetic | Apoptosis inducing | MTT assay | CaCo-2 | Colorectal Cancer | IC50 = 91 μM |
| dbacp06667 | 5[Orn] [Pal] | RWQWOWQWR | Synthetic | Apoptosis inducing | MTT assay | CaCo-2 | Colorectal Cancer | IC50 = 64 μM |
| dbacp06668 | 1[dR] 5[Orn] [Pal] | rWQWOWQWR | Synthetic | Apoptosis inducing | MTT assay | CaCo-2 | Colorectal Cancer | IC50 = 109 μM |
| dbacp06669 | Crabrolin | FLPLILRKIVTAL | European hornet (Vespa crabro) | Not available | MTT assay | H-838 | Lung Cancer | IC50 = 27.71 μM |
| dbacp06670 | Crabrolin | FLPLILRKIVTAL | European hornet (Vespa crabro) | Not available | MTT assay | PC-3 | Prostate Cancer | IC50 = 32.13 μM |
| dbacp06671 | Crabrolin | FLPLILRKIVTAL | European hornet (Vespa crabro) | Not available | MTT assay | U-251-MG | Brain Tumor | IC50 = 20.13 μM |
| dbacp06672 | Crabrolin | FLPLILRKIVTAL | European hornet (Vespa crabro) | Not available | MTT assay | HCT-116 | Colon Cancer | IC50 = 8.539 μM |
| dbacp06673 | Crabrolin | FLPLILRKIVTAL | European hornet (Vespa crabro) | Not available | MTT assay | MCF-7 | Breast Cancer | IC50 = 26.49 μM |
| dbacp06674 | Crabrolin-4R | FLPRILRKIVTAL | Synthetic Analog of Crabrolin | Not available | MTT assay | H-838 | Lung Cancer | IC50 = 11.40 μM |
| dbacp06675 | Crabrolin-4R | FLPRILRKIVTAL | Synthetic Analog of Crabrolin | Not available | MTT assay | PC-3 | Prostate Cancer | IC50 = 17.98 μM |
| dbacp06676 | Crabrolin-4R | FLPRILRKIVTAL | Synthetic Analog of Crabrolin | Not available | MTT assay | U-251-MG | Brain Tumor | IC50 = 25.09 μM |
| dbacp06677 | Crabrolin-4R | FLPRILRKIVTAL | Synthetic Analog of Crabrolin | Not available | MTT assay | HCT-116 | Colon Cancer | IC50 = 47.02 μM |
| dbacp06678 | Crabrolin-4R | FLPRILRKIVTAL | Synthetic Analog of Crabrolin | Not available | MTT assay | MCF-7 | Breast Cancer | IC50 = 20.26 μM |
| dbacp06679 | Crabrolin-4K | FLPKILRKIVTAL | Synthetic Analog of Crabrolin | Not available | MTT assay | H-838 | Lung Cancer | IC50 = 22.55 μM |
| dbacp06680 | Crabrolin-4K | FLPKILRKIVTAL | Synthetic Analog of Crabrolin | Not available | MTT assay | PC-3 | Prostate Cancer | IC50 = 20.58 μM |
| dbacp06681 | Crabrolin-4K | FLPKILRKIVTAL | Synthetic Analog of Crabrolin | Not available | MTT assay | U-251-MG | Brain Tumor | IC50 = 23.51 μM |
| dbacp06682 | Crabrolin-4K | FLPKILRKIVTAL | Synthetic Analog of Crabrolin | Not available | MTT assay | HCT-116 | Colon Cancer | IC50 = 42.88 μM |
| dbacp06683 | Crabrolin-4K | FLPKILRKIVTAL | Synthetic Analog of Crabrolin | Not available | MTT assay | MCF-7 | Breast Cancer | IC50 = 23.18 μM |
| dbacp06684 | Crabrolin-TR | FLPRILRKIVRAL | Synthetic Analog of Crabrolin | Not available | MTT assay | H-838 | Lung Cancer | IC50 = 4.637 μM |
| dbacp06685 | Crabrolin-TR | FLPRILRKIVRAL | Synthetic Analog of Crabrolin | Not available | MTT assay | PC-3 | Prostate Cancer | IC50 = 3.944 μM |
| dbacp06686 | Crabrolin-TR | FLPRILRKIVRAL | Synthetic Analog of Crabrolin | Not available | MTT assay | U-251-MG | Brain Tumor | IC50 = 12.40 μM |
| dbacp06687 | Crabrolin-TR | FLPRILRKIVRAL | Synthetic Analog of Crabrolin | Not available | MTT assay | HCT-116 | Colon Cancer | IC50 = 2.810 μM |
| dbacp06688 | Crabrolin-TR | FLPRILRKIVRAL | Synthetic Analog of Crabrolin | Not available | MTT assay | MCF-7 | Breast Cancer | IC50 = 3.459 μM |
| dbacp06689 | Crabrolin-FR | RLPRILRKIVRAL | Synthetic Analog of Crabrolin | Not available | MTT assay | H-838 | Lung Cancer | IC50 = 31.51 μM |
| dbacp06690 | Crabrolin-FR | RLPRILRKIVRAL | Synthetic Analog of Crabrolin | Not available | MTT assay | PC-3 | Prostate Cancer | IC50 = 15.87 μM |
| dbacp06691 | Crabrolin-FR | RLPRILRKIVRAL | Synthetic Analog of Crabrolin | Not available | MTT assay | U-251-MG | Brain Tumor | IC50 = 62.17 μM |
| dbacp06692 | Crabrolin-FR | RLPRILRKIVRAL | Synthetic Analog of Crabrolin | Not available | MTT assay | HCT-116 | Colon Cancer | IC50 = 30.29 μM |
| dbacp06693 | Crabrolin-FR | RLPRILRKIVRAL | Synthetic Analog of Crabrolin | Not available | MTT assay | MCF-7 | Breast Cancer | IC50 = 33.85 μM |
| dbacp06694 | Crabrolin-AR | RLPRILRKIVRRL | Synthetic Analog of Crabrolin | Not available | MTT assay | H-838 | Lung Cancer | IC50 = 41.31 μM |
| dbacp06695 | Crabrolin-AR | RLPRILRKIVRRL | Synthetic Analog of Crabrolin | Not available | MTT assay | PC-3 | Prostate Cancer | IC50 = 28.78 μM |
| dbacp06696 | Crabrolin-AR | RLPRILRKIVRRL | Synthetic Analog of Crabrolin | Not available | MTT assay | U-251-MG | Brain Tumor | IC50 = 52.01 μM |
| dbacp06697 | Crabrolin-AR | RLPRILRKIVRRL | Synthetic Analog of Crabrolin | Not available | MTT assay | HCT-116 | Colon Cancer | IC50 = 29.90 μM |
| dbacp06698 | Crabrolin-AR | RLPRILRKIVRRL | Synthetic Analog of Crabrolin | Not available | MTT assay | MCF-7 | Breast Cancer | IC50 = 32.51 μM |
| dbacp06699 | Crabrolin-PR | RLRRILRKIVRRL | Synthetic Analog of Crabrolin | Not available | MTT assay | H-838 | Lung Cancer | IC50 = 32.32 μM |
| dbacp06700 | Crabrolin-PR | RLRRILRKIVRRL | Synthetic Analog of Crabrolin | Not available | MTT assay | PC-3 | Prostate Cancer | IC50 = 22.37 μM |
| dbacp06701 | Crabrolin-PR | RLRRILRKIVRRL | Synthetic Analog of Crabrolin | Not available | MTT assay | U-251-MG | Brain Tumor | IC50 = 17.70 μM |
| dbacp06702 | Crabrolin-PR | RLRRILRKIVRRL | Synthetic Analog of Crabrolin | Not available | MTT assay | HCT-116 | Colon Cancer | IC50 = 16.29 μM |
| dbacp06703 | Crabrolin-PR | RLRRILRKIVRRL | Synthetic Analog of Crabrolin | Not available | MTT assay | MCF-7 | Breast Cancer | IC50 = 12.29 μM |
| dbacp06704 | P05 | ADDGRPFPQVIK | Aldolase A fragment | Apoptosis inducing | MTT assay | MG-63 | Bone Cancer | Relative viability = 0.85 at 50 μg/ml |
| dbacp06705 | P05 | ADDGRPFPQVIK | Aldolase A fragment | Apoptosis inducing | MTT assay | U-2 OS | Bone Cancer | Relative viability = 0.98 at 50 μg/ml |
| dbacp06706 | P02 | AEEYEFLTPMEEAPK | Rho GDP Dissociation Inhibitor Alpha fragment | Apoptosis inducing | MTT assay | MG-63 | Bone Cancer | Relative viability = 0.88 at 50 μg/ml |
| dbacp06707 | P02 | AEEYEFLTPMEEAPK | Rho GDP Dissociation Inhibitor Alpha fragment | Apoptosis inducing | MTT assay | U-2 OS | Bone Cancer | Relative viability = 0.93 at 50 μg/ml |
| dbacp06708 | P01 | SETAPAAPAAPAPAEK | Histone H1.4 (H1-4) Fragment | Apoptosis inducing | MTT assay | MG-63 | Bone Cancer | Relative viability = 0.84 at 50 μg/ml |
| dbacp06709 | P01 | SETAPAAPAAPAPAEK | Histone H1.4 (H1-4) Fragment | Apoptosis inducing | MTT assay | U-2 OS | Bone Cancer | Relative viability = 1.13 at 50 μg/ml |
| dbacp06710 | P03 | HVFGESDELIGQK | Triosephosphate Isomerase (TPI) fragment | Apoptosis inducing | MTT assay | MG-63 | Bone Cancer | Relative viability = 1.04 at 50 μg/ml |
| dbacp06711 | P03 | HVFGESDELIGQK | Triosephosphate Isomerase (TPI) fragment | Apoptosis inducing | MTT assay | U-2 OS | Bone Cancer | Relative viability = 0.98 at 50 μg/ml |
| dbacp06712 | P06 | GAGTGGLGLAVEGPSEAK | FLNA (Filamin A) fragment | Apoptosis inducing | MTT assay | MG-63 | Bone Cancer | Relative viability = 0.92 at 50 μg/ml |
| dbacp06713 | P06 | GAGTGGLGLAVEGPSEAK | FLNA (Filamin A) fragment | Apoptosis inducing | MTT assay | U-2 OS | Bone Cancer | Relative viability = 1.17 at 50 μg/ml |
| dbacp06714 | P07 | VEPGLGADNSVVR | FLNA (Filamin A) fragment | Apoptosis inducing | MTT assay | MG-63 | Bone Cancer | Relative viability = 0.96 at 50 μg/ml |
| dbacp06715 | P07 | VEPGLGADNSVVR | FLNA (Filamin A) fragment | Apoptosis inducing | MTT assay | U-2 OS | Bone Cancer | Relative viability = 0.96 at 50 μg/ml |
| dbacp06716 | P08 | NSNLVGAAHEELQQSR | Lamin A/C (LMNA) fragment | Apoptosis inducing | MTT assay | MG-63 | Bone Cancer | Relative viability = 0.92 at 50 μg/ml |
| dbacp06717 | P08 | NSNLVGAAHEELQQSR | Lamin A/C (LMNA) fragment | Apoptosis inducing | MTT assay | U-2 OS | Bone Cancer | Relative viability = 1.06 at 50 μg/ml |
| dbacp06718 | P09 | AAGTLYTYPENWR | Eukaryotic Translation Elongation Factor 1 Gamma (Eef1G) fragment | Apoptosis inducing | MTT assay | MG-63 | Bone Cancer | Relative viability = 0.85 at 50 μg/ml |
| dbacp06719 | P09 | AAGTLYTYPENWR | Eukaryotic Translation Elongation Factor 1 Gamma (Eef1G) fragment | Apoptosis inducing | MTT assay | U-2 OS | Bone Cancer | Relative viability = 1.07 at 50 μg/ml |
| dbacp06720 | P10 | FAAATGATPIAGR | 40S ribosomal protein fragment | Apoptosis inducing | MTT assay | MG-63 | Bone Cancer | Relative viability = 1.08 at 50 μg/ml |
| dbacp06721 | P10 | FAAATGATPIAGR | 40S ribosomal protein fragment | Apoptosis inducing | MTT assay | U-2 OS | Bone Cancer | Relative viability = 1.01 at 50 μg/ml |
| dbacp06722 | GE18 | GAGIVVASIDTGVRVSHE | Aphanomyces invadans | Not available | MTT assay | MCF-7 | Breast Cancer | IC50 = 35.34 µM |
| dbacp06723 | L14 | ALWKSILKNAGKALNEINQIVQ | Dermaseptin-SS1- Analog | Membrane Permeabilization | MTT assay | H-838 | Lung Cancer | IC50 = 64.4 µM |
| dbacp06724 | L14 | ALWKSILKNAGKALNEINQIVQ | Dermaseptin-SS1- Analog | Membrane Permeabilization | MTT assay | H-460 | Lung Cancer | IC50 = 20.1 µM |
| dbacp06725 | 14V | ALWKSILKNAGKAVLNEINQIVQ | Dermaseptin-SS1- Analog | Membrane Permeabilization | MTT assay | H-838 | Lung Cancer | IC50 = 7.0 µM |
| dbacp06726 | 14V | ALWKSILKNAGKAVLNEINQIVQ | Dermaseptin-SS1- Analog | Membrane Permeabilization | MTT assay | H-460 | Lung Cancer | IC50 = 4.1 µM |
| dbacp06727 | 14G | ALWKSILKNAGKAGLNEINQIVQ | Dermaseptin-SS1- Analog | Membrane Permeabilization | MTT assay | H-838 | Lung Cancer | IC50 = 48.7 µM |
| dbacp06728 | 14G | ALWKSILKNAGKAGLNEINQIVQ | Dermaseptin-SS1- Analog | Membrane Permeabilization | MTT assay | H-460 | Lung Cancer | IC50 = 31.7 µM |
| dbacp06729 | L2V | ALWKSILKNVGKVLNEINQIVQ | Dermaseptin-SS1- Analog | Membrane Permeabilization | MTT assay | H-838 | Lung Cancer | IC50 = 2.2 µM |
| dbacp06730 | L2V | ALWKSILKNVGKVLNEINQIVQ | Dermaseptin-SS1- Analog | Membrane Permeabilization | MTT assay | H-460 | Lung Cancer | IC50 = 0.6 µM |
| dbacp06731 | 14V5K | ALWKKILKNAGKAVLNEINQIVQ | Dermaseptin-SS1- Analog | Membrane Permeabilization | MTT assay | H-838 | Lung Cancer | IC50 = 8.1 µM |
| dbacp06732 | 14V5K | ALWKKILKNAGKAVLNEINQIVQ | Dermaseptin-SS1- Analog | Membrane Permeabilization | MTT assay | H-460 | Lung Cancer | IC50 = 6.1 µM |
| dbacp06733 | 14VL23 | ALWKSILKNAGKAVLNEINQIV | Dermaseptin-SS1- Analog | Membrane Permeabilization | MTT assay | H-838 | Lung Cancer | IC50 = 5.7 µM |
| dbacp06734 | 14VL23 | ALWKSILKNAGKAVLNEINQIV | Dermaseptin-SS1- Analog | Membrane Permeabilization | MTT assay | H-460 | Lung Cancer | IC50 = 16.4 µM |
| dbacp06737 | Aurein 1.2_mutant (Aurm) | GLFDIIKKIIKSF | Synthetic | Necrotic activity via cell membrane lysis and apoptotic activity through disrupting mitochondrial membrane | MTT assay | SW-480 | Colon Cancer | 51.63% cell viability |
| dbacp06738 | Aurein 1.2_mutant (Aurm) | GLFDIIKKIIKSF | Synthetic | Necrotic activity via cell membrane lysis and apoptotic activity through disrupting mitochondrial membrane | MTT assay | HT-29 | Colon Cancer | 66.10% cell viability |
| dbacp06739 | Aurein 1.2_R5 (R5-Aur) | RRRRRGLFDIIKKIAESF | Synthetic | Necrotic activity via cell membrane lysis and apoptotic activity through disrupting mitochondrial membrane | MTT assay | SW-480 | Colon Cancer | 43.89% cell viability |
| dbacp06740 | Aurein 1.2_R5 (R5-Aur) | RRRRRGLFDIIKKIAESF | Synthetic | Necrotic activity via cell membrane lysis and apoptotic activity through disrupting mitochondrial membrane | MTT assay | HT-29 | Colon Cancer | 61.56% cell viability |
| dbacp06741 | Aurein 1.2_mutant_R5 (R5-Aurm) | RRRRRGLFDIIKKIIKSF | Synthetic | Necrotic activity via cell membrane lysis and apoptotic activity through disrupting mitochondrial membrane | MTT assay | SW-480 | Colon Cancer | 40.62% cell viability |
| dbacp06742 | Aurein 1.2_mutant_R5 (R5-Aurm) | RRRRRGLFDIIKKIIKSF | Synthetic | Necrotic activity via cell membrane lysis and apoptotic activity through disrupting mitochondrial membrane | MTT assay | HT-29 | Colon Cancer | 54.22% cell viability |
| dbacp06749 | mPNC-NLS | QETFSDLWKLLVQRKRQKLMP | Synthetic | p53-mediated apoptosis | MTT assay | A-549 | Lung Cancer | IC50 = 44.9 μM |
| dbacp06750 | mPNC-NLS | QETFSDLWKLLVQRKRQKLMP | Synthetic | p53-mediated apoptosis | MTT assay | U-87 | Brain Tumor | IC50 = 56.9 μM |
| dbacp06752 | Salamandrin - I | FAVWGCADYRGY | Salamandra salamandra | Pyroptosis mediated | MTT assay | HL-60 | Leukemia Cancer | IC50 = 27 µM |
| dbacp06754 | 37-mer peptide | TKEQKEQIAKATGLTTKQVRNWYVQLNASIKVCMCSC | Synthetic | Apoptosis inducing | MTT assay | SNU-449 | Liver Cancer | IC50 = 76.4 ± 0.6015 μM |
| dbacp06755 | 37-mer peptide | TKEQKEQIAKATGLTTKQVRNWYVQLNASIKVCMCSC | Synthetic | Apoptosis inducing | MTT assay | HepG-2 | Liver Cancer | IC50 = 33.65 ± 1.09 μM |
| dbacp06756 | 37-mer peptide | TKEQKEQIAKATGLTTKQVRNWYVQLNASIKVCMCSC | Synthetic | Apoptosis inducing | MTT assay | SK-OV-3 | Ovarian cancer | IC50 = 27.45 ± 1.5085 μM |
| dbacp06757 | ATMP5 | THPPTTTTTTTTTTTYTAAPATTT | Synthetic Analog of ATMP1 | Apoptosis inducing | MTT assay | MDA-MB-231 | Breast Cancer | IC50 = 64.04 ± 0.021 μg /ml |
| dbacp06758 | ATMP1 | THPPTTTTTTTTTTTYTAAPATTT | Anabas testudineus | Apoptosis inducing | MTT assay | MDA-MB-231 | Breast Cancer | IC50 = 8.25 ± 0.14 μg/ml |
| dbacp06759 | p28 | LSTAADMQGVVTDGMASGLDKDYLKPDD | Pseudomonas aeruginosa | Apoptosis inducing | MTT assay | HT-29 | Colon Cancer | IC50 ~ 200 μg/ml |
| dbacp06760 | p28 | LSTAADMQGVVTDGMASGLDKDYLKPDD | Pseudomonas aeruginosa | Apoptosis inducing | MTT assay | CT-26 | Colorectal Cancer | IC50 ~ 150 μg/ml |
| dbacp06761 | RP7 | ATRQPNH | RAGE(receptor for advanced glycation end product) inhibitor | Apoptosis inducing | MTT assay | MDA-MB-231 | Breast Cancer | IC50 = 24.5 µM |
| dbacp06762 | RP7 | ATRQPNH | RAGE(receptor for advanced glycation end product) inhibitor | Apoptosis inducing | MTT assay | BT-549 | Breast Cancer | IC50 = 29.9 µM |
| dbacp06771 | Moricin | AKIPIKAAIKTVGKAVGKGLRAINIASTANDVFNFLKPKKRKA | Bombyx mori | Peptide-induced cell death | MTT assay | MDA-MB-231 | Triple-negative Breast Cancer | 70% cell viability at 6.25 µg/ml |
| dbacp06774 | PMAP-NC | RIIDRLWLVRRPQKPKFVLVWVL | Synthetic Analgog of PMAP-23 | Membrane permeabilization | MTT assay | MDA-MB-361 | Breast Cancer | IC50 = 6.4 μM |
| dbacp06775 | PMAP-NC | RIIDRLWLVRRPQKPKFVLVWVL | Synthetic Analgog of PMAP-24 | Membrane permeabilization | MTT assay | A-549 | Lung Cancer | IC50 = 7.1 μM |
| dbacp06776 | MP1-Q12K | IDWKKLLDAAKLIL | Analog of Polybia MP1 | Not available | MTT assay | A-549 | Lung Cancer | IC50 = 12.5 μM |
| dbacp06793 | CPSA-CPSC-L-ACAN | Not Available | Recombinant Fusion Peptide | Apoptosis inducing | MTT assay | HeLa | Cervical Cancer | IC50 = 63.15 μg/ml |
| dbacp06794 | CM11 | WKLFKKILKVL | Cecropin-Melittin Hybrid Peptide | Apoptosis inducing | MTT assay | Jurkat | Blood Cancer | Survival rate = 47% at 32 μg/ml |
| dbacp06795 | CM11 | WKLFKKILKVL | Cecropin-Melittin Hybrid Peptide | Apoptosis inducing | MTT assay | Raji | Blood Cancer | Survival rate = 51% at 32 μg/ml |
| dbacp06796 | LHRH-BinBC | QHWSYGLRPGGRGPKDAVRAVKGSALLPCIIVHDPNLNNSDKMKFNTYYLLEYKEYWHQLWSQIIPAHQTVKIQERTGISEVVQNSMIEDLNMYIGADFGMYFYLRSSGFKEQITRGLNRPLSQTTTQLGERVEEMEYYNSNDLDVRYVKYALAREFTLKRVNGEIVKNWVAVDYRMAGIQSYPNAPITNPLTLT | Synthetic | Apoptosis inducing | MTT assay | MCF-7 | Breast Cancer | IC50 = 10.96 μM |
| dbacp06798 | Test peptide | YSFGL | Neuropep Peptide | Not available | MTT assay | A-549 | Lung Cancer | IC50 = 26.417±0.660 µM |
| dbacp06799 | Test peptide | YSFGL | Neuropep Peptide | Not available | MTT assay | MDA-MB-231 | Lung Cancer | IC50 = 39.047±0.770 µM |
| dbacp06859 | ALA-A2 | KLWCKSSQVPQSR | Alpha-Lactalbumin | Not available | MTT assay | A-549 | Lung Cancer | ~50% cell viability |
| dbacp06860 | ALA-A2 | KLWCKSSQVPQSR | Alpha-Lactalbumin | Not available | MTT assay | HT-29 | Colon Cancer | ~50% cell viability |
| dbacp06861 | LK-LE1 | CLKKLLKLLKKLLKLCLHELLEHLHELLEH | Synthetic | Membrane disruption | MTT assay | HeLa | Cervical Cancer | IC50 = 11.3 µM at pH 6 |
| dbacp06862 | LK-LE2 | CLKKLLKLLKKLLKLCLEHLLEHLEHLLEH | Synthetic | Membrane disruption | MTT assay | HeLa | Cervical Cancer | IC50 = 12.9 µM at pH 6 |
| dbacp06863 | LK-LE3 | CLKKLLKLLKKLLKLCLEELLHHLEELLHH | Synthetic | Membrane disruption | MTT assay | HeLa | Cervical Cancer | IC50 = 10.2 µM at pH 6 |
| dbacp06864 | AMP-WF3 | FLKSLWRGVKAIFNGARQGYKEHKN | Poecilia Mexicana fish | Apoptosis inducing | MTT assay | Jurkat | Blood Cancer | IC50 = 50 µM |
| dbacp06868 | LfcinB(21-25)Pal | RWQWRWQWR | LfcinB | Apoptosis inducing | MTT assay | MDA-MB-468 | Breast Cancer | IC50 = 72 µM |
| dbacp06869 | LfcinB(21-25)Pal | RWQWRWQWR | LfcinB | Apoptosis inducing | MTT assay | MDA-MB-231 | Breast Cancer | IC50 = 103 µM |
| dbacp06870 | LfcinB(21-25)Pal | RWQWRWQWR | LfcinB | Apoptosis inducing | MTT assay | MCF-7 | Breast Cancer | IC50 = 81 µM |
| dbacp06871 | RR-1-RR | RRWQWRWQWRR | Synthetic analogue of LfcinB(21-25)Pal | Apoptosis inducing | MTT assay | MCF-7 | Breast Cancer | IC50 = 58 µM |
| dbacp06872 | RR-1-RR | RRWQWRWQWRR | Synthetic analogue of LfcinB(21-25)Pal | Apoptosis inducing | MTT assay | MDA-MB-231 | Breast Cancer | IC50 = 67 µM |
| dbacp06873 | R-1-RR | RWQWRWQWRR | Synthetic analogue of LfcinB(21-25)Pal | Apoptosis inducing | MTT assay | MCF-7 | Breast Cancer | IC50 = 122 µM |
| dbacp06874 | R-1-RR | RWQWRWQWRR | Synthetic analogue of LfcinB(21-25)Pal | Apoptosis inducing | MTT assay | MDA-MB-231 | Breast Cancer | IC50 = 95 µM |
| dbacp06875 | RR-1-R | RRWQWRWQWR | Synthetic analogue of LfcinB(21-25)Pal | Apoptosis inducing | MTT assay | MCF-7 | Breast Cancer | IC50 = 68 µM |
| dbacp06876 | RR-1-R | RRWQWRWQWR | Synthetic analogue of LfcinB(21-25)Pal | Apoptosis inducing | MTT assay | MDA-MB-231 | Breast Cancer | IC50 = 73 µM |
| dbacp06877 | 1 | WQWRWQW | Synthetic analogue of LfcinB(21-25)Pal | Apoptosis inducing | MTT assay | MCF-7 | Breast Cancer | IC50 = 105 µM |
| dbacp06878 | 1 | WQWRWQW | Synthetic analogue of LfcinB(21-25)Pal | Apoptosis inducing | MTT assay | MDA-MB-231 | Breast Cancer | IC50 > 170 µM |
| dbacp06879 | R-1 | RWQWRWQW | Synthetic analogue of LfcinB(21-25)Pal | Apoptosis inducing | MTT assay | MCF-7 | Breast Cancer | IC50 = 58 µM |
| dbacp06880 | R-1 | RWQWRWQW | Synthetic analogue of LfcinB(21-25)Pal | Apoptosis inducing | MTT assay | MDA-MB-231 | Breast Cancer | IC50 > 150 µM |
| dbacp06881 | 1-R | WQWRWQWR | Synthetic analogue of LfcinB(21-25)Pal | Apoptosis inducing | MTT assay | MCF-7 | Breast Cancer | IC50 = 130 µM |
| dbacp06882 | 1-R | WQWRWQWR | Synthetic analogue of LfcinB(21-25)Pal | Apoptosis inducing | MTT assay | MDA-MB-231 | Breast Cancer | IC50 > 150 µM |
| dbacp06904 | LFcin17–30 | FKCRRWQWRMKKLG | Lectoferrin Peptide | Apoptosis inducing | MTT assay | HepG-2 | Liver Cancer | cell viability ~ 50% at 1 µM |
| dbacp06905 | LFcin17–30 | FKCRRWQWRMKKLG | Lectoferrin Peptide | Apoptosis inducing | MTT assay | Jurkat | Blood Cancer | cell viability ~ 70% at 20 µM |
| dbacp06906 | LFampin265–284 | DLIWKLLSKAQEKFGKNKSR | Lectoferrin Peptide | Apoptosis inducing | MTT assay | HepG-2 | Liver Cancer | cell viability ~ 50% at 1 µM |
| dbacp06907 | LFampin265–284 | DLIWKLLSKAQEKFGKNKSR | Lectoferrin Peptide | Apoptosis inducing | MTT assay | Jurkat | Blood Cancer | cell viability ~ 47% at 10 µM |
| dbacp06908 | LFchimera | FKCRRWQWRMKKLG-K-RSKNKGFKEQAKSLLKWILD | Synthetic - Lectoferrin chimera | Apoptosis inducing | MTT assay | HepG-2 | Liver Cancer | cell viability ~ 44% at 10 µM |
| dbacp06909 | LFchimera | FKCRRWQWRMKKLG-K-RSKNKGFKEQAKSLLKWILD | Synthetic - Lectoferrin chimera | Apoptosis inducing | MTT assay | Jurkat | Blood Cancer | cell viability ~ 8% at 20 µM |
| dbacp06919 | Q7 | EQQQQQQPQNRRFRE | Pisum sativum | Inhibition of cell signalling | MTT assay | HEC-1-A | Endometrial Cancer | IC50 = 129.82 ± 7.53 μM |
| dbacp06920 | HAZ | GVKFAKRFWRFAKKAFKRFEK | Synthetic | Cell membrane destabilization | MTT assay | A-549 | Lung Cancer | IC50 = 5.44 μM |
| dbacp06941 | PS14 | PTECQVGTTCKVES | Aphanomyces invadans | Apoptosis inducing | MTT assay | Hep-2 | Larynx Cancer | IC50 = 21 µM |
| dbacp06945 | LJP-6 | FKEHGY | Laminaria japonica | Inhibition of cell signalling | MTT assay | HepG-2 | Liver Cancer | IC50 = 3.06 ± 0.31 mM |
| dbacp06946 | LJP-1 | EGFHL | Laminaria japonica | Inhibition of cell signalling | MTT assay | Huh-7 | Liver Cancer | IC50 = 0.48 ± 0.05 mM |
| dbacp06947 | LJP-1 | EGFHL | Laminaria japonica | Inhibition of cell signalling | MTT assay | HepG-2 | Liver Cancer | IC50 = 0.45 ± 0.05 mM |
| dbacp06948 | LJP-1 | EGFHL | Laminaria japonica | Inhibition of cell signalling | MTT assay | H-22 | Liver Cancer | IC50 = 0.36 ± 0.03 mM |
| dbacp06949 | LJP-8 | FSHTYV | Laminaria japonica | Inhibition of cell signalling | MTT assay | Huh-7 | Liver Cancer | IC50 = 0.44 ± 0.04 mM |
| dbacp06950 | LJP-8 | FSHTYV | Laminaria japonica | Inhibition of cell signalling | MTT assay | HepG-2 | Liver Cancer | IC50 = 0.63 ± 0.05 mM |
| dbacp06951 | LJP-8 | FSHTYV | Laminaria japonica | Inhibition of cell signalling | MTT assay | H-22 | Liver Cancer | IC50 = 0.76 ± 0.08 mM |
| dbacp06952 | LJP-2 | LWEHSH | Laminaria japonica | Inhibition of cell signalling | MTT assay | Huh-7 | Liver Cancer | IC50 = 2.25 ± 0.22 mM |
| dbacp06953 | LJP-2 | LWEHSH | Laminaria japonica | Inhibition of cell signalling | MTT assay | HepG-2 | Liver Cancer | IC50 = 1.71 ± 0.13 mM |
| dbacp06954 | LJP-2 | LWEHSH | Laminaria japonica | Inhibition of cell signalling | MTT assay | H-22 | Liver Cancer | IC50 = 0.62 ± 0.05 mM |
| dbacp06955 | LJP-3 | FSHRGH | Laminaria japonica | Inhibition of cell signalling | MTT assay | Huh-7 | Liver Cancer | IC50 = 1.42 ± 0.12 mM |
| dbacp06956 | LJP-3 | FSHRGH | Laminaria japonica | Inhibition of cell signalling | MTT assay | H-22 | Liver Cancer | IC50 = 1.70 ± 0.15 mM |
| dbacp06957 | LJP-5 | FSTHGG | Laminaria japonica | Inhibition of cell signalling | MTT assay | Huh-7 | Liver Cancer | IC50 = 2.44 ± 0.22 mM |
| dbacp06958 | LJP-5 | FSTHGG | Laminaria japonica | Inhibition of cell signalling | MTT assay | HepG-2 | Liver Cancer | IC50 = 2.78 ± 0.26 mM |
| dbacp06959 | LJP-5 | FSTHGG | Laminaria japonica | Inhibition of cell signalling | MTT assay | H-22 | Liver Cancer | IC50 = 1.49 ± 0.13 mM |
| dbacp06960 | LJP-7 | HAGYSWA | Laminaria japonica | Inhibition of cell signalling | MTT assay | Huh-7 | Liver Cancer | IC50 = 2.53 ± 0.24 mM |
| dbacp06961 | LJP-7 | HAGYSWA | Laminaria japonica | Inhibition of cell signalling | MTT assay | HepG-2 | Liver Cancer | IC50 = 1.66 ± 0.11 mM |
| dbacp06962 | LJP-7 | HAGYSWA | Laminaria japonica | Inhibition of cell signalling | MTT assay | H-22 | Liver Cancer | IC50 = 1.44 ± 0.12 mM |
| dbacp06963 | LJP-9 | FEHSG | Laminaria japonica | Inhibition of cell signalling | MTT assay | Huh-7 | Liver Cancer | IC50 = 0.53 ± 0.05 mM |
| dbacp06964 | LJP-9 | FEHSG | Laminaria japonica | Inhibition of cell signalling | MTT assay | HepG-2 | Liver Cancer | IC50 = 0.69 ± 0.08 mM |
| dbacp06965 | LJP-9 | FEHSG | Laminaria japonica | Inhibition of cell signalling | MTT assay | H-22 | Liver Cancer | IC50 = 0.51 ± 0.07 mM |
| dbacp06966 | LJP-10 | HASWEH | Laminaria japonica | Inhibition of cell signalling | MTT assay | Huh-7 | Liver Cancer | IC50 = 3.52 ± 0.35 mM |
| dbacp06967 | LJP-10 | HASWEH | Laminaria japonica | Inhibition of cell signalling | MTT assay | HepG-2 | Liver Cancer | IC50 = 2.69 ± 0.22 mM |
| dbacp06968 | LJP-10 | HASWEH | Laminaria japonica | Inhibition of cell signalling | MTT assay | H-22 | Liver Cancer | IC50 = 3.53 ± 0.34 mM |
| dbacp06969 | LJP-11 | YEHSHG | Laminaria japonica | Inhibition of cell signalling | MTT assay | Huh-7 | Liver Cancer | IC50 = 0.49 ± 0.05 mM |
| dbacp06970 | LJP-11 | YEHSHG | Laminaria japonica | Inhibition of cell signalling | MTT assay | HepG-2 | Liver Cancer | IC50 = 0.61 ± 0.07 mM |
| dbacp06971 | LJP-11 | YEHSHG | Laminaria japonica | Inhibition of cell signalling | MTT assay | H-22 | Liver Cancer | IC50 = 0.70 ± 0.07 mM |
| dbacp06972 | LJP-12 | TFKHG | Laminaria japonica | Inhibition of cell signalling | MTT assay | Huh-7 | Liver Cancer | IC50 = 0.41 ± 0.04 mM |
| dbacp06973 | LJP-12 | TFKHG | Laminaria japonica | Inhibition of cell signalling | MTT assay | HepG-2 | Liver Cancer | IC50 = 0.60 ± 0.08 mM |
| dbacp06974 | LJP-12 | TFKHG | Laminaria japonica | Inhibition of cell signalling | MTT assay | H-22 | Liver Cancer | IC50 = 0.72 ± 0.05 mM |
| dbacp06980 | Ponericin-W1 (11-25), At1 | KLLPSVVGLFKKKKQ | Synthetic | Apoptosis inducing | MTT assay | A-549 | Lung Cancer | IC50 > 100 µM |
| dbacp06981 | Ponericin-W1 (11-25), At1 | KLLPSVVGLFKKKKQ | Synthetic | Apoptosis inducing | MTT assay | HepG-2 | Liver Cancer | IC50 >100 µM |
| dbacp06982 | Ponericin-W1 (11-25) [P4K | KLLKKVVKLFKKKKK | Synthetic | Apoptosis inducing | MTT assay | A-549 | Lung Cancer | IC50 >100 µM |
| dbacp06983 | Ponericin-W1 (11-25) [P4K | KLLKKVVKLFKKKKK | Synthetic | Apoptosis inducing | MTT assay | HepG-2 | Liver Cancer | IC50 >100 µM |
| dbacp06984 | Ponericin-W1 (11-25) [P4K | KLLKKVVKLFKKLLK | Synthetic | Apoptosis inducing | MTT assay | A-549 | Lung Cancer | IC50 = 4.3 µM |
| dbacp06985 | Ponericin-W1 (11-25) [P4K | KLLKKVVKLFKKLLK | Synthetic | Apoptosis inducing | MTT assay | HepG-2 | Liver Cancer | IC50 = 2.2 µM |
| dbacp06986 | At4 | KLLKKLLKLLKKLLK | Synthetic | Apoptosis inducing | MTT assay | A-549 | Lung Cancer | IC50 = 7.2 µM |
| dbacp06987 | At4 | KLLKKLLKLLKKLLK | Synthetic | Apoptosis inducing | MTT assay | HepG-2 | Liver Cancer | IC50 = 2.5 µM |
| dbacp06988 | At5 | KIIKKIIKIIKKIIK | Synthetic | Apoptosis inducing | MTT assay | A-549 | Lung Cancer | IC50 = 3.6 µM |
| dbacp06989 | At5 | KIIKKIIKIIKKIIK | Synthetic | Apoptosis inducing | MTT assay | HepG-2 | Liver Cancer | IC50 = 1.5 µM |
| dbacp06990 | At6 | KVVKKVVKVVKKVVK | Synthetic | Apoptosis inducing | MTT assay | A-549 | Lung Cancer | IC50 > 100 µM |
| dbacp06991 | At6 | KVVKKVVKVVKKVVK | Synthetic | Apoptosis inducing | MTT assay | HepG-2 | Liver Cancer | IC50 = 70.8 µM |
| dbacp06992 | At7 | KIIKKIKKKIKKIIK | Synthetic | Apoptosis inducing | MTT assay | A-549 | Lung Cancer | IC50 = 10.3 µM |
| dbacp06993 | At7 | KIIKKIKKKIKKIIK | Synthetic | Apoptosis inducing | MTT assay | HepG-2 | Liver Cancer | IC50 = 8.8 µM |
| dbacp06994 | At8 | KLLKKLKKKLKKLLK | Synthetic | Apoptosis inducing | MTT assay | A-549 | Lung Cancer | IC50 = 13.4 µM |
| dbacp06995 | At8 | KLLKKLKKKLKKLLK | Synthetic | Apoptosis inducing | MTT assay | HepG-2 | Liver Cancer | IC50 = 8.9 µM |
| dbacp06996 | At9 | KVVKKVKKKVKKVVK | Synthetic | Apoptosis inducing | MTT assay | A-549 | Lung Cancer | IC50 = 100 µM |
| dbacp06997 | At9 | KVVKKVKKKVKKVVK | Synthetic | Apoptosis inducing | MTT assay | HepG-2 | Liver Cancer | IC50 = 51.7 µM |
| dbacp06998 | At10 | IKKIIKIIKKIIKKI | Synthetic | Apoptosis inducing | MTT assay | A-549 | Lung Cancer | IC50 = 4.4 µM |
| dbacp06999 | At10 | IKKIIKIIKKIIKKI | Synthetic | Apoptosis inducing | MTT assay | HepG-2 | Liver Cancer | IC50 = 3.2 µM |
| dbacp07000 | At11 | IIIKKIKKKIKKIII | Synthetic | Apoptosis inducing | MTT assay | A-549 | Lung Cancer | IC50 = 7.9 µM |
| dbacp07001 | At11 | IIIKKIKKKIKKIII | Synthetic | Apoptosis inducing | MTT assay | HepG-2 | Liver Cancer | IC50 = 7.6 µM |
| dbacp07002 | At12 | KIIIKIKKKIKIIIK | Synthetic | Apoptosis inducing | MTT assay | A-549 | Lung Cancer | IC50 = 14.0 µM |
| dbacp07003 | At12 | KIIIKIKKKIKIIIK | Synthetic | Apoptosis inducing | MTT assay | HepG-2 | Liver Cancer | IC50 = 13.4 µM |
| dbacp07004 | Rapeseed peptide | NDGNQPL | extracted from rapeseed protein | Inhibition of cell signalling | MTT assay | HepG-2 | Liver Cancer | IC50 = 1.56 mmol/L |
| dbacp07017 | D-LAK-120-A | kklalalakkwlalakklalalakk | Synthetic | ROS induction, mitochondria-mediated apoptosis. | MTT assay | A-549 | Lung Cancer | IC50 = 5.55 ± 0.13 μM |
| dbacp07018 | D-LAK-120-A | kklalalakkwlalakklalalakk | Synthetic | ROS induction, mitochondria-mediated apoptosis. | MTT assay | H-358 | Non Small Cell Lung Cancer (NSCLC) | IC50 = 4.00 ± 0.20 μM |
| dbacp07019 | D-LAK-120-A | kklalalakkwlalakklalalakk | Synthetic | ROS induction, mitochondria-mediated apoptosis. | MTT assay | H-1975 | Non Small Cell Lung Cancer (NSCLC) | IC50 between 4.0 and 5.5 μM |
| dbacp07020 | D-LAK-120-A | kklalalakkwlalakklalalakk | Synthetic | ROS induction, mitochondria-mediated apoptosis. | MTT assay | HCC-827 | Lung Adenocarcinoma | IC50 between 4.0 and 5.5 μM |
| dbacp07021 | BmPLA2 | FKWQFEMLIMKIAKTSGFMFYSSY | phospholipase A2 isoform from B. moojeni venom | Membrane disruption, selective cancer cytotoxicity | MTT assay | CaCo-2 | Colorectal Cancer | IC50 = 0.6 µM |
| dbacp07022 | BmPLA2 | FKWQFEMLIMKIAKTSGFMFYSSY | phospholipase A2 isoform from B. moojeni venom | Membrane disruption, selective cancer cytotoxicity | MTT assay | RD | Rhabdomyosarcoma | 60% reduction in cell viability |
| dbacp07050 | Temporin-PKE | FLPLIIGALSSLLPKIF | skin secretion of Pelophylax kl. esculentus | Charge-optimized membranolysis induces apoptosis. | MTT assay | U251-MG | Brain Tumor | IC50 = 23.24 μM |
| dbacp07051 | Temporin-PKE | FLPLIIGALSSLLPKIF | skin secretion of Pelophylax kl. esculentus | Charge-optimized membranolysis induces apoptosis. | MTT assay | PC-3 | Prostate Cancer | IC50 = 7.29 μM |
| dbacp07052 | Temporin-PKE | FLPLIIGALSSLLPKIF | skin secretion of Pelophylax kl. esculentus | Charge-optimized membranolysis induces apoptosis. | MTT assay | H-838 | Lung Cancer | IC50 = 16.38 μM |
| dbacp07053 | Temporin-PKE | FLPLIIGALSSLLPKIF | skin secretion of Pelophylax kl. esculentus | Charge-optimized membranolysis induces apoptosis. | MTT assay | HCT-116 | Colorectal Cancer | IC50 = 21.31 μM |
| dbacp07054 | Temporin-PKE | FLPLIIGALSSLLPKIF | skin secretion of Pelophylax kl. esculentus | Charge-optimized membranolysis induces apoptosis. | MTT assay | H-157 | Lung Cancer | IC50 = 17.40 μM |
| dbacp07055 | Temporin-PKE-2K | FLPLIIGKLSSLLPKIF | Synthetic | Charge-optimized membranolysis induces apoptosis. | MTT assay | U251-MG | Brain Tumor | IC50 = 2.49 μM |
| dbacp07056 | Temporin-PKE-2K | FLPLIIGKLSSLLPKIF | Synthetic | Charge-optimized membranolysis induces apoptosis. | MTT assay | PC-3 | Prostate Cancer | IC50 = 2.64 μM |
| dbacp07057 | Temporin-PKE-2K | FLPLIIGKLSSLLPKIF | Synthetic | Charge-optimized membranolysis induces apoptosis. | MTT assay | H-838 | Lung Cancer | IC50 = 3.07 μM |
| dbacp07058 | Temporin-PKE-2K | FLPLIIGKLSSLLPKIF | Synthetic | Charge-optimized membranolysis induces apoptosis. | MTT assay | HCT-116 | Colorectal Cancer | IC50 = 2.84 μM |
| dbacp07059 | Temporin-PKE-2K | FLPLIIGKLSSLLPKIF | Synthetic | Charge-optimized membranolysis induces apoptosis. | MTT assay | H-157 | Lung Cancer | IC50 = 2.78 μM |
| dbacp07060 | Temporin-PKE-K12 | FLPLIIGALSSKLPKIF | Synthetic | Charge-optimized membranolysis induces apoptosis. | MTT assay | U251-MG | Brain Tumor | IC50 = 25.75 μM |
| dbacp07061 | Temporin-PKE-K12 | FLPLIIGALSSKLPKIF | Synthetic | Charge-optimized membranolysis induces apoptosis. | MTT assay | PC-3 | Prostate Cancer | IC50 = 27.32 μM |
| dbacp07062 | Temporin-PKE-K12 | FLPLIIGALSSKLPKIF | Synthetic | Charge-optimized membranolysis induces apoptosis. | MTT assay | H-838 | Lung Cancer | IC50 = 22.67 μM |
| dbacp07063 | Temporin-PKE-K12 | FLPLIIGALSSKLPKIF | Synthetic | Charge-optimized membranolysis induces apoptosis. | MTT assay | HCT-116 | Colorectal Cancer | IC50 = 22.09 μM |
| dbacp07064 | Temporin-PKE-K12 | FLPLIIGALSSKLPKIF | Synthetic | Charge-optimized membranolysis induces apoptosis. | MTT assay | H-157 | Lung Cancer | IC50 = 24.03 μM |
| dbacp07065 | Temporin-PKE-3K | FLPKIIGKLSSLLPKIF | Synthetic | Charge-optimized membranolysis induces apoptosis. | MTT assay | U251-MG | Brain Tumor | IC50 = 2.83 μM |
| dbacp07066 | Temporin-PKE-3K | FLPKIIGKLSSLLPKIF | Synthetic | Charge-optimized membranolysis induces apoptosis. | MTT assay | PC-3 | Prostate Cancer | IC50 = 3.01 μM |
| dbacp07067 | Temporin-PKE-3K | FLPKIIGKLSSLLPKIF | Synthetic | Charge-optimized membranolysis induces apoptosis. | MTT assay | H-838 | Lung Cancer | IC50 = 0.51 μM |
| dbacp07068 | Temporin-PKE-3K | FLPKIIGKLSSLLPKIF | Synthetic | Charge-optimized membranolysis induces apoptosis. | MTT assay | HCT-116 | Colorectal Cancer | IC50 = 0.38 μM |
| dbacp07069 | Temporin-PKE-3K | FLPKIIGKLSSLLPKIF | Synthetic | Charge-optimized membranolysis induces apoptosis. | MTT assay | H-157 | Lung Cancer | IC50 = 3.29 μM |
| dbacp07070 | Temporin-PKE-4K | FLPKIIGKLSSKLPKIF | Synthetic | Charge-optimized membranolysis induces apoptosis. | MTT assay | U251-MG | Brain Tumor | IC50 = 85.52 μM |
| dbacp07071 | Temporin-PKE-4K | FLPKIIGKLSSKLPKIF | Synthetic | Charge-optimized membranolysis induces apoptosis. | MTT assay | PC-3 | Prostate Cancer | IC50 = 49.50 μM |
| dbacp07072 | Temporin-PKE-4K | FLPKIIGKLSSKLPKIF | Synthetic | Charge-optimized membranolysis induces apoptosis. | MTT assay | H-838 | Lung Cancer | IC50 = 35.28 μM |
| dbacp07073 | Temporin-PKE-4K | FLPKIIGKLSSKLPKIF | Synthetic | Charge-optimized membranolysis induces apoptosis. | MTT assay | HCT-116 | Colorectal Cancer | IC50 = 99.36 μM |
| dbacp07074 | Temporin-PKE-4K | FLPKIIGKLSSKLPKIF | Synthetic | Charge-optimized membranolysis induces apoptosis. | MTT assay | H-157 | Lung Cancer | IC50 = 27.76 μM |
| dbacp07075 | Temporin-PKE-i | FLPLIIGALSSLLPKiF | Synthetic | Charge-optimized membranolysis induces apoptosis. | MTT assay | U251-MG | Brain Tumor | IC50 = 4.46 μM |
| dbacp07076 | Temporin-PKE-i | FLPLIIGALSSLLPKiF | Synthetic | Charge-optimized membranolysis induces apoptosis. | MTT assay | PC-3 | Prostate Cancer | IC50 = 3.35 μM |
| dbacp07077 | Temporin-PKE-i | FLPLIIGALSSLLPKiF | Synthetic | Charge-optimized membranolysis induces apoptosis. | MTT assay | H-838 | Lung Cancer | IC50 = 5.28 μM |
| dbacp07078 | Temporin-PKE-i | FLPLIIGALSSLLPKiF | Synthetic | Charge-optimized membranolysis induces apoptosis. | MTT assay | HCT-116 | Colorectal Cancer | IC50 = 3.07 μM |
| dbacp07079 | Temporin-PKE-i | FLPLIIGALSSLLPKiF | Synthetic | Charge-optimized membranolysis induces apoptosis. | MTT assay | H-157 | Lung Cancer | IC50 = 2.94 μM |
| dbacp07080 | Temporin-PKE-3i | FLPLiiGALSSLLPKiF | Synthetic | Charge-optimized membranolysis induces apoptosis. | MTT assay | U251-MG | Brain Tumor | IC50 = 120.6 μM |
| dbacp07081 | Temporin-PKE-3i | FLPLiiGALSSLLPKiF | Synthetic | Charge-optimized membranolysis induces apoptosis. | MTT assay | PC-3 | Prostate Cancer | IC50 = 167 μM |
| dbacp07082 | Temporin-PKE-3i | FLPLiiGALSSLLPKiF | Synthetic | Charge-optimized membranolysis induces apoptosis. | MTT assay | H-838 | Lung Cancer | IC50 = 193.4 μM |
| dbacp07083 | Temporin-PKE-3i | FLPLiiGALSSLLPKiF | Synthetic | Charge-optimized membranolysis induces apoptosis. | MTT assay | HCT-116 | Colorectal Cancer | IC50 = 72.06 μM |
| dbacp07084 | Temporin-PKE-3i | FLPLiiGALSSLLPKiF | Synthetic | Charge-optimized membranolysis induces apoptosis. | MTT assay | H-157 | Lung Cancer | IC50 = 71.18 μM |
| dbacp07107 | Nigrocin-M1 | GLLGKILGAGKKVLLGVSGLL | Synthetic | Membrane disruption mediates selective cytotoxicity. | MTT assay | H-157 | Non-small cell lung cancer | IC50 = 24 μM |
| dbacp07108 | Nigrocin-M1 | GLLGKILGAGKKVLLGVSGLL | Synthetic | Membrane disruption mediates selective cytotoxicity. | MTT assay | PC-3 | Prostate cancer | IC50 = 31.27 μM |
| dbacp07109 | Nigrocin-M1 | GLLGKILGAGKKVLLGVSGLL | Synthetic | Membrane disruption mediates selective cytotoxicity. | MTT assay | U-251-MG | Brain Tumor | IC50 = 25.06 μM |
| dbacp07110 | Nigrocin-M1 | GLLGKILGAGKKVLLGVSGLL | Synthetic | Membrane disruption mediates selective cytotoxicity. | MTT assay | MCF-7 | Breast Cancer | IC50 = 24.60 μM |
| dbacp07111 | LyeTx-I-b | IWLTALKFLGKNLGKLAKQQLAKL | Synthetic | Synergistic autophagic death via AKT inhibition. | MTT assay | MDA-MB-231 | Breast Cancer | IC50 = 2.47 µM |
| dbacp07112 | Galaxamide | (N-Me-L)L(N-Me-L)LL | Galaxaura filamentosa | Cell-cycle arrest induces apoptosis | MTT assay | HepG-2 | Liver Cancer | IC50 = 5.20 ± 0.52 µg/ml |
| dbacp07113 | Galaxamide | (N-Me-L)L(N-Me-L)LL | Galaxaura filamentosa | Cell-cycle arrest induces apoptosis | MTT assay | MCF-7 | Breast Cancer | IC50 = 11.33 ± 2.95 µg/ml |
| dbacp07114 | Galaxamide | (N-Me-L)L(N-Me-L)LL | Galaxaura filamentosa | Cell-cycle arrest induces apoptosis | MTT assay | HeLa | Cervical Cancer | IC50 = 8.53 ± 0.73 µg/ml |
| dbacp07115 | Galaxamide | (N-Me-L)L(N-Me-L)LL | Galaxaura filamentosa | Cell-cycle arrest induces apoptosis | MTT assay | MDA-MB-231 | Breast Cancer | IC50 = 8.73 ± 0.29 µg/ml |
| dbacp07116 | Galaxamide | (N-Me-L)L(N-Me-L)LL | Galaxaura filamentosa | Cell-cycle arrest induces apoptosis | MTT assay | A-549 | Lung Cancer | IC50 = 6.99 ± 0.63 µg/ml |
| dbacp07117 | Z-1 | L(N-Me-L)LPL | Synthetic | Cell-cycle arrest induces apoptosis | MTT assay | MCF-7 | Breast Cancer | IC50 = 5.85 ± 1.28 µg/ml |
| dbacp07118 | Z-1 | L(N-Me-L)LPL | Synthetic | Cell-cycle arrest induces apoptosis | MTT assay | HepG-2 | Liver Cancer | IC50 = 7.57 ± 0.17 µg/ml |
| dbacp07119 | Z-1 | L(N-Me-L)LPL | Synthetic | Cell-cycle arrest induces apoptosis | MTT assay | MDA-MB-231 | Breast Cancer | IC50 = 17.81 ± 0.6 µg/ml |
| dbacp07120 | Z-1 | L(N-Me-L)LPL | Synthetic | Cell-cycle arrest induces apoptosis | MTT assay | HeLa | Cervical Cancer | IC50 = 11.56 ± 0.65 µg/ml |
| dbacp07121 | Z-1 | L(N-Me-L)LPL | Synthetic | Cell-cycle arrest induces apoptosis | MTT assay | A-549 | Lung Cancer | IC50 = 4.92 ± 0.84 µg/ml |
| dbacp07122 | DEE | GLLDLLELLLEAAGW | Synthetic | Selective membrane perforation prevents resistance. | MTT assay | HMLER | Breast Cancer | IC50 = 5.55 ± 0.35 µM |
| dbacp07123 | DEE | GLLDLLELLLEAAGW | Synthetic | Selective membrane perforation prevents resistance. | MTT assay | HMLER-shEcad | Breast Cancer | IC50 = 6.05 ± 2.76 µM |
| dbacp07124 | DEE | GLLDLLELLLEAAGW | Synthetic | Selective membrane perforation prevents resistance. | MTT assay | U-2 OS | Bone Cancer | IC50 = 61.00 ± 1.41 µM |
| dbacp07125 | EEE | GLLELLELLLEAAGW | Synthetic | Selective membrane perforation prevents resistance. | MTT assay | HMLER | Breast Cancer | IC50 = 6.25 ± 1.77 µM |
| dbacp07126 | EEE | GLLELLELLLEAAGW | Synthetic | Selective membrane perforation prevents resistance. | MTT assay | HMLER-shEcad | Breast Cancer | IC50 = 10.55 ± 3.46 µM |
| dbacp07127 | EEE | GLLELLELLLEAAGW | Synthetic | Selective membrane perforation prevents resistance. | MTT assay | U-2 OS | Bone Cancer | IC50 = 78.75 ± 5.30 µM |
| dbacp07128 | HEE | GLLHLLELLLEAAGW | Synthetic | Selective membrane perforation prevents resistance. | MTT assay | HMLER | Breast Cancer | IC50 = 6.50 ± 0.71 µM |
| dbacp07129 | HEE | GLLHLLELLLEAAGW | Synthetic | Selective membrane perforation prevents resistance. | MTT assay | HMLER-shEcad | Breast Cancer | IC50 = 4.95 ± 0.49 µM |
| dbacp07130 | HEE | GLLHLLELLLEAAGW | Synthetic | Selective membrane perforation prevents resistance. | MTT assay | U-2 OS | Bone Cancer | IC50 = 47.50 ± 11 µM |
| dbacp07131 | KEE | GLLKLLELLLEAAGW | Synthetic | Selective membrane perforation prevents resistance. | MTT assay | HMLER | Breast Cancer | IC50 = 3.75 ± 0.78 µM |
| dbacp07132 | KEE | GLLKLLELLLEAAGW | Synthetic | Selective membrane perforation prevents resistance. | MTT assay | HMLER-shEcad | Breast Cancer | IC50 = 2.05 ± 0.21 µM |
| dbacp07133 | KEE | GLLKLLELLLEAAGW | Synthetic | Selective membrane perforation prevents resistance. | MTT assay | U-2 OS | Bone Cancer | IC50 = 49.38 ± 13.26 µM |
| dbacp07134 | DHE | GLLDLLHLLLEAAGW | Synthetic | Selective membrane perforation prevents resistance. | MTT assay | HMLER | Breast Cancer | IC50 = 3.75 ± 0.92 µM |
| dbacp07135 | DHE | GLLDLLHLLLEAAGW | Synthetic | Selective membrane perforation prevents resistance. | MTT assay | HMLER-shEcad | Breast Cancer | IC50 = 2.80 ± 0.14 µM |
| dbacp07136 | DHE | GLLDLLHLLLEAAGW | Synthetic | Selective membrane perforation prevents resistance. | MTT assay | U-2 OS | Bone Cancer | IC50 = 17.25 ± 1.06 µM |
| dbacp07137 | EHE | GLLELLHLLLEAAGW | Synthetic | Selective membrane perforation prevents resistance. | MTT assay | HMLER | Breast Cancer | IC50 = 3.90 ± 0.28 µM |
| dbacp07138 | EHE | GLLELLHLLLEAAGW | Synthetic | Selective membrane perforation prevents resistance. | MTT assay | HMLER-shEcad | Breast Cancer | IC50 = 2.55 ± 0.07 µM |
| dbacp07139 | EHE | GLLELLHLLLEAAGW | Synthetic | Selective membrane perforation prevents resistance. | MTT assay | U-2 OS | Bone Cancer | IC50 = 18.25 ± 1.06 µM |
| dbacp07140 | HHE | GLLHLLHLLLEAAGW | Synthetic | Selective membrane perforation prevents resistance. | MTT assay | HMLER | Breast Cancer | IC50 = 16.70 ± 2.26 µM |
| dbacp07141 | HHE | GLLHLLHLLLEAAGW | Synthetic | Selective membrane perforation prevents resistance. | MTT assay | HMLER-shEcad | Breast Cancer | IC50 = 10.75 ± 0.78 µM |
| dbacp07142 | HHE | GLLHLLHLLLEAAGW | Synthetic | Selective membrane perforation prevents resistance. | MTT assay | U-2 OS | Bone Cancer | IC50 = 53.25 ± 5.30 µM |
| dbacp07143 | KHE | GLLKLLHLLLEAAGW | Synthetic | Selective membrane perforation prevents resistance. | MTT assay | HMLER | Breast Cancer | IC50 = 3.70 ± 0.14 µM |
| dbacp07144 | KHE | GLLKLLHLLLEAAGW | Synthetic | Selective membrane perforation prevents resistance. | MTT assay | HMLER-shEcad | Breast Cancer | IC50 = 2.92 ± 0.17 µM |
| dbacp07145 | KHE | GLLKLLHLLLEAAGW | Synthetic | Selective membrane perforation prevents resistance. | MTT assay | U-2 OS | Bone Cancer | IC50 = 53 ± 2.83 µM |
| dbacp07146 | DKE | GLLDLLKLLLEAAGW | Synthetic | Selective membrane perforation prevents resistance. | MTT assay | HMLER | Breast Cancer | IC50 = 2.10 ± 0 µM |
| dbacp07147 | DKE | GLLDLLKLLLEAAGW | Synthetic | Selective membrane perforation prevents resistance. | MTT assay | HMLER-shEcad | Breast Cancer | IC50 = 1.57 ± 0.33 µM |
| dbacp07148 | DKE | GLLDLLKLLLEAAGW | Synthetic | Selective membrane perforation prevents resistance. | MTT assay | U-2 OS | Bone Cancer | IC50 = 9.93 ± 0.25 µM |
| dbacp07149 | EKE | GLLELLKLLLEAAGW | Synthetic | Selective membrane perforation prevents resistance. | MTT assay | HMLER | Breast Cancer | IC50 = 1.80 ± 0.28 µM |
| dbacp07150 | EKE | GLLELLKLLLEAAGW | Synthetic | Selective membrane perforation prevents resistance. | MTT assay | HMLER-shEcad | Breast Cancer | IC50 = 1.30 ± 0.14 µM |
| dbacp07151 | EKE | GLLELLKLLLEAAGW | Synthetic | Selective membrane perforation prevents resistance. | MTT assay | U-2 OS | Bone Cancer | IC50 = 8.00 ± 0.71 µM |
| dbacp07152 | HKE | GLLHLLKLLLEAAGW | Synthetic | Selective membrane perforation prevents resistance. | MTT assay | HMLER | Breast Cancer | IC50 = 2.70 ± 0.28 µM |
| dbacp07153 | HKE | GLLHLLKLLLEAAGW | Synthetic | Selective membrane perforation prevents resistance. | MTT assay | HMLER-shEcad | Breast Cancer | IC50 = 1.90 ± 0.42 µM |
| dbacp07154 | HKE | GLLHLLKLLLEAAGW | Synthetic | Selective membrane perforation prevents resistance. | MTT assay | U-2 OS | Bone Cancer | IC50 = 15.95 ± 0.78 µM |
| dbacp07155 | KKE | GLLKLLKLLLEAAGW | Synthetic | Selective membrane perforation prevents resistance. | MTT assay | HMLER | Breast Cancer | IC50 = 2.05 ± 0.64 µM |
| dbacp07156 | KKE | GLLKLLKLLLEAAGW | Synthetic | Selective membrane perforation prevents resistance. | MTT assay | HMLER-shEcad | Breast Cancer | IC50 = 1.70 ± 0 µM |
| dbacp07157 | KKE | GLLKLLKLLLEAAGW | Synthetic | Selective membrane perforation prevents resistance. | MTT assay | U-2 OS | Bone Cancer | IC50 = 12.75 ± 1.20 µM |
| dbacp07158 | DEH | GLLDLLELLLHAAGW | Synthetic | Selective membrane perforation prevents resistance. | MTT assay | HMLER | Breast Cancer | IC50 = 5.35 ± 1.91 µM |
| dbacp07159 | DEH | GLLDLLELLLHAAGW | Synthetic | Selective membrane perforation prevents resistance. | MTT assay | HMLER-shEcad | Breast Cancer | IC50 = 3.60 ± 0.42 µM |
| dbacp07160 | DEH | GLLDLLELLLHAAGW | Synthetic | Selective membrane perforation prevents resistance. | MTT assay | U-2 OS | Bone Cancer | IC50 = 36.48 ± 3.92 µM |
| dbacp07161 | EEH | GLLELLELLLHAAGW | Synthetic | Selective membrane perforation prevents resistance. | MTT assay | HMLER | Breast Cancer | IC50 = 3.30 ± 0.14 µM |
| dbacp07162 | EEH | GLLELLELLLHAAGW | Synthetic | Selective membrane perforation prevents resistance. | MTT assay | HMLER-shEcad | Breast Cancer | IC50 = 3.60 ± 0.85 µM |
| dbacp07163 | EEH | GLLELLELLLHAAGW | Synthetic | Selective membrane perforation prevents resistance. | MTT assay | U-2 OS | Bone Cancer | IC50 = 19.60 ± 3.96 µM |
| dbacp07164 | HEH | GLLHLLELLLHAAGW | Synthetic | Selective membrane perforation prevents resistance. | MTT assay | HMLER | Breast Cancer | IC50 = 28.60 ± 10.75 µM |
| dbacp07165 | HEH | GLLHLLELLLHAAGW | Synthetic | Selective membrane perforation prevents resistance. | MTT assay | HMLER-shEcad | Breast Cancer | IC50 = 10.95 ± 1.06 µM |
| dbacp07166 | HEH | GLLHLLELLLHAAGW | Synthetic | Selective membrane perforation prevents resistance. | MTT assay | U-2 OS | Bone Cancer | IC50 = 106 ± 14 µM |
| dbacp07167 | KEH | GLLKLLELLLHAAGW | Synthetic | Selective membrane perforation prevents resistance. | MTT assay | HMLER | Breast Cancer | IC50 = 3.30 ± 0.42 µM |
| dbacp07168 | KEH | GLLKLLELLLHAAGW | Synthetic | Selective membrane perforation prevents resistance. | MTT assay | HMLER-shEcad | Breast Cancer | IC50 = 2.35 ± 0.07 µM |
| dbacp07169 | KEH | GLLKLLELLLHAAGW | Synthetic | Selective membrane perforation prevents resistance. | MTT assay | U-2 OS | Bone Cancer | IC50 = 49.25 ± 5.30 µM |
| dbacp07170 | DHH | GLLDLLHLLLHAAGW | Synthetic | Selective membrane perforation prevents resistance. | MTT assay | HMLER | Breast Cancer | IC50 = 21.45 ± 2.47 µM |
| dbacp07171 | DHH | GLLDLLHLLLHAAGW | Synthetic | Selective membrane perforation prevents resistance. | MTT assay | HMLER-shEcad | Breast Cancer | IC50 = 11.90 ± 0.14 µM |
| dbacp07172 | DHH | GLLDLLHLLLHAAGW | Synthetic | Selective membrane perforation prevents resistance. | MTT assay | U-2 OS | Bone Cancer | IC50 = 55.85 ± 18.88 µM |
| dbacp07173 | EHH | GLLELLHLLLHAAGW | Synthetic | Selective membrane perforation prevents resistance. | MTT assay | HMLER | Breast Cancer | IC50 = 25.35 ± 2.76 µM |
| dbacp07174 | EHH | GLLELLHLLLHAAGW | Synthetic | Selective membrane perforation prevents resistance. | MTT assay | HMLER-shEcad | Breast Cancer | IC50 = 16.05 ± 3.18 µM |
| dbacp07175 | EHH | GLLELLHLLLHAAGW | Synthetic | Selective membrane perforation prevents resistance. | MTT assay | U-2 OS | Bone Cancer | IC50 = 117 ± 7 µM |
| dbacp07176 | HHH | GLLHLLHLLLHAAGW | Synthetic | Selective membrane perforation prevents resistance. | MTT assay | HMLER | Breast Cancer | IC50 = 21.10 ± 6.93 µM |
| dbacp07177 | HHH | GLLHLLHLLLHAAGW | Synthetic | Selective membrane perforation prevents resistance. | MTT assay | HMLER-shEcad | Breast Cancer | IC50 = 9.50 ± 0.99 µM |
| dbacp07178 | HHH | GLLHLLHLLLHAAGW | Synthetic | Selective membrane perforation prevents resistance. | MTT assay | U-2 OS | Bone Cancer | IC50 = 185 ± 7 µM |
| dbacp07179 | KHH | GLLKLLHLLLHAAGW | Synthetic | Selective membrane perforation prevents resistance. | MTT assay | HMLER | Breast Cancer | IC50 = 5.20 ± 0.71 µM |
| dbacp07180 | KHH | GLLKLLHLLLHAAGW | Synthetic | Selective membrane perforation prevents resistance. | MTT assay | HMLER-shEcad | Breast Cancer | IC50 = 4.45 ± 0.49 µM |
| dbacp07181 | KHH | GLLKLLHLLLHAAGW | Synthetic | Selective membrane perforation prevents resistance. | MTT assay | U-2 OS | Bone Cancer | IC50 = 39.75 ± 5.30 µM |
| dbacp07182 | DKH | GLLDLLKLLLHAAGW | Synthetic | Selective membrane perforation prevents resistance. | MTT assay | HMLER | Breast Cancer | IC50 = 3.45 ± 0.07 µM |
| dbacp07183 | DKH | GLLDLLKLLLHAAGW | Synthetic | Selective membrane perforation prevents resistance. | MTT assay | HMLER-shEcad | Breast Cancer | IC50 = 2.80 ± 0.28 µM |
| dbacp07184 | DKH | GLLDLLKLLLHAAGW | Synthetic | Selective membrane perforation prevents resistance. | MTT assay | U-2 OS | Bone Cancer | IC50 = 21.13 ± 3.01 µM |
| dbacp07185 | EKH | GLLELLKLLLHAAGW | Synthetic | Selective membrane perforation prevents resistance. | MTT assay | HMLER | Breast Cancer | IC50 = 2.75 ± 0.07 µM |
| dbacp07186 | EKH | GLLELLKLLLHAAGW | Synthetic | Selective membrane perforation prevents resistance. | MTT assay | HMLER-shEcad | Breast Cancer | IC50 = 2.18 ± 0.31 µM |
| dbacp07187 | EKH | GLLELLKLLLHAAGW | Synthetic | Selective membrane perforation prevents resistance. | MTT assay | U-2 OS | Bone Cancer | IC50 = 23.83 ± 0.81 µM |
| dbacp07188 | HKH | GLLHLLKLLLHAAGW | Synthetic | Selective membrane perforation prevents resistance. | MTT assay | HMLER | Breast Cancer | IC50 = 3.45 ± 0.21 µM |
| dbacp07189 | HKH | GLLHLLKLLLHAAGW | Synthetic | Selective membrane perforation prevents resistance. | MTT assay | HMLER-shEcad | Breast Cancer | IC50 = 3.10 ± 0.57 µM |
| dbacp07190 | HKH | GLLHLLKLLLHAAGW | Synthetic | Selective membrane perforation prevents resistance. | MTT assay | U-2 OS | Bone Cancer | IC50 = 18.88 ± 1.24 µM |
| dbacp07191 | KKH | GLLKLLKLLLHAAGW | Synthetic | Selective membrane perforation prevents resistance. | MTT assay | HMLER | Breast Cancer | IC50 = 2.40 ± 0.85 µM |
| dbacp07192 | KKH | GLLKLLKLLLHAAGW | Synthetic | Selective membrane perforation prevents resistance. | MTT assay | HMLER-shEcad | Breast Cancer | IC50 = 2.20 ± 0.42 µM |
| dbacp07193 | KKH | GLLKLLKLLLHAAGW | Synthetic | Selective membrane perforation prevents resistance. | MTT assay | U-2 OS | Bone Cancer | IC50 = 13.30 ± 0.99 µM |
| dbacp07194 | DEK | GLLDLLELLLKAAGW | Synthetic | Selective membrane perforation prevents resistance. | MTT assay | HMLER | Breast Cancer | IC50 = 1.14 ± 0.52 µM |
| dbacp07195 | DEK | GLLDLLELLLKAAGW | Synthetic | Selective membrane perforation prevents resistance. | MTT assay | HMLER-shEcad | Breast Cancer | IC50 = 0.70 ± 0.07 µM |
| dbacp07196 | DEK | GLLDLLELLLKAAGW | Synthetic | Selective membrane perforation prevents resistance. | MTT assay | U-2 OS | Bone Cancer | IC50 = 19.88 ± 2.65 µM |
| dbacp07197 | EEK | GLLELLELLLKAAGW | Synthetic | Selective membrane perforation prevents resistance. | MTT assay | HMLER | Breast Cancer | IC50 = 1.10 ± 0.14 µM |
| dbacp07198 | EEK | GLLELLELLLKAAGW | Synthetic | Selective membrane perforation prevents resistance. | MTT assay | HMLER-shEcad | Breast Cancer | IC50 = 1.08 ± 0.18 µM |
| dbacp07199 | EEK | GLLELLELLLKAAGW | Synthetic | Selective membrane perforation prevents resistance. | MTT assay | U-2 OS | Bone Cancer | IC50 = 32.88 ± 4.07 µM |
| dbacp07200 | HEK | GLLHLLELLLKAAGW | Synthetic | Selective membrane perforation prevents resistance. | MTT assay | HMLER | Breast Cancer | IC50 = 2.35 ± 1.06 µM |
| dbacp07201 | HEK | GLLHLLELLLKAAGW | Synthetic | Selective membrane perforation prevents resistance. | MTT assay | HMLER-shEcad | Breast Cancer | IC50 = 3.45 ± 2.19 µM |
| dbacp07202 | HEK | GLLHLLELLLKAAGW | Synthetic | Selective membrane perforation prevents resistance. | MTT assay | U-2 OS | Bone Cancer | IC50 = 143.20 ± 80.33 µM |
| dbacp07203 | KEK | GLLKLLELLLKAAGW | Synthetic | Selective membrane perforation prevents resistance. | MTT assay | HMLER | Breast Cancer | IC50 = 1.60 ± 0.14 µM |
| dbacp07204 | KEK | GLLKLLELLLKAAGW | Synthetic | Selective membrane perforation prevents resistance. | MTT assay | HMLER-shEcad | Breast Cancer | IC50 = 1.35 ± 0.07 µM |
| dbacp07205 | KEK | GLLKLLELLLKAAGW | Synthetic | Selective membrane perforation prevents resistance. | MTT assay | U-2 OS | Bone Cancer | IC50 = 8.15 ± 0.49 µM |
| dbacp07206 | DHK | GLLDLLHLLLKAAGW | Synthetic | Selective membrane perforation prevents resistance. | MTT assay | HMLER | Breast Cancer | IC50 = 1.75 ±0.49 µM |
| dbacp07207 | DHK | GLLDLLHLLLKAAGW | Synthetic | Selective membrane perforation prevents resistance. | MTT assay | HMLER-shEcad | Breast Cancer | IC50 = 1.02 ± 0.12 µM |
| dbacp07208 | DHK | GLLDLLHLLLKAAGW | Synthetic | Selective membrane perforation prevents resistance. | MTT assay | U-2 OS | Bone Cancer | IC50 = 20.45 ± 2.05 µM |
| dbacp07209 | EHK | GLLELLHLLLKAAGW | Synthetic | Selective membrane perforation prevents resistance. | MTT assay | HMLER | Breast Cancer | IC50 = 1.35 ± 0.35 µM |
| dbacp07210 | EHK | GLLELLHLLLKAAGW | Synthetic | Selective membrane perforation prevents resistance. | MTT assay | HMLER-shEcad | Breast Cancer | IC50 = 0.71 ± 0.13 µM |
| dbacp07211 | EHK | GLLELLHLLLKAAGW | Synthetic | Selective membrane perforation prevents resistance. | MTT assay | U-2 OS | Bone Cancer | IC50 = 25.00 ± 0 µM |
| dbacp07212 | HHK | GLLHLLHLLLKAAGW | Synthetic | Selective membrane perforation prevents resistance. | MTT assay | HMLER | Breast Cancer | IC50 = 3.15 ± 0.07 µM |
| dbacp07213 | HHK | GLLHLLHLLLKAAGW | Synthetic | Selective membrane perforation prevents resistance. | MTT assay | HMLER-shEcad | Breast Cancer | IC50 = 1.75 ± 0.21 µM |
| dbacp07214 | HHK | GLLHLLHLLLKAAGW | Synthetic | Selective membrane perforation prevents resistance. | MTT assay | U-2 OS | Bone Cancer | IC50 = 12.65 ± 1.91 µM |
| dbacp07215 | KHK | GLLKLLHLLLKAAGW | Synthetic | Selective membrane perforation prevents resistance. | MTT assay | HMLER | Breast Cancer | IC50 = 2.59 ± 0.92 µM |
| dbacp07216 | KHK | GLLKLLHLLLKAAGW | Synthetic | Selective membrane perforation prevents resistance. | MTT assay | HMLER-shEcad | Breast Cancer | IC50 = 1.40 ± 0.14 µM |
| dbacp07217 | KHK | GLLKLLHLLLKAAGW | Synthetic | Selective membrane perforation prevents resistance. | MTT assay | U-2 OS | Bone Cancer | IC50 = 12.88 ± 1.24 µM |
| dbacp07218 | DKK | GLLDLLKLLLKAAGW | Synthetic | Selective membrane perforation prevents resistance. | MTT assay | HMLER | Breast Cancer | IC50 = 1.95 ± 0.35 µM |
| dbacp07219 | DKK | GLLDLLKLLLKAAGW | Synthetic | Selective membrane perforation prevents resistance. | MTT assay | HMLER-shEcad | Breast Cancer | IC50 = 1.20 ± 0.14 µM |
| dbacp07220 | DKK | GLLDLLKLLLKAAGW | Synthetic | Selective membrane perforation prevents resistance. | MTT assay | U-2 OS | Bone Cancer | IC50 = 10.40 ± 1.70 µM |
| dbacp07221 | EKK | GLLELLKLLLKAAGW | Synthetic | Selective membrane perforation prevents resistance. | MTT assay | HMLER | Breast Cancer | IC50 = 1.72 ± 0.21 µM |
| dbacp07222 | EKK | GLLELLKLLLKAAGW | Synthetic | Selective membrane perforation prevents resistance. | MTT assay | HMLER-shEcad | Breast Cancer | IC50 = 1.19 ± 0.40 µM |
| dbacp07223 | EKK | GLLELLKLLLKAAGW | Synthetic | Selective membrane perforation prevents resistance. | MTT assay | U-2 OS | Bone Cancer | IC50 = 12.20 ± 1.84 µM |
| dbacp07224 | HKK | GLLHLLKLLLKAAGW | Synthetic | Selective membrane perforation prevents resistance. | MTT assay | HMLER | Breast Cancer | IC50 = 3.40 ± 0.71 µM |
| dbacp07225 | HKK | GLLHLLKLLLKAAGW | Synthetic | Selective membrane perforation prevents resistance. | MTT assay | HMLER-shEcad | Breast Cancer | IC50 = 2.60 ± 0.42 µM |
| dbacp07226 | HKK | GLLHLLKLLLKAAGW | Synthetic | Selective membrane perforation prevents resistance. | MTT assay | U-2 OS | Bone Cancer | IC50 = 12.23 ± 0.11 µM |
| dbacp07227 | KKK | GLLKLLKLLLKAAGW | Synthetic | Selective membrane perforation prevents resistance. | MTT assay | HMLER | Breast Cancer | IC50 = 1.57 ± 0.24 µM |
| dbacp07228 | KKK | GLLKLLKLLLKAAGW | Synthetic | Selective membrane perforation prevents resistance. | MTT assay | HMLER-shEcad | Breast Cancer | IC50 = 1.35 ± 0.40 µM |
| dbacp07229 | KKK | GLLKLLKLLLKAAGW | Synthetic | Selective membrane perforation prevents resistance. | MTT assay | U-2 OS | Bone Cancer | IC50 = 9.65 ± 1.20 µM |
| dbacp07230 | d-DHK | GlldllhlllkaaGw | Synthetic | Selective membrane perforation prevents resistance. | MTT assay | HMLER | Breast Cancer | IC50 = 0.32 ± 0.07 µM |
| dbacp07231 | d-DHK | GlldllhlllkaaGw | Synthetic | Selective membrane perforation prevents resistance. | MTT assay | HMLER-shEcad | Breast Cancer | IC50 = 0.23 ± 0.04 µM |
| dbacp07232 | d-DHK | GlldllhlllkaaGw | Synthetic | Selective membrane perforation prevents resistance. | MTT assay | U-2 OS | Bone Cancer | IC50 = 1.24 ± 0.03 µM |
| dbacp07233 | d-DEK | GlldllelllkaaGw | Synthetic | Selective membrane perforation prevents resistance. | MTT assay | HMLER | Breast Cancer | IC50 = 0.44 ± 0.10 µM |
| dbacp07234 | d-DEK | GlldllelllkaaGw | Synthetic | Selective membrane perforation prevents resistance. | MTT assay | HMLER-shEcad | Breast Cancer | IC50 = 0.36 ± 0 µM |
| dbacp07235 | d-DEK | GlldllelllkaaGw | Synthetic | Selective membrane perforation prevents resistance. | MTT assay | U-2 OS | Bone Cancer | IC50 = 5.84 ± 0.04 µM |
| dbacp07236 | d-EEK | GllellelllkaaGw | Synthetic | Selective membrane perforation prevents resistance. | MTT assay | HMLER | Breast Cancer | IC50 = 0.29 ± 0.01 µM |
| dbacp07237 | d-EEK | GllellelllkaaGw | Synthetic | Selective membrane perforation prevents resistance. | MTT assay | HMLER-shEcad | Breast Cancer | IC50 = 0.29 ± 0.01 µM |
| dbacp07238 | d-EEK | GllellelllkaaGw | Synthetic | Selective membrane perforation prevents resistance. | MTT assay | U-2 OS | Bone Cancer | IC50 = 4.78 ± 0.02 µM |
| dbacp07239 | RB4 | MADSERLSAPGCWAACTNFSRTRK | Derived from protein PLP2 | F-actin modulation induces necrotic death. | MTT assay | B16-F10-Nex 2 | Skin Cancer | EC50 = 0.263 ± 0.585 mol/L × 10-3 |
| dbacp07240 | RB4 | MADSERLSAPGCWAACTNFSRTRK | Derived from protein PLP2 | F-actin modulation induces necrotic death. | MTT assay | HeLa | Cervical Cancer | EC50 = 0.525 ± 0.160 mol/L × 10-3 |
| dbacp07241 | RB4 | MADSERLSAPGCWAACTNFSRTRK | Derived from protein PLP2 | F-actin modulation induces necrotic death. | MTT assay | U-87 | Brain Tumor | EC50 = 0.427 ± 0.053 mol/L × 10-3 |
| dbacp07242 | RB4 | MADSERLSAPGCWAACTNFSRTRK | Derived from protein PLP2 | F-actin modulation induces necrotic death. | MTT assay | A-2058 | Skin Cancer | EC50 = 0.744 ± 0.208 mol/L × 10-3 |
| dbacp07243 | RB4 | MADSERLSAPGCWAACTNFSRTRK | Derived from protein PLP2 | F-actin modulation induces necrotic death. | MTT assay | MCF-7 | Breast Cancer | EC50 = 0.724 ± 0.340 mol/L × 10-3 |
| dbacp07258 | trans-Phakellistatin 18 | trans(P)PIPYPIF | Synthetic | Not Available | MTT assay | HepG-2 | Liver Cancer | IC50 = 67.5 ± 2.938 µM |
| dbacp07259 | t-DPH1-K4 | GLWKKIKNVAAAAGKAALGAL | Analogue of t-DPH1 | Membrane disruption induces apoptotic signaling. | MTT assay | PC-3 | Prostate Cancer | IC50 = 18.99 μM |
| dbacp07260 | t-DPH1-K4 | GLWKKIKNVAAAAGKAALGAL | Analogue of t-DPH1 | Membrane disruption induces apoptotic signaling. | MTT assay | H-838 | Lung Cancer | IC50 = 10.11 μM |
| dbacp07261 | t-DPH1-K4 | GLWKKIKNVAAAAGKAALGAL | Analogue of t-DPH1 | Membrane disruption induces apoptotic signaling. | MTT assay | H-157 | Lung Cancer | IC50 = 6.143 μM |
| dbacp07262 | t-DPH1-K4 | GLWKKIKNVAAAAGKAALGAL | Analogue of t-DPH1 | Membrane disruption induces apoptotic signaling. | MTT assay | U251-MG | Brain Tumor | IC50 = 32.18 μM |
| dbacp07263 | t-DPH1-5K | GLWKKIKNVAKAAGKAALGAL | Analogue of t-DPH1 | Membrane disruption induces apoptotic signaling. | MTT assay | PC-3 | Prostate Cancer | IC50 = 2.605 μM |
| dbacp07264 | t-DPH1-5K | GLWKKIKNVAKAAGKAALGAL | Analogue of t-DPH1 | Membrane disruption induces apoptotic signaling. | MTT assay | H-838 | Lung Cancer | IC50 = 1.796 μM |
| dbacp07265 | t-DPH1-5K | GLWKKIKNVAKAAGKAALGAL | Analogue of t-DPH1 | Membrane disruption induces apoptotic signaling. | MTT assay | H-157 | Lung Cancer | IC50 = 1.546 μM |
| dbacp07266 | t-DPH1-5K | GLWKKIKNVAKAAGKAALGAL | Analogue of t-DPH1 | Membrane disruption induces apoptotic signaling. | MTT assay | U251-MG | Brain Tumor | IC50 = 2.679 μM |
| dbacp07267 | t-DPH1-6K | GLWKKIKNVAKAAGKAAKGAL | Analogue of t-DPH1 | Membrane disruption induces apoptotic signaling. | MTT assay | PC-3 | Prostate Cancer | IC50 = 55.65 μM |
| dbacp07268 | t-DPH1-6K | GLWKKIKNVAKAAGKAAKGAL | Analogue of t-DPH1 | Membrane disruption induces apoptotic signaling. | MTT assay | H-838 | Lung Cancer | IC50 = 186.1 μM |
| dbacp07269 | t-DPH1-6K | GLWKKIKNVAKAAGKAAKGAL | Analogue of t-DPH1 | Membrane disruption induces apoptotic signaling. | MTT assay | H-157 | Lung Cancer | IC50 = 88.28 μM |
| dbacp07270 | t-DPH1-6K | GLWKKIKNVAKAAGKAAKGAL | Analogue of t-DPH1 | Membrane disruption induces apoptotic signaling. | MTT assay | U251-MG | Brain Tumor | IC50 = 593.7 μM |
| dbacp07271 | t-DPH1-6KW | WLWKKIKNVAKAAGKAAKGAL | Analogue of t-DPH1 | Membrane disruption induces apoptotic signaling. | MTT assay | PC-3 | Prostate Cancer | IC50 = 118.4 μM |
| dbacp07272 | t-DPH1-6KW | WLWKKIKNVAKAAGKAAKGAL | Analogue of t-DPH1 | Membrane disruption induces apoptotic signaling. | MTT assay | H-838 | Lung Cancer | IC50 = 180.8 μM |
| dbacp07273 | t-DPH1-6KW | WLWKKIKNVAKAAGKAAKGAL | Analogue of t-DPH1 | Membrane disruption induces apoptotic signaling. | MTT assay | H-157 | Lung Cancer | IC50 = 427.3 μM |
| dbacp07274 | t-DPH1-6KW | WLWKKIKNVAKAAGKAAKGAL | Analogue of t-DPH1 | Membrane disruption induces apoptotic signaling. | MTT assay | U251-MG | Brain Tumor | IC50 = 1499 μM |
| dbacp07275 | LCP-2 | WAHT | Laminaria japonica | Mitochondrial apoptosis via p53 activation. | MTT assay | SGC-7901 | Gastric Cancer | IC50 = 116 ± 12.4 μM |
| dbacp07276 | LCP-2 | WAHT | Laminaria japonica | Mitochondrial apoptosis via p53 activation. | MTT assay | MKN-45 | Gastric Cancer | IC50 = 107 ± 11.8 μM |
| dbacp07277 | LCP-2 | WAHT | Laminaria japonica | Mitochondrial apoptosis via p53 activation. | MTT assay | HepG-2 | Gastric Cancer | IC50 = 96.9 ± 9.91 μM |
| dbacp07278 | LCP-2 | WAHT | Laminaria japonica | Mitochondrial apoptosis via p53 activation. | MTT assay | CaCo-2 | Colon Cancer | IC50 = 100 ± 11.6 μM |
| dbacp07279 | LCP-3 | WHLV | Laminaria japonica | Mitochondrial apoptosis via p53 activation. | MTT assay | SGC-7901 | Gastric Cancer | IC50 = 101 ± 10.6 μM |
| dbacp07280 | LCP-3 | WHLV | Laminaria japonica | Mitochondrial apoptosis via p53 activation. | MTT assay | MKN-45 | Gastric Cancer | IC50 = 86.9 ± 9.11 μM |
| dbacp07281 | LCP-3 | WHLV | Laminaria japonica | Mitochondrial apoptosis via p53 activation. | MTT assay | HepG-2 | Gastric Cancer | IC50 = 85.2 ± 9.27 μM |
| dbacp07282 | LCP-3 | WHLV | Laminaria japonica | Mitochondrial apoptosis via p53 activation. | MTT assay | CaCo-2 | Colon Cancer | IC50 = 68.2 ± 7.11 μM |
| dbacp07283 | AtMP1 | THPPTTTTTTTTTTTTTAAPATTT | Anabastestudineus skin mucus fraction 2 | p53-mediated Bax/Bcl-2 apoptosis activation | MTT assay | MCF-7 | Breast Cancer | IC50 = 8.25 ± 0.14 μg/ml |
| dbacp07284 | AtMP1 | THPPTTTTTTTTTTTTTAAPATTT | Anabastestudineus skin mucus fraction 2 | p53-mediated Bax/Bcl-2 apoptosis activation | MTT assay | MDA-MB-231 | Breast Cancer | IC50 = 9.35 ± 0.25 μg/ml |
| dbacp07285 | AtMP2 | TGIATSGLATFTLHTGSLAPAT | Anabastestudineus skin mucus fraction 2 | p53-mediated Bax/Bcl-2 apoptosis activation | MTT assay | MCF-7 | Breast Cancer | IC50 = 5.89 ± 0.14 μg/ml |
| dbacp07286 | AtMP2 | TGIATSGLATFTLHTGSLAPAT | Anabastestudineus skin mucus fraction 2 | p53-mediated Bax/Bcl-2 apoptosis activation | MTT assay | MDA-MB-231 | Breast Cancer | IC50 = 6.97 ± 0.24 μg/ml |
| dbacp07296 | vCPP0275 | KKRYKKKYKAYKPYKKKKKF | Capsid protein of the Torque teno douroucouli virus | Dual anticancer and BBB-blockade. | MTT assay | BT-20 | Breast Cancer | IC50 = 44.8 ± 1.1 μM |
| dbacp07297 | vCPP0275 | KKRYKKKYKAYKPYKKKKKF | Capsid protein of the Torque teno douroucouli virus | Dual anticancer and BBB-blockade. | MTT assay | SK-BR-3 | Breast Cancer | IC50 = 34.0 ± 1.0 μM |
| dbacp07298 | vCPP0667 | RPRRRATTRRRITTGTRRRR | Capsid protein of the Torque teno douroucouli virus | Dual anticancer and BBB-blockade. | MTT assay | BT-20 | Breast Cancer | IC50 = 88.8 ± 1.0 μM |
| dbacp07299 | vCPP0667 | RPRRRATTRRRITTGTRRRR | Capsid protein of the Torque teno douroucouli virus | Dual anticancer and BBB-blockade. | MTT assay | BT-474 | Breast Cancer | IC50 = 92.8 ± 1.1 μM |
| dbacp07300 | vCPP0667 | RPRRRATTRRRITTGTRRRR | Capsid protein of the Torque teno douroucouli virus | Dual anticancer and BBB-blockade. | MTT assay | SK-BR-3 | Breast Cancer | IC50 = 71.2 ± 1.1 μM |
| dbacp07301 | vCPP0769 | RRLTLRQLLGLGSRRRRRSR | Capsid protein of the Torque teno douroucouli virus | Dual anticancer and BBB-blockade. | MTT assay | MDA-MB-231 | Breast Cancer | IC50 = 9.0 ± 0.1 μM |
| dbacp07302 | vCPP0769 | RRLTLRQLLGLGSRRRRRSR | Capsid protein of the Torque teno douroucouli virus | Dual anticancer and BBB-blockade. | MTT assay | BT-20 | Breast Cancer | IC50 = 3.5 ± 1.5 μM |
| dbacp07303 | vCPP0769 | RRLTLRQLLGLGSRRRRRSR | Capsid protein of the Torque teno douroucouli virus | Dual anticancer and BBB-blockade. | MTT assay | BT-474 | Breast Cancer | IC50 = 37.5 ± 1.7 μM |
| dbacp07304 | vCPP0769 | RRLTLRQLLGLGSRRRRRSR | Capsid protein of the Torque teno douroucouli virus | Dual anticancer and BBB-blockade. | MTT assay | SK-BR-3 | Breast Cancer | IC50 = 21.1 ± 2.0 μM |
| dbacp07305 | vCPP2319 | WRRRYRRWRRRRRWRRRPRR | Capsid protein of the Torque teno douroucouli virus | Dual anticancer and BBB-blockade. | MTT assay | MDA-MB-231 | Breast Cancer | IC50 = 4.5 ± 0.1 μM |
| dbacp07306 | vCPP2319 | WRRRYRRWRRRRRWRRRPRR | Capsid protein of the Torque teno douroucouli virus | Dual anticancer and BBB-blockade. | MTT assay | BT-20 | Breast Cancer | IC50 = 4.2 ± 2.2 μM |
| dbacp07307 | vCPP2319 | WRRRYRRWRRRRRWRRRPRR | Capsid protein of the Torque teno douroucouli virus | Dual anticancer and BBB-blockade. | MTT assay | BT-474 | Breast Cancer | IC50 = 15.7 ± 1.5 μM |
| dbacp07308 | vCPP2319 | WRRRYRRWRRRRRWRRRPRR | Capsid protein of the Torque teno douroucouli virus | Dual anticancer and BBB-blockade. | MTT assay | SK-BR-3 | Breast Cancer | IC50 = 14.0 ± 1.0 μM |
| dbacp07309 | LyeTxI-b | IWLTALKFLGKNLGKLAKQQLAKL | Synthetic | Apoptosis induction and immune modulation. | MTT assay | 4T1 | Breast Cancer | IC50 = 6.5 ± 5.30 µM |
| dbacp07310 | LyeTxI-b | IWLTALKFLGKNLGKLAKQQLAKL | Synthetic | Apoptosis induction and immune modulation. | MTT assay | MCF-7 | Breast Cancer | IC50 = 7.34 ± 3.09 µM |
| dbacp07311 | LyeTxI-b | IWLTALKFLGKNLGKLAKQQLAKL | Synthetic | Apoptosis induction and immune modulation. | MTT assay | MDA-MB-231 | Breast Cancer | IC50 = 5.77 ± 0.83 µM |
| dbacp07312 | B1OS-L | FLPLIASLAGNVVPKIFCKITKRC | B-1OS | Not Available | MTT assay | H-838 | Lung Cancer | IC50 = 3.976 µM |
| dbacp07313 | B1OS-L | FLPLIASLAGNVVPKIFCKITKRC | B-1OS | Not Available | MTT assay | PC-3 | Prostate Cancer | IC50 = 5.473 µM |
| dbacp07314 | B1OS-L | FLPLIASLAGNVVPKIFCKITKRC | B-1OS | Not Available | MTT assay | U251-MG | Brain Tumor | IC50 = 8.629 µM |
| dbacp07315 | B1OS-L | FLPLIASLAGNVVPKIFCKITKRC | B-1OS | Not Available | MTT assay | MCF-7 | Breast Cancer | IC50 = 8.883 µM |
| dbacp07316 | B1OS-L | FLPLIASLAGNVVPKIFCKITKRC | B-1OS | Not Available | MTT assay | HCT-116 | Colon Cancer | IC50 = 11.03 µM |
| dbacp07317 | B1OS-D-L | FlPLIASLAGNVVPKIFCKITKRC | B-1OS | Not Available | MTT assay | H-838 | Lung Cancer | IC50 = 2.553 µM |
| dbacp07318 | B1OS-D-L | FlPLIASLAGNVVPKIFCKITKRC | B-1OS | Not Available | MTT assay | PC-3 | Prostate Cancer | IC50 = 2.629 µM |
| dbacp07319 | B1OS-D-L | FlPLIASLAGNVVPKIFCKITKRC | B-1OS | Not Available | MTT assay | U251-MG | Brain Tumor | IC50 = 3.492 µM |
| dbacp07320 | B1OS-D-L | FlPLIASLAGNVVPKIFCKITKRC | B-1OS | Not Available | MTT assay | MCF-7 | Breast Cancer | IC50 = 3.17 µM |
| dbacp07321 | B1OS-D-L | FlPLIASLAGNVVPKIFCKITKRC | B-1OS | Not Available | MTT assay | HCT-116 | Colon Cancer | IC50 = 3.721 µM |
| dbacp07324 | IK13 | CIIKKIIKKIIKK | Synthetic | Mitochondrial mediated apoptosis | MTT assay | HCT-116 | Colorectal Cancer | IC50 = 29 ± 6 µM |
| dbacp07325 | IK13 | CIIKKIIKKIIKK | Synthetic | Mitochondrial mediated apoptosis | MTT assay | HeLa | Cervical Cancer | IC50 = 47±5 µM |
| dbacp07326 | LK13 | CLLKKLLKKLLKK | Synthetic | Mitochondrial mediated apoptosis | MTT assay | HCT-116 | Colorectal Cancer | IC50 = 23 ± 2 µM |
| dbacp07327 | LK13 | CLLKKLLKKLLKK | Synthetic | Mitochondrial mediated apoptosis | MTT assay | HeLa | Cervical Cancer | IC50 = 83 ± 9 µM |
| dbacp07328 | IR13 | CIIRRIIRRIIRR | Synthetic | Mitochondrial mediated apoptosis | MTT assay | HCT-116 | Colorectal Cancer | IC50 > 100 µM |
| dbacp07329 | IR13 | CIIRRIIRRIIRR | Synthetic | Mitochondrial mediated apoptosis | MTT assay | HeLa | Cervical Cancer | IC50 > 100 µM |
| dbacp07330 | LR13 | CLLRRLLRRLLRR | Synthetic | Mitochondrial mediated apoptosis | MTT assay | HCT-116 | Colorectal Cancer | IC50 = 15.6 ± 1.0 µM |
| dbacp07331 | LR13 | CLLRRLLRRLLRR | Synthetic | Mitochondrial mediated apoptosis | MTT assay | HeLa | Cervical Cancer | IC50 = 26.7 ± 1.3 µM |
| dbacp07332 | CI-15 | CIIKKIIKKIIKKII | Synthetic | Mitochondrial mediated apoptosis | MTT assay | HCT-116 | Colorectal Cancer | IC50 = 7.7 ± 0.2 µM |
| dbacp07333 | CI-15 | CIIKKIIKKIIKKII | Synthetic | Mitochondrial mediated apoptosis | MTT assay | HeLa | Cervical Cancer | IC50 = 2.7 ± 0.5 µM |
| dbacp07334 | GI-15 | LC-Propargyl-GIIKKIIKKIIKKII | Synthetic | Mitochondrial mediated apoptosis | MTT assay | HCT-116 | Colorectal Cancer | IC50 = 13.6 ± 0.2 µM |
| dbacp07335 | GI-15 | LC-Propargyl-GIIKKIIKKIIKKII | Synthetic | Mitochondrial mediated apoptosis | MTT assay | HeLa | Cervical Cancer | IC50 = 16.6 ± 0.8 µM |
| dbacp07336 | Temporin-HLa | FFPLIFGALSSILPKIL | Hylarana latouchii | Membrane disruption | MTT assay | NCI-H23 | Lung Cancer | IC50 = 4.96 ± 0.94 μM |
| dbacp07337 | Temporin-HLa | FFPLIFGALSSILPKIL | Hylarana latouchii | Membrane disruption | MTT assay | H-157 | Lung Cancer | IC50 = 15.18 ± 2.98 μM |
| dbacp07338 | Temporin-HLa | FFPLIFGALSSILPKIL | Hylarana latouchii | Membrane disruption | MTT assay | H-460 | Lung Cancer | IC50 = 1.64 ± 0.41 μM |
| dbacp07347 | GA - 2 | Structure given in figure | Synthetic (glycyrrhetinic acid (GA)-based peptides) | Apoptosis induction, Bax/p53/caspase activation | MTT assay | MCF-7 | Breast Cancer | IC50 = 7.70 ± 1.3 µg/mL |
| dbacp07348 | GA - 2 | Structure given in figure | Synthetic (glycyrrhetinic acid (GA)-based peptides) | Apoptosis induction, Bax/p53/caspase activation | MTT assay | HCT-116 | Colon Cancer | IC50 = 70.30 ± 0.9 µg/mL |
| dbacp07349 | GA - 3 | Structure given in figure | Synthetic (glycyrrhetinic acid (GA)-based peptides) | Apoptosis induction, Bax/p53/caspase activation | MTT assay | MCF-7 | Breast Cancer | IC50 = 5.1 ± 0.7 µg/mL |
| dbacp07350 | GA - 3 | Structure given in figure | Synthetic (glycyrrhetinic acid (GA)-based peptides) | Apoptosis induction, Bax/p53/caspase activation | MTT assay | HCT-116 | Colon Cancer | IC50 = 7.40 ± 0.4 µg/mL |
| dbacp07351 | GA - 4 | Structure given in figure | Synthetic (glycyrrhetinic acid (GA)-based peptides) | Apoptosis induction, Bax/p53/caspase activation | MTT assay | MCF-7 | Breast Cancer | IC50 = 6.10 ± 0.4 µg/mL |
| dbacp07352 | GA - 4 | Structure given in figure | Synthetic (glycyrrhetinic acid (GA)-based peptides) | Apoptosis induction, Bax/p53/caspase activation | MTT assay | HCT-116 | Colon Cancer | IC50 = 73.0 ± 1.4 µg/mL |
| dbacp07353 | GA - 5 | Structure given in figure | Synthetic (glycyrrhetinic acid (GA)-based peptides) | Apoptosis induction, Bax/p53/caspase activation | MTT assay | MCF-7 | Breast Cancer | IC50 = 5.0 ± 0.3 µg/mL |
| dbacp07354 | GA - 5 | Structure given in figure | Synthetic (glycyrrhetinic acid (GA)-based peptides) | Apoptosis induction, Bax/p53/caspase activation | MTT assay | HCT-116 | Colon Cancer | IC50 = 5.2 ± 0.8 µg/mL |
| dbacp07355 | GA - 7 | Structure given in figure | Synthetic (glycyrrhetinic acid (GA)-based peptides) | Apoptosis induction, Bax/p53/caspase activation | MTT assay | MCF-7 | Breast Cancer | IC50 = 3.70 ± 0.2 µg/mL |
| dbacp07356 | GA - 7 | Structure given in figure | Synthetic (glycyrrhetinic acid (GA)-based peptides) | Apoptosis induction, Bax/p53/caspase activation | MTT assay | HCT-116 | Colon Cancer | IC50 = 3.0 ± 1.1 µg/mL |
| dbacp07357 | GA - 7 | Structure given in figure | Synthetic (glycyrrhetinic acid (GA)-based peptides) | Apoptosis induction, Bax/p53/caspase activation | MTT assay | HepG-2 | Liver Cancer | IC50 = 3.30 ± 0.1 µg/mL |
| dbacp07358 | GA - 8 | Structure given in figure | Synthetic (glycyrrhetinic acid (GA)-based peptides) | Apoptosis induction, Bax/p53/caspase activation | MTT assay | MCF-7 | Breast Cancer | IC50 = 6.90 ± 1.1 µg/mL |
| dbacp07359 | GA - 8 | Structure given in figure | Synthetic (glycyrrhetinic acid (GA)-based peptides) | Apoptosis induction, Bax/p53/caspase activation | MTT assay | HCT-116 | Colon Cancer | IC50 = 60.70 ± 0.6 µg/mL |
| dbacp07360 | N-Ter-TAT | RDVFTKGYGFGL-GRK(Dansylglycine)KRRQRRRPQ | Synthetic | Mitochondrial targeting, VDAC1-HKII dissociation | MTT assay | A-375 | Skin Cancer | IC50 > 50.0 μM |
| dbacp07361 | Pal-N-Ter-TAT | Pal-RDVFTKGYGFGL-GRK(Dansylglycine)KRRQRRRPQ | Analogue of N-terminal fragment of the VDAC1 protein | Mitochondrial targeting, VDAC1-HKII dissociation | MTT assay | A-375 | Skin Cancer | IC50 = 36.67(Supplementary material)/15.2 ± 0.7 μM(Published paper) |
| dbacp07362 | Pal-N-Ter-TAT | Pal-RDVFTKGYGFGL-GRK(Dansylglycine)KRRQRRRPQ | Analogue of N-terminal fragment of the VDAC1 protein | Mitochondrial targeting, VDAC1-HKII dissociation | MTT assay | A-549 | Lung Cancer | IC50 = 44.98 μM |
| dbacp07363 | Pal-N-Ter-TAT | Pal-RDVFTKGYGFGL-GRK(Dansylglycine)KRRQRRRPQ | Analogue of N-terminal fragment of the VDAC1 protein | Mitochondrial targeting, VDAC1-HKII dissociation | MTT assay | MCF-7 | Breast Cancer | IC50 = 27.26 μM |
| dbacp07364 | pFL-N-Ter-TAT | FPWWWPFL-RDVFTKGYGFGL-GRK(Dansylglycine)KRRQRRRPQ | Analogue of N-terminal fragment of the VDAC1 protein | Mitochondrial targeting, VDAC1-HKII dissociation | MTT assay | A-375 | Skin Cancer | IC50 = 11.1 ± 0.1 μM |
| dbacp07365 | Piscidin 3 | FIHHIFRGIVHAGRSIGRFLTG | Morone chrysops x Morone saxatilis | Cu²⁺-mediated membrane lipid oxidation | MTT assay | HT-1080 | Fibrosarcoma | IC50 = 26.01 µM |
| dbacp07366 | Piscidin 3 | FIHHIFRGIVHAGRSIGRFLTG | Morone chrysops x Morone saxatilis | Cu²⁺-mediated membrane lipid oxidation | MTT assay | HT-1080 | Fibrosarcoma | IC50 = 5.52 µM |
| dbacp07367 | Piscidin 3 | FIHHIFRGIVHAGRSIGRFLTG | Morone chrysops x Morone saxatilis | Cu²⁺-mediated membrane lipid oxidation | MTT assay | MDA-MB-231 | Breast Cancer | IC50 = 17.5 µM |
| dbacp07368 | Piscidin 3 | FIHHIFRGIVHAGRSIGRFLTG | Morone chrysops x Morone saxatilis | Cu²⁺-mediated membrane lipid oxidation | MTT assay | MDA-MB-231 | Breast Cancer | IC50 = 5.25 µM |
| dbacp07369 | Piscidin 3 | FIHHIFRGIVHAGRSIGRFLTG | Morone chrysops x Morone saxatilis | Cu²⁺-mediated membrane lipid oxidation | MTT assay | A-549 | Lung Cancer | IC50 = 21.6 µM |
| dbacp07370 | Piscidin 3 | FIHHIFRGIVHAGRSIGRFLTG | Morone chrysops x Morone saxatilis | Cu²⁺-mediated membrane lipid oxidation | MTT assay | A-549 | Lung Cancer | IC50 = 2.99 µM |
| dbacp07371 | Piscidin 3 | FIHHIFRGIVHAGRSIGRFLTG | Morone chrysops x Morone saxatilis | Cu²⁺-mediated membrane lipid oxidation | MTT assay | HeLa | Cervical Cancer | IC50 = 18.1 µM |
| dbacp07372 | Piscidin 3 | FIHHIFRGIVHAGRSIGRFLTG | Morone chrysops x Morone saxatilis | Cu²⁺-mediated membrane lipid oxidation | MTT assay | HeLa | Cervical Cancer | IC50 = 1.97 µM |
| dbacp07373 | HPRP-A1 | FKKLKKLFSKLWNWK | N-terminal region of Helicobacter pylori ribosomal protein L1 | Apoptosis induction, p53-mediated cell cycle arrest | MTT assay | CT-26 | Colorectal Cancer | IC50 between 0.5 and 1 µg/mL |
| dbacp07374 | HPRP-A1 | FKKLKKLFSKLWNWK | N-terminal region of Helicobacter pylori ribosomal protein L1 | Apoptosis induction, p53-mediated cell cycle arrest | MTT assay | HT-29 | Colon Cancer | IC50 ~ 0.5 µg/mL |
| dbacp07375 | Brevinin-2DYd | GIFDVVKGVLKGVGKNVAGSLLEQLKCKLSGGC | Rana dybowskii | Not Available | MTT assay | A-549 | Lung Cancer | IC50 = 2.975 µg/ml |
| dbacp07376 | Brevinin-2DYd | GIFDVVKGVLKGVGKNVAGSLLEQLKCKLSGGC | Rana dybowskii | Not Available | MTT assay | MCF-7 | Breast Cancer | IC50 = 25.74 µg/ml |
| dbacp07377 | Brevinin-2DYd | GIFDVVKGVLKGVGKNVAGSLLEQLKCKLSGGC | Rana dybowskii | Not Available | MTT assay | HeLa | Cervical Cancer | IC50 = 19.69 µg/ml |
| dbacp07378 | Brevinin-2DYd | GIFDVVKGVLKGVGKNVAGSLLEQLKCKLSGGC | Rana dybowskii | Not Available | MTT assay | LoVo | Colon Cancer | IC50 = 8.05 µg/ml |
| dbacp07379 | Ranatuerin-2Lb | GILSSIKGVAKGVAKNVAAQLLDTLKCKITGC | Rana luteiventris | Not Available | MTT assay | A-549 | Lung Cancer | IC50 = 15.32 µM |
| dbacp07380 | Ranatuerin-2Lb | GILSSIKGVAKGVAKNVAAQLLDTLKCKITGC | Rana luteiventris | Not Available | MTT assay | MCF-7 | Breast Cancer | IC50 = 45.25 µM |
| dbacp07381 | Ranatuerin-2Lb | GILSSIKGVAKGVAKNVAAQLLDTLKCKITGC | Rana luteiventris | Not Available | MTT assay | HeLa | Cervical Cancer | IC50 = 37.23 µM |
| dbacp07382 | Ranatuerin-2Lb | GILSSIKGVAKGVAKNVAAQLLDTLKCKITGC | Rana luteiventris | Not Available | MTT assay | LoVo | Colon Cancer | IC50 = 59.78 µM |
| dbacp07383 | Odorranain-C1 | GVLGAVKDLLIGAGKSAAQSVLKTLSCKLSNDC | Odorrana grahami | Not Available | MTT assay | A-549 | Lung Cancer | IC50 = 27.31 µM |
| dbacp07384 | Odorranain-C1 | GVLGAVKDLLIGAGKSAAQSVLKTLSCKLSNDC | Odorrana grahami | Not Available | MTT assay | MCF-7 | Breast Cancer | IC50 = 41.21 µM |
| dbacp07385 | Odorranain-C1 | GVLGAVKDLLIGAGKSAAQSVLKTLSCKLSNDC | Odorrana grahami | Not Available | MTT assay | HeLa | Cervical Cancer | IC50 = 52.83 µM |
| dbacp07386 | Odorranain-C1 | GVLGAVKDLLIGAGKSAAQSVLKTLSCKLSNDC | Odorrana grahami | Not Available | MTT assay | LoVo | Colon Cancer | IC50 = 55.22 µM |
| dbacp07387 | Brevinin-2DYb | GLFDVVKGVLKGAGKNVAGSLLEQLKCKLSGGC | Rana dybowskii | Not Available | MTT assay | A-549 | Lung Cancer | IC50 = 24.01 µM |
| dbacp07388 | Brevinin-2DYb | GLFDVVKGVLKGAGKNVAGSLLEQLKCKLSGGC | Rana dybowskii | Not Available | MTT assay | MCF-7 | Breast Cancer | IC50 = 37.84 µM |
| dbacp07389 | Brevinin-2DYb | GLFDVVKGVLKGAGKNVAGSLLEQLKCKLSGGC | Rana dybowskii | Not Available | MTT assay | HeLa | Cervical Cancer | IC50 = 23.26 µM |
| dbacp07390 | Brevinin-2DYb | GLFDVVKGVLKGAGKNVAGSLLEQLKCKLSGGC | Rana dybowskii | Not Available | MTT assay | LoVo | Colon Cancer | IC50 = 35.05 µM |
| dbacp07391 | Ranatuerin-2 | GLFLDTLKGAAKDVAGKLEGLKCKITGCKLP | Rana catesbeiana | Not Available | MTT assay | A-549 | Lung Cancer | IC50 > 128 µM |
| dbacp07392 | Ranatuerin-2 | GLFLDTLKGAAKDVAGKLEGLKCKITGCKLP | Rana catesbeiana | Not Available | MTT assay | MCF-7 | Breast Cancer | IC50 > 128 µM |
| dbacp07393 | Ranatuerin-2 | GLFLDTLKGAAKDVAGKLEGLKCKITGCKLP | Rana catesbeiana | Not Available | MTT assay | HeLa | Cervical Cancer | IC50 > 128 µM |
| dbacp07394 | Ranatuerin-2 | GLFLDTLKGAAKDVAGKLEGLKCKITGCKLP | Rana catesbeiana | Not Available | MTT assay | LoVo | Colon Cancer | IC50 = 128 µM |
| dbacp07395 | 17BIPHE2 | GBKRLVQRLKDBLRNLV | Derivative of LL-37 | ERK-mediated apoptosis and mitochondrial disruption | MTT assay | A-549 | Lung Cancer | IC50 = 34.33 µmol |
| dbacp07396 | 17BIPHE2 | GBKRLVQRLKDBLRNLV | Derivative of LL-37 | ERK-mediated apoptosis and mitochondrial disruption | MTT assay | NCI-H-1975 | Lung Cancer | IC50 = 71.42 µmol/L |
| dbacp07397 | Pugnin A | RLMRIFRILKLAR | Synthetic | Membrane disruption induces necrotic death | MTT assay | MCF-7 | Breast Cancer | 12% Cytotoxicity at 100 µM |
| dbacp07398 | Pugnin A | RLMRIFRILKLAR | Synthetic | Membrane disruption induces necrotic death | MTT assay | PC-3 | Prostate Cancer | 74% Cytotoxicity at 100 µM |
| dbacp07399 | Pugnin B | RMMRIFWVIKLAR | Synthetic | Membrane disruption induces necrotic death | MTT assay | MCF-7 | Breast Cancer | 5% Cytotoxicity at 100 µM |
| dbacp07400 | Pugnin B | RMMRIFWVIKLAR | Synthetic | Membrane disruption induces necrotic death | MTT assay | PC-3 | Prostate Cancer | 90% Cytotoxicity at 100 µM |
| dbacp07401 | NMTP-5 | zffygwyggmekllrggrgerppr | Not Available | NRP1/MDM2 inhibition induces apoptosis | MTT assay | SK-HEP-1 | Liver Cancer | IC50 = 53.84 ± 4.35 µM |
| dbacp07402 | Pep | GKLRLIKKLWVKKWKKKGWKA | Synthetic | Membrane disruption induces necrotic death | MTT assay | A-549 | Lung Cancer | IC50 = 4 µM |
| dbacp07403 | Pep | GKLRLIKKLWVKKWKKKGWKA | Synthetic | Membrane disruption induces necrotic death | MTT assay | MCF-7 | Breast Cancer | IC50 = 2 µM |
| dbacp07408 | Dermaseptin-TO | ALWKDLLKNVGIAAGKAALNKVTDMVNQ | Phyllomedusa tomopterna | Membrane disruption induces cell death | MTT assay | U251-MG | Brain Tumor | Graph Figure-7 |
| dbacp07409 | Dermaseptin-TO | ALWKDLLKNVGIAAGKAALNKVTDMVNQ | Phyllomedusa tomopterna | Membrane disruption induces cell death | MTT assay | H-157 | Lung Cancer | Graph Figure-7 |
| dbacp07410 | Dermaseptin-TO | ALWKDLLKNVGIAAGKAALNKVTDMVNQ | Phyllomedusa tomopterna | Membrane disruption induces cell death | MTT assay | PC-3 | Prostate Cancer | Graph Figure-7 |
| dbacp07411 | Si1 | (KLAKLAK)2 | Synthetic | Membrane disruption induces cancer apoptosis | MTT assay | MCF-7 | Breast Cancer | IC50 = 124.1 ± 8.12 µM |
| dbacp07412 | Si1 | (KLAKLAK)2 | Synthetic | Membrane disruption induces cancer apoptosis | MTT assay | MDA-MB-231 | Breast Cancer | IC50 = 746.5 ± 7.6 µM |
| dbacp07413 | Si3 | KL(Beta-A)KL(Beta-A)AK | Synthetic | Membrane disruption induces cancer apoptosis | MTT assay | MCF-7 | Breast Cancer | IC50 = 176.3 ± 4.66 µM |
| dbacp07414 | Si2 | KL(Beta-A)KL(Beta-A)K | Synthetic | Membrane disruption induces cancer apoptosis | MTT assay | MCF-7 | Breast Cancer | IC50 = 662.9 ± 20.02 µM |
| dbacp07415 | Si2 | KL(Beta-A)KL(Beta-A)K | Synthetic | Membrane disruption induces cancer apoptosis | MTT assay | MDA-MB-231 | Breast Cancer | IC50 = 840 ± 21.18 µM |
| dbacp07416 | Si11 | KL(Beta-A)KL(Beta-A)K | Synthetic | Membrane disruption induces cancer apoptosis | MTT assay | MDA-MB-231 | Breast Cancer | IC50 = 1087 ± 70.71 µM |
| dbacp07417 | Si11 | KL(Beta-A)KLAK | Synthetic | Membrane disruption induces cancer apoptosis | MTT assay | MCF-7 | Breast Cancer | IC50 = 228.8 ± 7.18 µM |
| dbacp07418 | Si13 | KnLAKnLAK | Synthetic | Membrane disruption induces cancer apoptosis | MTT assay | MCF-7 | Breast Cancer | IC50 = 1704 ± 112 µM |
| dbacp07419 | Si14 | KnLAKnLAK | Synthetic | Membrane disruption induces cancer apoptosis | MTT assay | MCF-7 | Breast Cancer | IC50 = 593.3 ± 60.3 µM |
| dbacp07420 | Si14 | KnLAKnLAK | Synthetic | Membrane disruption induces cancer apoptosis | MTT assay | MDA-MB-231 | Breast Cancer | IC50 = 1049 ± 49.77 µM |
| dbacp07421 | Si15 | KnLAKnLAK | Synthetic | Membrane disruption induces cancer apoptosis | MTT assay | MCF-7 | Breast Cancer | IC50 = 140.3 ± 7.12 µM |
| dbacp07422 | Si15 | KnLAKnLAK | Synthetic | Membrane disruption induces cancer apoptosis | MTT assay | MDA-MB-231 | Breast Cancer | IC50 = 346.3 ± 7.91 µM |
| dbacp07423 | GP-1 | FKEHGY | Ginseng Leaf Peptide | Mitochondrial apoptosis via p53 activation | MTT assay | CT-26 | Colorectal Cancer | IC50 = 86.4 ± 9.46 µM |
| dbacp07424 | GP-1 | FKEHGY | Ginseng Leaf Peptide | Mitochondrial apoptosis via p53 activation | MTT assay | CaCo-2 | Colon Cancer | IC50 = 104 ± 11.3 µM |
| dbacp07425 | GP-1 | FKEHGY | Ginseng Leaf Peptide | Mitochondrial apoptosis via p53 activation | MTT assay | Colo-320 | Colon Cancer | IC50 = 111 ± 12.0 µM |
| dbacp07426 | GP-2 | EGFHL | Ginseng Leaf Peptide | Mitochondrial apoptosis via p53 activation | MTT assay | CT-26 | Colorectal Cancer | IC50 = 114 ± 12.1 µM |
| dbacp07427 | GP-2 | EGFHL | Ginseng Leaf Peptide | Mitochondrial apoptosis via p53 activation | MTT assay | CaCo-2 | Colon Cancer | IC50 = 154 ± 15.8 µM |
| dbacp07428 | GP-2 | EGFHL | Ginseng Leaf Peptide | Mitochondrial apoptosis via p53 activation | MTT assay | Colo-320 | Colon Cancer | IC50 = 142 ± 14.9 µM |
| dbacp07429 | GP-3 | FSHTYV | Ginseng Leaf Peptide | Mitochondrial apoptosis via p53 activation | MTT assay | CT-26 | Colorectal Cancer | IC50 = 133 ± 12.5 µM |
| dbacp07430 | GP-3 | FSHTYV | Ginseng Leaf Peptide | Mitochondrial apoptosis via p53 activation | MTT assay | CaCo-2 | Colon Cancer | IC50 = 162 ± 17.1 µM |
| dbacp07431 | GP-3 | FSHTYV | Ginseng Leaf Peptide | Mitochondrial apoptosis via p53 activation | MTT assay | Colo-320 | Colon Cancer | IC50 = 149 ± 15.2 µM |
| dbacp07432 | [Arg]3-VmCT1 | FLRALWNVAKSVF | Synthetic | Membrane disruption via cationic interaction | MTT assay | MCF-7 | Breast Cancer | IC50 = 20.6 ± 3.1 μmol/L |
| dbacp07433 | [Arg]7-VmCT1 | FLGALWRVAKSVF | Synthetic | Membrane disruption via cationic interaction | MTT assay | MCF-7 | Breast Cancer | IC50 = 18.0 ± 2.7 μmol/L |
| dbacp07434 | [Arg]11-VmCT1 | FLGALWNVAKRVF | Synthetic | Membrane disruption via cationic interaction | MTT assay | MCF-7 | Breast Cancer | IC50 = 25.8 ± 5.2 μmol/L |
| dbacp07435 | L9H5-1 | LHLLLHLLHHLLHL | Synthetic | Acid-triggered membrane disruption apoptosis | MTT assay | HeLa | Cervical Cancer | IC50 = 5.4 µM |
| dbacp07436 | L8H6 | LHHLLHLLHHLLHL | Synthetic | Acid-triggered membrane disruption apoptosis | MTT assay | HeLa | Cervical Cancer | IC50 = 16.4 µM |
| dbacp07466 | Tachyplesin | KWCFRVCYRGICYIRRCR | Horseshoe crab | Fas activation drives apoptosis/necroptosis | MTT assay | A-549 | Lung Cancer | IC50 = 35 µg/ml |
| dbacp07467 | Tachyplesin | KWCFRVCYRGICYIRRCR | Horseshoe crab | Fas activation drives apoptosis/necroptosis | MTT assay | H-460 | Lung Cancer | IC50 = 25 µg/ml |
| dbacp07472 | MzDef | MSSSNCANVCQTENFPGGECKAEGATRKCFCKNC | Zea mays L. | Disulfide-stabilized peptide disrupts pathogens | MTT assay | HepG-2 | Liver Cancer | IC50 ~ 22 µg/mL |
| dbacp07473 | MzDef | MSSSNCANVCQTENFPGGECKAEGATRKCFCKNC | Zea mays L. | Disulfide-stabilized peptide disrupts pathogens | MTT assay | MCF-7 | Breast Cancer | IC50 = 14.85 µg/mL |
| dbacp07474 | MzDef | MSSSNCANVCQTENFPGGECKAEGATRKCFCKNC | Zea mays L. | Disulfide-stabilized peptide disrupts pathogens | MTT assay | HCT-116 | Colon Cancer | IC50 = 29.85 µg/mL |
| dbacp07477 | (LLKK)4 linear peptide | LLKKLLKKLLKKLLKK | Synthetic | Apoptosis, drug-resistance reversal, tumor suppression | MTT assay | SK-HEP-1 | Liver Cancer | Cell Viability (%) ~ 14.1 ± 0.8 at 30 µg/mL |
| dbacp07478 | (LLKK)4 linear peptide | LLKKLLKKLLKKLLKK | Synthetic | Apoptosis, drug-resistance reversal, tumor suppression | MTT assay | HCT-116 | Colon Cancer | Cell Viability (%) ~ 10.73 ± 2.4 at 30 µg/mL |
| dbacp07479 | (LLKK)4 linear peptide | LLKKLLKKLLKKLLKK | Synthetic | Apoptosis, drug-resistance reversal, tumor suppression | MTT assay | Bcap-37 | Breast Cancer | Cell Viability (%) ~ 15.07 ± 0.5 at 30 µg/mL |
| dbacp07480 | (LLKK)4 linear peptide | LLKKLLKKLLKKLLKK | Synthetic | Apoptosis, drug-resistance reversal, tumor suppression | MTT assay | PC-3 | Prostate Cancer | Cell Viability (%) ~ 17.1 ± 5.0 at 30 µg/mL |
| dbacp07481 | 2-arm branched peptide | [LLKKLLKK]2kC | Synthetic | Apoptosis, drug-resistance reversal, tumor suppression | MTT assay | SK-HEP-1 | Liver Cancer | Cell Viability (%) ~ 85.7 ± 4.3 at 30 µg/mL |
| dbacp07482 | 2-arm branched peptide | [LLKKLLKK]2kC | Synthetic | Apoptosis, drug-resistance reversal, tumor suppression | MTT assay | HCT-116 | Colon Cancer | Cell Viability (%) ~ 78.6 ± 10.5 at 30 µg/mL |
| dbacp07483 | 2-arm branched peptide | [LLKKLLKK]2kC | Synthetic | Apoptosis, drug-resistance reversal, tumor suppression | MTT assay | Bcap-37 | Breast Cancer | Cell Viability (%) ~ 81.8 ± 8.8 at 30 µg/mL |
| dbacp07484 | 2-arm branched peptide | [LLKKLLKK]2kC | Synthetic | Apoptosis, drug-resistance reversal, tumor suppression | MTT assay | PC-3 | Prostate Cancer | Cell Viability (%) ~ 73.5 ± 2.2 at 30 µg/mL |
| dbacp07485 | 4-arm branched peptide | {[LLKKLLKK]2kC}2 | Synthetic | Apoptosis, drug-resistance reversal, tumor suppression | MTT assay | SK-HEP-1 | Liver Cancer | Cell Viability (%) ~ 31.7 ± 5.1 at 30 µg/mL |
| dbacp07486 | 4-arm branched peptide | {[LLKKLLKK]2kC}2 | Synthetic | Apoptosis, drug-resistance reversal, tumor suppression | MTT assay | HCT-116 | Colon Cancer | Cell Viability (%) ~ 67.6 ± 5.8 at 30 µg/mL |
| dbacp07487 | 4-arm branched peptide | {[LLKKLLKK]2kC}2 | Synthetic | Apoptosis, drug-resistance reversal, tumor suppression | MTT assay | Bcap-37 | Breast Cancer | Cell Viability (%) ~ 51.4 ± 4.2 at 30 µg/mL |
| dbacp07488 | 4-arm branched peptide | {[LLKKLLKK]2kC}2 | Synthetic | Apoptosis, drug-resistance reversal, tumor suppression | MTT assay | PC-3 | Prostate Cancer | Cell Viability (%) ~ 49.0 ± 0.8 at 30 µg/mL |
| dbacp07489 | LRH7-G5 | Not Available | Synthetic | GPR1 antagonism, PI3K/AKT inhibition | MTT assay | MDA-MB-231 | Breast Cancer | 60% cell viability at 0.01 μM |
| dbacp07490 | LRH7-G5 | Not Available | Synthetic | GPR1 antagonism, PI3K/AKT inhibition | MTT assay | HCC-1937 | Breast Cancer | 60% cell viability at 0.1 μM |
| dbacp07491 | Figainin 1 | FIGTLIPLALGALTKLFK | Boana raniceps | Membrane disruption, α-helix mediated | MTT assay | MCF-7 | Breast Cancer | IC50 = 13.7 µM |
| dbacp07492 | Figainin 1 | FIGTLIPLALGALTKLFK | Boana raniceps | Membrane disruption, α-helix mediated | MTT assay | HeLa | Cervical Cancer | IC50 = 11.1 µM |
| dbacp07493 | Figainin 1 | FIGTLIPLALGALTKLFK | Boana raniceps | Membrane disruption, α-helix mediated | MTT assay | B16-F10 | Skin Cancer | IC50 = 10.5 µM |
| dbacp07494 | RA-3 | RWrGGGGGLFDIIKKIAESF | Synthetic | Integrin-targeting, α-helix mediated lysis | MTT assay | U87-MG | Brain Tumor | IC50 = 32.27 μM |
| dbacp07495 | RA-3 | RWrGGGGGLFDIIKKIAESF | Synthetic | Integrin-targeting, α-helix mediated lysis | MTT assay | MDA-MB-231 | Breast Cancer | IC50 = 28.4 μM |
| dbacp07496 | RA-3 | RWrGGGGGLFDIIKKIAESF | Synthetic | Integrin-targeting, α-helix mediated lysis | MTT assay | MCF-7 | Breast Cancer | IC50 = 44.14 μM |
| dbacp07497 | HX-12A | FFRKVLKLIRKI | Synthetic derivative of Temporin-Pta | ABCB1 inhibition, MDR reversal, sensitization | MTT assay | KB-C2 | Cervical Cancer | IC50 = 6.45 μM |
| dbacp07498 | HX-12B | FFRKVLKLIRKIF | Synthetic derivative of Temporin-Pta | ABCB1 inhibition, MDR reversal, sensitization | MTT assay | KB-C2 | Cervical Cancer | IC50 = 7.61 μM |
| dbacp07499 | HX-12C | FFRKVLKLIRKIWR | Synthetic derivative of Temporin-Pta | ABCB1 inhibition, MDR reversal, sensitization | MTT assay | KB-C2 | Cervical Cancer | IC50 = 6.06 μM |
| dbacp07500 | Mambalgin-1 | LKCYQHGKVVTCHRDMKFCYHNTGMPFRNLKLILQGCSSSCSETENNKCCSTDRCNK | Dendroaspis polylepsis | ASIC inhibition suppresses cancer proliferation | MTT assay | MCF-7 | Breast Cancer | 22.43% cytotoxicity at 10 µg/mL |
| dbacp07501 | Brevinin-1Ha | FALGAVTCLIRTKCKVLPKLF | Analogue of Brevinin-1H | α-helix enhances antimicrobial, anticancer activity | MTT assay | PC-3 | Prostate Cancer | IC50 = 186.9 µM |
| dbacp07502 | Brevinin-1Ha | FALGAVTCLIRTKCKVLPKLF | Analogue of Brevinin-1H | α-helix enhances antimicrobial, anticancer activity | MTT assay | MDA-MB-435S | Breast Cancer | IC50 = 214.7 µM |
| dbacp07503 | Brevinin-1Ha | FALGAVTCLIRTKCKVLPKLF | Analogue of Brevinin-1H | α-helix enhances antimicrobial, anticancer activity | MTT assay | H-157 | Lung Cancer | IC50 = 278.9 µM |
| dbacp07504 | Brevinin-1Ha | FALGAVTCLIRTKCKVLPKLF | Analogue of Brevinin-1H | α-helix enhances antimicrobial, anticancer activity | MTT assay | HCT-116 | Colon Cancer | IC50 = 342.8 µM |
| dbacp07505 | Brevinin-1HY | FALGAVTKVLYKLFCLITRKC | Analogue of Brevinin-1H | α-helix enhances antimicrobial, anticancer activity | MTT assay | PC-3 | Prostate Cancer | IC50 = 5.425 µM |
| dbacp07506 | Brevinin-1HY | FALGAVTKVLYKLFCLITRKC | Analogue of Brevinin-1H | α-helix enhances antimicrobial, anticancer activity | MTT assay | MDA-MB-435S | Breast Cancer | IC50 = 2.243 µM |
| dbacp07507 | Brevinin-1HY | FALGAVTKVLYKLFCLITRKC | Analogue of Brevinin-1H | α-helix enhances antimicrobial, anticancer activity | MTT assay | H-157 | Lung Cancer | IC50 = 2.811 µM |
| dbacp07508 | Brevinin-1HY | FALGAVTKVLYKLFCLITRKC | Analogue of Brevinin-1H | α-helix enhances antimicrobial, anticancer activity | MTT assay | HCT-116 | Colon Cancer | IC50 = 3.583 µM |
| dbacp07509 | cyclic dipeptide - 2b | WA | Synthetic | Not Available | MTT assay | HeLa | Cervical Cancer | IC50 = 93.1 µM |
| dbacp07510 | cyclic dipeptide - 2b | WA | Synthetic | Not Available | MTT assay | MCF-7 | Breast Cancer | IC50 = 45.6 µM |
| dbacp07511 | YT12 | YFYPKDFTPGCT | Arthrospira platensis | ROS scavenging induces cancer cell death | MTT assay | HT-29 | Colon Cancer | IC50 = 12.5 μM |
| dbacp07512 | Dermaseptin-PP | ALWKDMLKGIGKLAGKAALGAVKTLV | Phyllomedusa palliata | Membrane disruption triggers dual apoptosis | MTT assay | H-157 | Lung Cancer | IC50 = 1.55 μM |
| dbacp07513 | Dermaseptin-PP | ALWKDMLKGIGKLAGKAALGAVKTLV | Phyllomedusa palliata | Membrane disruption triggers dual apoptosis | MTT assay | MCF-7 | Breast Cancer | IC50 = 2.92 μM |
| dbacp07514 | Dermaseptin-PP | ALWKDMLKGIGKLAGKAALGAVKTLV | Phyllomedusa palliata | Membrane disruption triggers dual apoptosis | MTT assay | PC-3 | Prostate Cancer | IC50 = 4.15 μM |
| dbacp07515 | Dermaseptin-PP | ALWKDMLKGIGKLAGKAALGAVKTLV | Phyllomedusa palliata | Membrane disruption triggers dual apoptosis | MTT assay | U-251 | Brain Tumor | IC50 = 2.47 μM |
| dbacp07517 | LL-37 Analogue 2 | LKRIVQRIKDFLR | Synthetic Analog of LL-37 | Helical peptides disrupt cancer membranes | MTT assay | A-549 | Lung Cancer | IC50 = 33.7 µg/mL |
| dbacp07518 | LL-37 Analogue 3 | AKRIVQRIKDFLR | Synthetic Analog of LL-37 | Helical peptides disrupt cancer membranes | MTT assay | A-549 | Lung Cancer | IC50 = 29.8 µg/mL |
| dbacp07519 | LL-37 Analogue 4 | FΚRIVQRILDFLR | Synthetic Analog of LL-37 | Helical peptides disrupt cancer membranes | MTT assay | A-549 | Lung Cancer | IC50 = 3.9 µg/mL |
| dbacp07520 | LL-37 Analogue 5 | FKSARIVQRILDFLR | Synthetic Analog of LL-37 | Helical peptides disrupt cancer membranes | MTT assay | A-549 | Lung Cancer | IC50 = 10.7 µg/mL |
| dbacp07521 | LL-37 Analogue 6 | FKRIVQRIRDFLR | Synthetic Analog of LL-37 | Helical peptides disrupt cancer membranes | MTT assay | A-549 | Lung Cancer | IC50 = 56 µg/mL |
| dbacp07522 | LL-37 Analogue 7 | FKRIVQRIRDFLR | Synthetic Analog of LL-37 | Helical peptides disrupt cancer membranes | MTT assay | A-549 | Lung Cancer | IC50 = 12.5 µg/mL |
| dbacp07523 | LL-37 Analogue 8 | FKRIVQKIKDFLR | Synthetic Analog of LL-37 | Helical peptides disrupt cancer membranes | MTT assay | A-549 | Lung Cancer | IC50 = 145 µg/mL |
| dbacp07524 | LL-37 Analogue 9 | FKRIVQLIKDFLR | Synthetic Analog of LL-37 | Helical peptides disrupt cancer membranes | MTT assay | A-549 | Lung Cancer | IC50 = 18.9 µg/mL |
| dbacp07525 | LL-37 Analogue 10 | FKRIVQLIKDFLR | Synthetic Analog of LL-37 | Helical peptides disrupt cancer membranes | MTT assay | A-549 | Lung Cancer | IC50 = 13.9 µg/mL |
| dbacp07526 | LL-37 Analogue 11 | FKRIVQRIKDLLR | Synthetic Analog of LL-37 | Helical peptides disrupt cancer membranes | MTT assay | A-549 | Lung Cancer | IC50 = 75 µg/mL |
| dbacp07527 | LL-37 Analogue 12 | FKRIVQRIKDLLR | Synthetic Analog of LL-37 | Helical peptides disrupt cancer membranes | MTT assay | A-549 | Lung Cancer | IC50 = 45.5 µg/mL |
| dbacp07528 | LL-37 Analogue 13 | FKRIVQIIKKFLR | Synthetic Analog of LL-37 | Helical peptides disrupt cancer membranes | MTT assay | A-549 | Lung Cancer | IC50 = 20.0 µg/mL |
| dbacp07529 | LL-37 Analogue 14 | FKRIVQIIKKFLR | Synthetic Analog of LL-37 | Helical peptides disrupt cancer membranes | MTT assay | A-549 | Lung Cancer | IC50 = 12.9 µg/mL |
| dbacp07530 | LL-37 Analogue 15 | FKRIVQLLKKLLR | Synthetic Analog of LL-37 | Helical peptides disrupt cancer membranes | MTT assay | A-549 | Lung Cancer | IC50 = 12.8 µg/mL |
| dbacp07531 | LL-37 Analogue 16 | FKRIVQLLKKLLR | Synthetic Analog of LL-37 | Helical peptides disrupt cancer membranes | MTT assay | A-549 | Lung Cancer | IC50 = 9.8 µg/mL |
| dbacp07532 | LL-37 Analogue 17 | FKRILQRIKDFLR | Synthetic Analog of LL-37 | Helical peptides disrupt cancer membranes | MTT assay | A-549 | Lung Cancer | IC50 = 19.2 µg/mL |
| dbacp07533 | LL-37 Analogue 18 | FKRILQRIKDFLR | Synthetic Analog of LL-37 | Helical peptides disrupt cancer membranes | MTT assay | A-549 | Lung Cancer | IC50 = 29.2 µg/mL |
| dbacp07534 | rCT-II | LKCKKLVPLFSKTCPAGKNLCYKMFMVAAPHVPVKRGCIDVCPKSSLLVKYVCCNTDKCN | Naja naja | Apoptosis via intrinsic (mitochondrial) and extrinsic (death receptor) pathways | MTT assay | MCF-7 | Breast Cancer | IC50 = 3.66 µg/mL |
| dbacp07546 | Sur-X | YGRKKRRQRRRKDHRISTFKNWPFLEGCACTPERM | Synthetic | Disrupts XIAP-survivin, induces apoptosis/necroptosis | MTT assay | HCT-116 | Colon Cancer | 20% cell viability at at 20 μM |
| dbacp07547 | Sur-X | YGRKKRRQRRRKDHRISTFKNWPFLEGCACTPERM | Synthetic | Disrupts XIAP-survivin, induces apoptosis/necroptosis | MTT assay | HCT-15 | Colon Cancer | Not Available |
| dbacp07548 | Sur-X | YGRKKRRQRRRKDHRISTFKNWPFLEGCACTPERM | Synthetic | Disrupts XIAP-survivin, induces apoptosis/necroptosis | MTT assay | RKO | Colon Cancer | 25% cell viability at at 20 μM |
| dbacp07549 | Sur-X | YGRKKRRQRRRKDHRISTFKNWPFLEGCACTPERM | Synthetic | Disrupts XIAP-survivin, induces apoptosis/necroptosis | MTT assay | HT-29 | Colon Cancer | Not Available |
| dbacp07550 | NMANF2 | KAIGLVIPEIDGKLDGGAQRV | Staphylococcus hominis strain MANF2 | GAPDH-like protein disrupts survival | MTT assay | A-549 | Lung Cancer | IC50 = 46.6 µg/mL |
| dbacp07551 | NMANF2 | KAIGLVIPEIDGKLDGGAQRV | Staphylococcus hominis strain MANF2 | GAPDH-like protein disrupts survival | MTT assay | HT-29 | Colon Cancer | IC50 = 48.9 µg/mL |
| dbacp07552 | macrocyclic pyridoheptapeptide derivative 1a | Structure given in Scheme 1 | Synthetic | Macrocyclic peptides disrupt cancer growth | MTT assay | MCF-7 | Breast Cancer | IC50 = 15.329 ± 0.672 μM |
| dbacp07553 | macrocyclic pyridoheptapeptide derivative 1a | Structure given in Scheme 1 | Synthetic | Macrocyclic peptides disrupt cancer growth | MTT assay | HepG-2 | Liver Cancer | IC50 = 6.615 ± 0.353 μM |
| dbacp07554 | macrocyclic pyridoheptapeptide derivative 1b | Structure given in Scheme 1 | Synthetic | Macrocyclic peptides disrupt cancer growth | MTT assay | MCF-7 | Breast Cancer | IC50 = 10.904 ± 0.534 μM |
| dbacp07555 | macrocyclic pyridoheptapeptide derivative 1b | Structure given in Scheme 1 | Synthetic | Macrocyclic peptides disrupt cancer growth | MTT assay | HepG-2 | Liver Cancer | IC50 = 8.724 ± 0.474 μM |
| dbacp07556 | macrocyclic pyridoheptapeptide derivative 1c | Structure given in Scheme 1 | Synthetic | Macrocyclic peptides disrupt cancer growth | MTT assay | MCF-7 | Breast Cancer | IC50 = 34.894 ± 1.273 μM |
| dbacp07557 | macrocyclic pyridoheptapeptide derivative 1c | Structure given in Scheme 1 | Synthetic | Macrocyclic peptides disrupt cancer growth | MTT assay | HepG-2 | Liver Cancer | IC50 = 17.011 ± 0.965 μM |
| dbacp07558 | macrocyclic pyridoheptapeptide derivative 2a | Structure given in Scheme 1 | Synthetic | Macrocyclic peptides disrupt cancer growth | MTT assay | HepG-2 | Liver Cancer | IC50 = 17.513 ± 0.876 μM |
| dbacp07559 | macrocyclic pyridoheptapeptide derivative 2b | Structure given in Scheme 1 | Synthetic | Macrocyclic peptides disrupt cancer growth | MTT assay | MCF-7 | Breast Cancer | IC50 = 20.697 ± 0.974 μM |
| dbacp07560 | macrocyclic pyridoheptapeptide derivative 2b | Structure given in Scheme 1 | Synthetic | Macrocyclic peptides disrupt cancer growth | MTT assay | HepG-2 | Liver Cancer | IC50 = 18.681 ± 0.988 μM |
| dbacp07561 | macrocyclic pyridoheptapeptide derivative 2c | Structure given in Scheme 1 | Synthetic | Macrocyclic peptides disrupt cancer growth | MTT assay | MCF-7 | Breast Cancer | IC50 = 24.943 ± 1.082 μM |
| dbacp07562 | macrocyclic pyridoheptapeptide derivative 2c | Structure given in Scheme 1 | Synthetic | Macrocyclic peptides disrupt cancer growth | MTT assay | HepG-2 | Liver Cancer | IC50 = 19.318 ± 1.057 μM |
| dbacp07563 | macrocyclic pyridoheptapeptide derivative 3a | Structure given in Scheme 1 | Synthetic | Macrocyclic peptides disrupt cancer growth | MTT assay | MCF-7 | Breast Cancer | IC50 = 10.316 ± 0.546 μM |
| dbacp07564 | macrocyclic pyridoheptapeptide derivative 3a | Structure given in Scheme 1 | Synthetic | Macrocyclic peptides disrupt cancer growth | MTT assay | HepG-2 | Liver Cancer | IC50 = 8.063 ± 0.863 μM |
| dbacp07565 | macrocyclic pyridoheptapeptide derivative 3b | Structure given in Scheme 1 | Synthetic | Macrocyclic peptides disrupt cancer growth | MTT assay | MCF-7 | Breast Cancer | IC50 = 9.911 ± 0.491 μM |
| dbacp07566 | macrocyclic pyridoheptapeptide derivative 3b | Structure given in Scheme 1 | Synthetic | Macrocyclic peptides disrupt cancer growth | MTT assay | HepG-2 | Liver Cancer | IC50 = 9.66 ± 0.792 μM |
| dbacp07567 | macrocyclic pyridoheptapeptide derivative 3c | Structure given in Scheme 1 | Synthetic | Macrocyclic peptides disrupt cancer growth | MTT assay | MCF-7 | Breast Cancer | IC50 = 22.864 ± 0.992 μM |
| dbacp07568 | macrocyclic pyridoheptapeptide derivative 3c | Structure given in Scheme 1 | Synthetic | Macrocyclic peptides disrupt cancer growth | MTT assay | HepG-2 | Liver Cancer | IC50 = 16.957 ± 1.161 μM |
| dbacp07569 | macrocyclic pyridoheptapeptide derivative 4a | Structure given in Scheme 1 | Synthetic | Macrocyclic peptides disrupt cancer growth | MTT assay | MCF-7 | Breast Cancer | IC50 = 9.304 ± 0.536 μM |
| dbacp07570 | macrocyclic pyridoheptapeptide derivative 4a | Structure given in Scheme 1 | Synthetic | Macrocyclic peptides disrupt cancer growth | MTT assay | HepG-2 | Liver Cancer | IC50 = 7.31 ± 0.595 μM |
| dbacp07571 | macrocyclic pyridoheptapeptide derivative 4b | Structure given in Scheme 1 | Synthetic | Macrocyclic peptides disrupt cancer growth | MTT assay | MCF-7 | Breast Cancer | IC50 = 9.188 ± 0.545 μM |
| dbacp07572 | macrocyclic pyridoheptapeptide derivative 4b | Structure given in Scheme 1 | Synthetic | Macrocyclic peptides disrupt cancer growth | MTT assay | HepG-2 | Liver Cancer | IC50 = 7.166 ± 0.892 μM |
| dbacp07573 | macrocyclic pyridoheptapeptide derivative 4c | Structure given in Scheme 1 | Synthetic | Macrocyclic peptides disrupt cancer growth | MTT assay | MCF-7 | Breast Cancer | IC50 = 19.552 ± 1.032 μM |
| dbacp07574 | macrocyclic pyridoheptapeptide derivative 4c | Structure given in Scheme 1 | Synthetic | Macrocyclic peptides disrupt cancer growth | MTT assay | HepG-2 | Liver Cancer | IC50 = 9.631 ± 0.932 μM |
| dbacp07575 | macrocyclic pyridoheptapeptide derivative 5a | Structure given in Scheme 1 | Synthetic | Macrocyclic peptides disrupt cancer growth | MTT assay | HepG-2 | Liver Cancer | IC50 = 7.117 ± 0.790 μM |
| dbacp07576 | macrocyclic pyridoheptapeptide derivative 5b | Structure given in Scheme 1 | Synthetic | Macrocyclic peptides disrupt cancer growth | MTT assay | HepG-2 | Liver Cancer | IC50 = 7.088 ± 0.784 μM |
| dbacp07577 | macrocyclic pyridoheptapeptide derivative 5c | Structure given in Scheme 1 | Synthetic | Macrocyclic peptides disrupt cancer growth | MTT assay | HepG-2 | Liver Cancer | IC50 = 9.568 ± 1.139 μM |
| dbacp07599 | Tritrp-Agb | V(Agb)(Agb)FPWWWPFL(Agb)(Agb) | Synthetic | Membrane permeabilization via lysine substitution | MTT assay | Jurkat | Blood Cancer | IC50 = 9.6 μM |
| dbacp07600 | Tritrp-hArg | V(hArg)(hArg)FPWWWPFL(hArg)(hArg) | Synthetic | Membrane permeabilization via lysine substitution | MTT assay | Jurkat | Blood Cancer | IC50 = 13.3 μM |
| dbacp07601 | Tritrp-Lys | VKKFPWWWPFLKK | Synthetic | Membrane permeabilization via lysine substitution | MTT assay | Jurkat | Blood Cancer | IC50 = 11.5 μM |
| dbacp07602 | Tritrp-Dap | V(Dap)(Dap)FPWWWPFL(Dap)(Dap) | Synthetic | Membrane permeabilization via lysine substitution | MTT assay | Jurkat | Blood Cancer | IC50 ≥ 65 μM |
| dbacp07603 | Tritrp-Dab | V(Dab)(Dab)FPWWWPFL(Dab)(Dab) | Synthetic | Membrane permeabilization via lysine substitution | MTT assay | Jurkat | Blood Cancer | IC50 ≤ 6.5 μM |
| dbacp07604 | Tritrp-Orn | V(Orn)(Orn)FPWWWPFL(Orn)(Orn) | Synthetic | Membrane permeabilization via lysine substitution | MTT assay | Jurkat | Blood Cancer | IC50 ≤ 6.5 μM |
| dbacp07605 | Tritrp-P59A | VRRFAWWWAFLRR | Synthetic | Membrane permeabilization via lysine substitution | MTT assay | Jurkat | Blood Cancer | IC50 = 12.5 μM |
| dbacp07606 | Tritrp-P59A-Lys | VKKFAWWWAFLKK | Synthetic | Membrane permeabilization via lysine substitution | MTT assay | Jurkat | Blood Cancer | IC50 = 27.6 μM |
| dbacp07607 | Tritrp-P5A | VRRFAWWWPFLRR | Synthetic | Membrane permeabilization via lysine substitution | MTT assay | Jurkat | Blood Cancer | IC50 = 16.2 μM |
| dbacp07608 | Tritrp-P5A-Lys | VKKFAWWWPFLKK | Synthetic | Membrane permeabilization via lysine substitution | MTT assay | Jurkat | Blood Cancer | IC50 = 27.6 μM |
| dbacp07609 | Tritrp-P9A | VRRFPWWWAFLRR | Synthetic | Membrane permeabilization via lysine substitution | MTT assay | Jurkat | Blood Cancer | IC50 = 6.8 μM |
| dbacp07610 | Tritrp-P9A-Lys | VKKFPWWWAFLKK | Synthetic | Membrane permeabilization via lysine substitution | MTT assay | Jurkat | Blood Cancer | IC50 = 15.1 μM |
| dbacp07611 | Tritrp-W678F | VRRFPFFFPFLRR | Synthetic | Membrane permeabilization via lysine substitution | MTT assay | Jurkat | Blood Cancer | IC50 = 24.6 μM |
| dbacp07612 | Tritrp-W678bTA | VRRFP(bTA)(bTA)(bTA)PFLRR | Synthetic | Membrane permeabilization via lysine substitution | MTT assay | Jurkat | Blood Cancer | IC50 = 9.6 μM |
| dbacp07613 | Tritrp-W6hW | VRRFP(hW)WWPFLRR | Synthetic | Membrane permeabilization via lysine substitution | MTT assay | Jurkat | Blood Cancer | IC50 = 16.1 μM |
| dbacp07614 | Tritrp-W7hW | VRRFPW(hW)WPFLRR | Synthetic | Membrane permeabilization via lysine substitution | MTT assay | Jurkat | Blood Cancer | IC50 = 15.1 μM |
| dbacp07615 | Tritrp-W8hW | VRRFPWW(hW)PFLRR | Synthetic | Membrane permeabilization via lysine substitution | MTT assay | Jurkat | Blood Cancer | IC50 = 10.7 μM |
| dbacp07616 | Tritrp-W789hW | VRRFP(hW)(hW)(hW)PFLRR | Synthetic | Membrane permeabilization via lysine substitution | MTT assay | Jurkat | Blood Cancer | IC50 = 44.8 μM |
| dbacp07617 | Tritrp-W6A | VRRFPAWWPFLRR | Synthetic | Membrane permeabilization via lysine substitution | MTT assay | Jurkat | Blood Cancer | IC50 = 36.5 μM |
| dbacp07618 | Tritrp-W7A | VRRFPWAWPFLRR | Synthetic | Membrane permeabilization via lysine substitution | MTT assay | Jurkat | Blood Cancer | IC50 = 48.2 μM |
| dbacp07619 | Tritrp-W8A | VRRFPWWAPFLRR | Synthetic | Membrane permeabilization via lysine substitution | MTT assay | Jurkat | Blood Cancer | IC50 = 22.8 μM |
| dbacp07620 | Tritrp-W67A | VRRFPAAWPFLRR | Synthetic | Membrane permeabilization via lysine substitution | MTT assay | Jurkat | Blood Cancer | IC50 ≥ 65 μM |
| dbacp07621 | Tritrp-W68A | VRRFPAWAPFLRR | Synthetic | Membrane permeabilization via lysine substitution | MTT assay | Jurkat | Blood Cancer | IC50 ≥ 65 μM |
| dbacp07622 | Tritrp-W78A | VRRFPWAAPFLRR | Synthetic | Membrane permeabilization via lysine substitution | MTT assay | Jurkat | Blood Cancer | IC50 ≥ 65 μM |
| dbacp07623 | Tritrp-W678A | VRRFPAAAPFLRR | Synthetic | Membrane permeabilization via lysine substitution | MTT assay | Jurkat | Blood Cancer | IC50 ≥ 65 μM |
| dbacp07624 | Tritrp-W6Y | VRRFPYWWPFLRR | Synthetic | Membrane permeabilization via lysine substitution | MTT assay | Jurkat | Blood Cancer | IC50 = 19.3 μM |
| dbacp07625 | Tritrp-W7Y | VRRFPWYWPFLRR | Synthetic | Membrane permeabilization via lysine substitution | MTT assay | Jurkat | Blood Cancer | IC50 = 11.4 μM |
| dbacp07626 | Tritrp-W8Y | VRRFPWWYPFLRR | Synthetic | Membrane permeabilization via lysine substitution | MTT assay | Jurkat | Blood Cancer | IC50 = 12.0 μM |
| dbacp07627 | Tritrp-W67Y | VRRFPYYWPFLRR | Synthetic | Membrane permeabilization via lysine substitution | MTT assay | Jurkat | Blood Cancer | IC50 = 32.2 μM |
| dbacp07628 | Tritrp-W68Y | VRRFPYWYPFLRR | Synthetic | Membrane permeabilization via lysine substitution | MTT assay | Jurkat | Blood Cancer | IC50 = 35.4 μM |
| dbacp07629 | Tritrp-W78Y | VRRFPWYYPFLRR | Synthetic | Membrane permeabilization via lysine substitution | MTT assay | Jurkat | Blood Cancer | IC50 = 25.6 μM |
| dbacp07630 | Tritrp-W678Y | VRRFPYYYPFLRR | Synthetic | Membrane permeabilization via lysine substitution | MTT assay | Jurkat | Blood Cancer | IC50 ≥ 65 μM |
| dbacp07631 | Tritrp DiSu | CVRRFPWWYPFLRRC | Synthetic | Membrane permeabilization via lysine substitution | MTT assay | Jurkat | Blood Cancer | IC50 = 12.3 μM |
| dbacp07632 | MagaininF5W-Lys | GIGKWLHSAKKFGKAFVGEIMNS | Synthetic | Membrane permeabilization via lysine substitution | MTT assay | Jurkat | Blood Cancer | IC50 = 16.8 μM |
| dbacp07633 | MagaininF5W-Arg | GIGRWLHSARRFGRAFVGEIMNS | Synthetic | Membrane permeabilization via lysine substitution | MTT assay | Jurkat | Blood Cancer | IC50 = 16.8 μM |
| dbacp07634 | PuroA-Arg | FPVTWKWWKWWKG | Synthetic | Membrane permeabilization via lysine substitution | MTT assay | Jurkat | Blood Cancer | IC50 = 10.0 μM |
| dbacp07635 | PuroA-Lys | FPVTWRWWRWWRG | Synthetic | Membrane permeabilization via lysine substitution | MTT assay | Jurkat | Blood Cancer | IC50 = 12.0 μM |
| dbacp07636 | Indolicidin-Lys | ILPWKWPWWPWKK | Synthetic | Membrane permeabilization via lysine substitution | MTT assay | Jurkat | Blood Cancer | IC50 = 9.5 μM |
| dbacp07637 | MPG | GALFLGFLGAAGSTMGAWSQPKKKRKV | Synthetic | Membrane permeabilization via lysine substitution | MTT assay | Jurkat | Blood Cancer | IC50 = 15.8 μM |
| dbacp07638 | branched tetrapeptide Schiff bases derivative 4a | Figure given in Scheme 1 | Synthetic | p53 stabilization and LDHA inhibition | MTT assay | MCF-7 | Breast Cancer | IC50 between 8.12 ± 0.14 to 17.55 ± 0.27 μM |
| dbacp07639 | branched tetrapeptide Schiff bases derivative 4b | Figure given in Scheme 1 | Synthetic | p53 stabilization and LDHA inhibition | MTT assay | MCF-7 | Breast Cancer | IC50 between 8.12 ± 0.14 to 17.55 ± 0.27 μM |
| dbacp07640 | branched tetrapeptide Schiff bases derivative 4c | Figure given in Scheme 1 | Synthetic | p53 stabilization and LDHA inhibition | MTT assay | MCF-7 | Breast Cancer | IC50 between 8.12 ± 0.14 to 17.55 ± 0.27 μM |
| dbacp07641 | branched tetrapeptide Schiff bases derivative 5c | Figure given in Scheme 1 | Synthetic | p53 stabilization and LDHA inhibition | MTT assay | MCF-7 | Breast Cancer | IC50 between 8.12 ± 0.14 to 17.55 ± 0.27 μM |
| dbacp07642 | branched tetrapeptide Schiff bases derivative 5d | Figure given in Scheme 1 | Synthetic | p53 stabilization and LDHA inhibition | MTT assay | MCF-7 | Breast Cancer | IC50 between 8.12 ± 0.14 to 17.55 ± 0.27 μM |
| dbacp07643 | branched tetrapeptide Schiff bases derivative 5e | Figure given in Scheme 1 | Synthetic | p53 stabilization and LDHA inhibition | MTT assay | MCF-7 | Breast Cancer | IC50 between 8.12 ± 0.14 to 17.55 ± 0.27 μM |
| dbacp07644 | Colicin N | HGDNNSKPKPGGNSGNRGNNGDGASAKVGEITITPDNSKPGRYISSNPEYSLLAKLIDAESIKGTEVYTFHTRKGQYVKVTVPDSNIDKMRVDYVNWKGPKYNNKLVKRFVSQFLLFRKEEKEKNEKEALLKASELVSGMGDKLGEYLGVKYKNVAKEVANDIKNFHGRNIRSYNEAMASLNKVLANPKMKVNKSDKDAIVNAWKQVNAKDMANKIGNLGKAFKVADLAIKVEKIREKSIEGYNTGNWGPLLLEVESWIIGGVVAGVAISLFGAVLSFLPISGLAVTALGVIGIMTISYLSSFIDANRVSNINNIISSVIR | Apoptosis via integrin-Akt suppression | MTT assay | H-460 | Lung Cancer | Dose dependent % cell viability resuctuction at 1-15 µM | |
| dbacp07645 | Colicin N | HGDNNSKPKPGGNSGNRGNNGDGASAKVGEITITPDNSKPGRYISSNPEYSLLAKLIDAESIKGTEVYTFHTRKGQYVKVTVPDSNIDKMRVDYVNWKGPKYNNKLVKRFVSQFLLFRKEEKEKNEKEALLKASELVSGMGDKLGEYLGVKYKNVAKEVANDIKNFHGRNIRSYNEAMASLNKVLANPKMKVNKSDKDAIVNAWKQVNAKDMANKIGNLGKAFKVADLAIKVEKIREKSIEGYNTGNWGPLLLEVESWIIGGVVAGVAISLFGAVLSFLPISGLAVTALGVIGIMTISYLSSFIDANRVSNINNIISSVIR | Apoptosis via integrin-Akt suppression | MTT assay | H-292 | Lung Cancer | Dose dependent % cell viability resuctuction at 1-15 µM | |
| dbacp07646 | Colicin N | HGDNNSKPKPGGNSGNRGNNGDGASAKVGEITITPDNSKPGRYISSNPEYSLLAKLIDAESIKGTEVYTFHTRKGQYVKVTVPDSNIDKMRVDYVNWKGPKYNNKLVKRFVSQFLLFRKEEKEKNEKEALLKASELVSGMGDKLGEYLGVKYKNVAKEVANDIKNFHGRNIRSYNEAMASLNKVLANPKMKVNKSDKDAIVNAWKQVNAKDMANKIGNLGKAFKVADLAIKVEKIREKSIEGYNTGNWGPLLLEVESWIIGGVVAGVAISLFGAVLSFLPISGLAVTALGVIGIMTISYLSSFIDANRVSNINNIISSVIR | Apoptosis via integrin-Akt suppression | MTT assay | NCI-H23 | Lung Cancer | Dose dependent % cell viability resuctuction at 1-15 µM | |
| dbacp07647 | AP1-Z1 | FLFSLIPHAISGLISAFK | AcrAP1 from the venom of the Arabian scorpion | Charge–hydrophobicity balance drives apoptosis | MTT assay | MCF-7 | Breast Cancer | IC50 = 7.222 μM |
| dbacp07648 | AP1-Z1 | FLFSLIPHAISGLISAFK | AcrAP1 from the venom of the Arabian scorpion | Charge–hydrophobicity balance drives apoptosis | MTT assay | A-375 | Skin Cancer | IC50 = 9.478 μM |
| dbacp07649 | AP1-Z1 | FLFSLIPHAISGLISAFK | AcrAP1 from the venom of the Arabian scorpion | Charge–hydrophobicity balance drives apoptosis | MTT assay | U-87 | Brain Tumor | IC50 = 10.21 μM |
| dbacp07650 | AP1-Z5a | FLFKLIPKAIKGLIKAFK | Mutant of APR-Z1 | Charge–hydrophobicity balance drives apoptosis | MTT assay | MCF-7 | Breast Cancer | Graph Figure 2A |
| dbacp07651 | AP1-Z5a | FLFKLIPKAIKGLIKAFK | Mutant of APR-Z1 | Charge–hydrophobicity balance drives apoptosis | MTT assay | A-375 | Skin Cancer | Graph Figure 2B |
| dbacp07652 | AP1-Z5a | FLFKLIPKAIKGLIKAFK | Mutant of APR-Z1 | Charge–hydrophobicity balance drives apoptosis | MTT assay | U-87 | Brain Tumor | Graph Figure 2C |
| dbacp07653 | AP1-Z5b | FLFKLIKHAIKGLIKAFK | Mutant of APR-Z1 | Charge–hydrophobicity balance drives apoptosis | MTT assay | MCF-7 | Breast Cancer | IC50 = 1.037 μM |
| dbacp07654 | AP1-Z5b | FLFKLIKHAIKGLIKAFK | Mutant of APR-Z1 | Charge–hydrophobicity balance drives apoptosis | MTT assay | A-375 | Skin Cancer | IC50 = 2.607 μM |
| dbacp07655 | AP1-Z5b | FLFKLIKHAIKGLIKAFK | Mutant of APR-Z1 | Charge–hydrophobicity balance drives apoptosis | MTT assay | U-87 | Brain Tumor | IC50 = 3.115 μM |
| dbacp07656 | AP1-Z3a | FLFSLIKHAIKGLISAFK | Mutant of APR-Z1 | Charge–hydrophobicity balance drives apoptosis | MTT assay | MCF-7 | Breast Cancer | Graph Figure 2A |
| dbacp07657 | AP1-Z3a | FLFSLIKHAIKGLISAFK | Mutant of APR-Z1 | Charge–hydrophobicity balance drives apoptosis | MTT assay | A-375 | Skin Cancer | Graph Figure 2B |
| dbacp07658 | AP1-Z3a | FLFSLIKHAIKGLISAFK | Mutant of APR-Z1 | Charge–hydrophobicity balance drives apoptosis | MTT assay | U-87 | Brain Tumor | Graph Figure 2C |
| dbacp07659 | AP1-Z3b | FLFSLIKHAISKLISAFK | Mutant of APR-Z1 | Charge–hydrophobicity balance drives apoptosis | MTT assay | MCF-7 | Breast Cancer | Graph Figure 2A |
| dbacp07660 | AP1-Z3b | FLFSLIKHAISKLISAFK | Mutant of APR-Z1 | Charge–hydrophobicity balance drives apoptosis | MTT assay | A-375 | Skin Cancer | Graph Figure 2B |
| dbacp07661 | AP1-Z3b | FLFSLIKHAISKLISAFK | Mutant of APR-Z1 | Charge–hydrophobicity balance drives apoptosis | MTT assay | U-87 | Brain Tumor | Graph Figure 2C |
| dbacp07662 | AP1-Z7 | FLFKLIKKAIKKLIKAFK | Mutant of APR-Z1 | Charge–hydrophobicity balance drives apoptosis | MTT assay | MCF-7 | Breast Cancer | Graph Figure 2A |
| dbacp07663 | AP1-Z7 | FLFKLIKKAIKKLIKAFK | Mutant of APR-Z1 | Charge–hydrophobicity balance drives apoptosis | MTT assay | A-375 | Skin Cancer | Graph Figure 2B |
| dbacp07664 | AP1-Z7 | FLFKLIKKAIKKLIKAFK | Mutant of APR-Z1 | Charge–hydrophobicity balance drives apoptosis | MTT assay | U-87 | Brain Tumor | Graph Figure 2C |
| dbacp07665 | AP1-Z9 | FLFKLIKKKIKKLIKKFK | Mutant of APR-Z1 | Charge–hydrophobicity balance drives apoptosis | MTT assay | MCF-7 | Breast Cancer | Graph Figure 2A |
| dbacp07666 | AP1-Z9 | FLFKLIKKKIKKLIKKFK | Mutant of APR-Z1 | Charge–hydrophobicity balance drives apoptosis | MTT assay | A-375 | Skin Cancer | Graph Figure 2B |
| dbacp07667 | AP1-Z9 | FLFKLIKKKIKKLIKKFK | Mutant of APR-Z1 | Charge–hydrophobicity balance drives apoptosis | MTT assay | U-87 | Brain Tumor | Graph Figure 2C |
| dbacp07668 | Longicalycinin A linear analogue 1 | GYPFV | Synthetic Analogue of Longicalycinin A | Cyclization enhances apoptosis via lysosomes | MTT assay | HepG-2 | Liver Cancer | IC50 = 9.66 ± 0.0007 µg/ml |
| dbacp07669 | Longicalycinin A linear analogue 1 | GYPFV | Synthetic Analogue of Longicalycinin A | Cyclization enhances apoptosis via lysosomes | MTT assay | HT-29 | Colorectal Cancer | IC50 = 10.45 ± 0.0042 µg/ml |
| dbacp07670 | Longicalycinin A linear analogue 1 | GYPFV | Synthetic Analogue of Longicalycinin A | Cyclization enhances apoptosis via lysosomes | MTT assay | HepG-2 | Liver Cancer | 13.29% Cell death at 100 µg/ml |
| dbacp07671 | Longicalycinin A linear analogue 1 | GYPFV | Synthetic Analogue of Longicalycinin A | Cyclization enhances apoptosis via lysosomes | MTT assay | HT-29 | Colorectal Cancer | 83.02% Cell death at 100 µg/ml |
| dbacp07672 | Longicalycinin A Cyclic analogue 1 | GYPFV | Synthetic Analogue of Longicalycinin A | Cyclization enhances apoptosis via lysosomes | MTT assay | HepG-2 | Liver Cancer | IC50 = 10.2 ± 0.007 µg/ml |
| dbacp07673 | Longicalycinin A Cyclic analogue 1 | GYPFV | Synthetic Analogue of Longicalycinin A | Cyclization enhances apoptosis via lysosomes | MTT assay | HT-29 | Colorectal Cancer | IC50 = 11.4 ± 0.0028 µg/ml |
| dbacp07674 | Longicalycinin A Cyclic analogue 1 | GYPFV | Synthetic Analogue of Longicalycinin A | Cyclization enhances apoptosis via lysosomes | MTT assay | HepG-2 | Liver Cancer | 69.73% Cell death at 100 µg/ml |
| dbacp07675 | Longicalycinin A Cyclic analogue 1 | GYPFV | Synthetic Analogue of Longicalycinin A | Cyclization enhances apoptosis via lysosomes | MTT assay | HT-29 | Colorectal Cancer | 71.5% Cell death at 100 µg/ml |
| dbacp07676 | Longicalycinin A linear analogue 2 | LYPFA | Synthetic Analogue of Longicalycinin A | Cyclization enhances apoptosis via lysosomes | MTT assay | HepG-2 | Liver Cancer | IC50 = 8.76 ± 0.0035 µg/ml |
| dbacp07677 | Longicalycinin A linear analogue 2 | LYPFA | Synthetic Analogue of Longicalycinin A | Cyclization enhances apoptosis via lysosomes | MTT assay | HT-29 | Colorectal Cancer | IC50 = 12.33 ± 0 µg/ml |
| dbacp07678 | Longicalycinin A linear analogue 2 | LYPFA | Synthetic Analogue of Longicalycinin A | Cyclization enhances apoptosis via lysosomes | MTT assay | HepG-2 | Liver Cancer | 71.37% Cell death at 100 µg/ml |
| dbacp07679 | Longicalycinin A linear analogue 2 | LYPFA | Synthetic Analogue of Longicalycinin A | Cyclization enhances apoptosis via lysosomes | MTT assay | HT-29 | Colorectal Cancer | 88.47% Cell death at 100 µg/ml |
| dbacp07680 | Longicalycinin A | FYPFG | Dianthus superbus | Cyclization enhances apoptosis via lysosomes | MTT assay | HepG-2 | Liver Cancer | IC50 = 13.52 µg/ml |
| dbacp07681 | Longicalycinin A | FYPFG | Dianthus superbus | Cyclization enhances apoptosis via lysosomes | MTT assay | DLA cell line | Lung Cancer | CTC50 = 2.62 µM |
| dbacp07682 | Longicalycinin A | FYPFG | Dianthus superbus | Cyclization enhances apoptosis via lysosomes | MTT assay | EAC cell Line | Breast Cancer | CTC50 = 6.17 µM |
| dbacp07683 | Longicalycinin A | FYPFG | Synthetic | Cyclization enhances apoptosis via lysosomes | MTT assay | HepG-2 | Liver Cancer | IC50 = 10.45 ± 0.0042 µg/ml |
| dbacp07684 | Longicalycinin A | FYPFG | Synthetic | Cyclization enhances apoptosis via lysosomes | MTT assay | HT-29 | Colorectal Cancer | IC50 = 11.87 ± 0.0021 µg/ml |
| dbacp07685 | Longicalycinin A (Linear) | FYPFG | Synthetic | Cyclization enhances apoptosis via lysosomes | MTT assay | HepG-2 | Liver Cancer | IC50 = 9.18 ± 0.0014 µg/ml |
| dbacp07686 | Longicalycinin A (Linear) | FYPFG | Synthetic | Cyclization enhances apoptosis via lysosomes | MTT assay | HT-29 | Colorectal Cancer | IC50 = 9.61 ± 0.0007 µg/ml |
| dbacp07687 | Longicalycinin A linear analogue 14 | PYFFL | Synthetic Analogue of Longicalycinin A | Cyclization enhances apoptosis via lysosomes | MTT assay | HepG-2 | Liver Cancer | IC50 = 9.67 ± 0.0007 µg/ml |
| dbacp07688 | Longicalycinin A linear analogue 14 | PYFFL | Synthetic Analogue of Longicalycinin A | Cyclization enhances apoptosis via lysosomes | MTT assay | HT-29 | Colorectal Cancer | IC50 = 9.12 ± 0.0042 µg/ml |
| dbacp07689 | Longicalycinin A linear analogue 14 | PYFFL | Synthetic Analogue of Longicalycinin A | Cyclization enhances apoptosis via lysosomes | MTT assay | HepG-2 | Liver Cancer | 13.02% Cell death at 100 µg/ml |
| dbacp07690 | Longicalycinin A linear analogue 14 | PYFFL | Synthetic Analogue of Longicalycinin A | Cyclization enhances apoptosis via lysosomes | MTT assay | HT-29 | Colorectal Cancer | 82.36% Cell death at 100 µg/ml |
| dbacp07691 | Longicalycinin A cyclic analogue 14 | PYFFL | Synthetic Analogue of Longicalycinin A | Cyclization enhances apoptosis via lysosomes | MTT assay | HepG-2 | Liver Cancer | IC50 = 10.46 ± 0.0028 µg/ml |
| dbacp07692 | Longicalycinin A cyclic analogue 14 | PYFFL | Synthetic Analogue of Longicalycinin A | Cyclization enhances apoptosis via lysosomes | MTT assay | HT-29 | Colorectal Cancer | IC50 = 10.92 ± 0.0021 µg/ml |
| dbacp07693 | Longicalycinin A cyclic analogue 14 | PYFFL | Synthetic Analogue of Longicalycinin A | Cyclization enhances apoptosis via lysosomes | MTT assay | HepG-2 | Liver Cancer | 70.69% Cell death at 100 µg/ml |
| dbacp07694 | Longicalycinin A cyclic analogue 14 | PYFFL | Synthetic Analogue of Longicalycinin A | Cyclization enhances apoptosis via lysosomes | MTT assay | HT-29 | Colorectal Cancer | 52.38% Cell death at 100 µg/ml |
| dbacp07695 | Longicalycinin A linear analogue 3 | GYPFA | Synthetic Analogue of Longicalycinin A | Cyclization enhances apoptosis via lysosomes | MTT assay | HepG-2 | Liver Cancer | IC50 = 9.77 ± 0.0007 µg/ml |
| dbacp07696 | Longicalycinin A linear analogue 3 | GYPFA | Synthetic Analogue of Longicalycinin A | Cyclization enhances apoptosis via lysosomes | MTT assay | HT-29 | Colorectal Cancer | IC50 = 11.4 ± 0 µg/ml |
| dbacp07697 | Longicalycinin A linear analogue 3 | GYPFA | Synthetic Analogue of Longicalycinin A | Cyclization enhances apoptosis via lysosomes | MTT assay | HepG-2 | Liver Cancer | 82.33% Cell death at 100 µg/ml |
| dbacp07698 | Longicalycinin A linear analogue 3 | GYPFA | Synthetic Analogue of Longicalycinin A | Cyclization enhances apoptosis via lysosomes | MTT assay | HT-29 | Colorectal Cancer | 87.56% Cell death at 100 µg/ml |
| dbacp07699 | Longicalycinin A cyclic analogue 3 | GYPFA | Synthetic Analogue of Longicalycinin A | Cyclization enhances apoptosis via lysosomes | MTT assay | HepG-2 | Liver Cancer | IC50 = 9.5 ± 0.0056 µg/ml |
| dbacp07700 | Longicalycinin A cyclic analogue 3 | GYPFA | Synthetic Analogue of Longicalycinin A | Cyclization enhances apoptosis via lysosomes | MTT assay | HT-29 | Colorectal Cancer | IC50 = 11.28 ± 0.0063 µg/ml |
| dbacp07701 | Longicalycinin A cyclic analogue 3 | GYPFA | Synthetic Analogue of Longicalycinin A | Cyclization enhances apoptosis via lysosomes | MTT assay | HepG-2 | Liver Cancer | 56.72% Cell death at 100 µg/ml |
| dbacp07702 | Longicalycinin A cyclic analogue 3 | GYPFA | Synthetic Analogue of Longicalycinin A | Cyclization enhances apoptosis via lysosomes | MTT assay | HT-29 | Colorectal Cancer | 28.51% Cell death at 100 µg/ml |
| dbacp07703 | Longicalycinin A linear analogue 4 | AYPFG | Synthetic Analogue of Longicalycinin A | Cyclization enhances apoptosis via lysosomes | MTT assay | HepG-2 | Liver Cancer | IC50 = 9.53 ± 0.0014 µg/ml |
| dbacp07704 | Longicalycinin A linear analogue 4 | AYPFG | Synthetic Analogue of Longicalycinin A | Cyclization enhances apoptosis via lysosomes | MTT assay | HT-29 | Colorectal Cancer | IC50 = 10.78 ± 0.0021 µg/ml |
| dbacp07705 | Longicalycinin A linear analogue 4 | AYPFG | Synthetic Analogue of Longicalycinin A | Cyclization enhances apoptosis via lysosomes | MTT assay | HepG-2 | Liver Cancer | 27.13% Cell death at 100 µg/ml |
| dbacp07706 | Longicalycinin A linear analogue 4 | AYPFG | Synthetic Analogue of Longicalycinin A | Cyclization enhances apoptosis via lysosomes | MTT assay | HT-29 | Colorectal Cancer | 75.91% Cell death at 100 µg/ml |
| dbacp07707 | Longicalycinin A cyclic analogue 4 | AYPFG | Synthetic Analogue of Longicalycinin A | Cyclization enhances apoptosis via lysosomes | MTT assay | HepG-2 | Liver Cancer | IC50 = 9.77 ± 0.007 µg/ml |
| dbacp07708 | Longicalycinin A cyclic analogue 4 | AYPFG | Synthetic Analogue of Longicalycinin A | Cyclization enhances apoptosis via lysosomes | MTT assay | HT-29 | Colorectal Cancer | IC50 = 11.33 ± 0.0035 µg/ml |
| dbacp07709 | Longicalycinin A cyclic analogue 4 | AYPFG | Synthetic Analogue of Longicalycinin A | Cyclization enhances apoptosis via lysosomes | MTT assay | HepG-2 | Liver Cancer | 71.1% Cell death at 100 µg/ml |
| dbacp07710 | Longicalycinin A cyclic analogue 4 | AYPFG | Synthetic Analogue of Longicalycinin A | Cyclization enhances apoptosis via lysosomes | MTT assay | HT-29 | Colorectal Cancer | 52.49% Cell death at 100 µg/ml |
| dbacp07711 | Longicalycinin A linear analogue 5 | FSPFG | Synthetic Analogue of Longicalycinin A | Cyclization enhances apoptosis via lysosomes | MTT assay | HepG-2 | Liver Cancer | IC50 = 8.99 ± 0.0014 µg/ml |
| dbacp07712 | Longicalycinin A linear analogue 5 | FSPFG | Synthetic Analogue of Longicalycinin A | Cyclization enhances apoptosis via lysosomes | MTT assay | HT-29 | Colorectal Cancer | IC50 = 10.97 ± 0.0049 µg/ml |
| dbacp07713 | Longicalycinin A linear analogue 5 | FSPFG | Synthetic Analogue of Longicalycinin A | Cyclization enhances apoptosis via lysosomes | MTT assay | HepG-2 | Liver Cancer | 76.72% Cell death at 100 µg/ml |
| dbacp07714 | Longicalycinin A linear analogue 5 | FSPFG | Synthetic Analogue of Longicalycinin A | Cyclization enhances apoptosis via lysosomes | MTT assay | HT-29 | Colorectal Cancer | 91.52% Cell death at 100 µg/ml |
| dbacp07715 | Longicalycinin A cyclic analogue 5 | FSPFG | Synthetic Analogue of Longicalycinin A | Cyclization enhances apoptosis via lysosomes | MTT assay | HepG-2 | Liver Cancer | IC50 = 9.45 ± 0.0056 µg/ml |
| dbacp07716 | Longicalycinin A cyclic analogue 5 | FSPFG | Synthetic Analogue of Longicalycinin A | Cyclization enhances apoptosis via lysosomes | MTT assay | HT-29 | Colorectal Cancer | IC50 = 9.98 ± 0.4256 µg/ml |
| dbacp07717 | Longicalycinin A cyclic analogue 5 | FSPFG | Synthetic Analogue of Longicalycinin A | Cyclization enhances apoptosis via lysosomes | MTT assay | HepG-2 | Liver Cancer | 41.37% Cell death at 100 µg/ml |
| dbacp07718 | Longicalycinin A cyclic analogue 5 | FSPFG | Synthetic Analogue of Longicalycinin A | Cyclization enhances apoptosis via lysosomes | MTT assay | HT-29 | Colorectal Cancer | 97.74% Cell death at 100 µg/ml |
| dbacp07719 | Longicalycinin A linear analogue 6 | VYPIA | Synthetic Analogue of Longicalycinin A | Cyclization enhances apoptosis via lysosomes | MTT assay | HepG-2 | Liver Cancer | IC50 = 10.98 ± 0.0014 µg/ml |
| dbacp07720 | Longicalycinin A linear analogue 6 | VYPIA | Synthetic Analogue of Longicalycinin A | Cyclization enhances apoptosis via lysosomes | MTT assay | HT-29 | Colorectal Cancer | IC50 = 12.31 ± 0.0063 µg/ml |
| dbacp07721 | Longicalycinin A linear analogue 6 | VYPIA | Synthetic Analogue of Longicalycinin A | Cyclization enhances apoptosis via lysosomes | MTT assay | HepG-2 | Liver Cancer | 38.64% Cell death at 100 µg/ml |
| dbacp07722 | Longicalycinin A linear analogue 6 | VYPIA | Synthetic Analogue of Longicalycinin A | Cyclization enhances apoptosis via lysosomes | MTT assay | HT-29 | Colorectal Cancer | 49.33% Cell death at 100 µg/ml |
| dbacp07723 | Longicalycinin A cyclic analogue 6 | VYPIA | Synthetic Analogue of Longicalycinin A | Cyclization enhances apoptosis via lysosomes | MTT assay | HepG-2 | Liver Cancer | IC50 = 17.34 ± 0.0014 µg/ml |
| dbacp07724 | Longicalycinin A cyclic analogue 6 | VYPIA | Synthetic Analogue of Longicalycinin A | Cyclization enhances apoptosis via lysosomes | MTT assay | HT-29 | Colorectal Cancer | IC50 = 10.2 ± 0.0021 µg/ml |
| dbacp07725 | Longicalycinin A cyclic analogue 6 | VYPIA | Synthetic Analogue of Longicalycinin A | Cyclization enhances apoptosis via lysosomes | MTT assay | HepG-2 | Liver Cancer | 51.79% Cell death at 100 µg/ml |
| dbacp07726 | Longicalycinin A cyclic analogue 6 | VYPIA | Synthetic Analogue of Longicalycinin A | Cyclization enhances apoptosis via lysosomes | MTT assay | HT-29 | Colorectal Cancer | 27.61% Cell death at 100 µg/ml |
| dbacp07727 | Longicalycinin A linear analogue 7 | PYVFA | Synthetic Analogue of Longicalycinin A | Cyclization enhances apoptosis via lysosomes | MTT assay | HepG-2 | Liver Cancer | IC50 = 9.6 ± 0.0007 µg/ml |
| dbacp07728 | Longicalycinin A linear analogue 7 | PYVFA | Synthetic Analogue of Longicalycinin A | Cyclization enhances apoptosis via lysosomes | MTT assay | HT-29 | Colorectal Cancer | IC50 = 9.78 ± 0.0212 µg/ml |
| dbacp07729 | Longicalycinin A linear analogue 7 | PYVFA | Synthetic Analogue of Longicalycinin A | Cyclization enhances apoptosis via lysosomes | MTT assay | HepG-2 | Liver Cancer | 82.33% Cell death at 100 µg/ml |
| dbacp07730 | Longicalycinin A linear analogue 7 | PYVFA | Synthetic Analogue of Longicalycinin A | Cyclization enhances apoptosis via lysosomes | MTT assay | HT-29 | Colorectal Cancer | 84.17% Cell death at 100 µg/ml |
| dbacp07731 | Longicalycinin A cyclic analogue 7 | PYVFA | Synthetic Analogue of Longicalycinin A | Cyclization enhances apoptosis via lysosomes | MTT assay | HepG-2 | Liver Cancer | IC50 = 9.21 ± 0.0056 µg/ml |
| dbacp07732 | Longicalycinin A cyclic analogue 7 | PYVFA | Synthetic Analogue of Longicalycinin A | Cyclization enhances apoptosis via lysosomes | MTT assay | HT-29 | Colorectal Cancer | IC50 = 12.11 ± 0.0035 µg/ml |
| dbacp07733 | Longicalycinin A cyclic analogue 7 | PYVFA | Synthetic Analogue of Longicalycinin A | Cyclization enhances apoptosis via lysosomes | MTT assay | HepG-2 | Liver Cancer | 47.68% Cell death at 100 µg/ml |
| dbacp07734 | Longicalycinin A cyclic analogue 7 | PYVFA | Synthetic Analogue of Longicalycinin A | Cyclization enhances apoptosis via lysosomes | MTT assay | HT-29 | Colorectal Cancer | 22.86% Cell death at 100 µg/ml |
| dbacp07735 | Longicalycinin A linear analogue 8 | FYPVG | Synthetic Analogue of Longicalycinin A | Cyclization enhances apoptosis via lysosomes | MTT assay | HepG-2 | Liver Cancer | IC50 = 10.35 ± 0.0014 µg/ml |
| dbacp07736 | Longicalycinin A linear analogue 8 | FYPVG | Synthetic Analogue of Longicalycinin A | Cyclization enhances apoptosis via lysosomes | MTT assay | HT-29 | Colorectal Cancer | IC50 = 12.88 ± 0.0014 µg/ml |
| dbacp07737 | Longicalycinin A linear analogue 8 | FYPVG | Synthetic Analogue of Longicalycinin A | Cyclization enhances apoptosis via lysosomes | MTT assay | HepG-2 | Liver Cancer | 15.35% Cell death at 100 µg/ml |
| dbacp07738 | Longicalycinin A linear analogue 8 | FYPVG | Synthetic Analogue of Longicalycinin A | Cyclization enhances apoptosis via lysosomes | MTT assay | HT-29 | Colorectal Cancer | 88.01% Cell death at 100 µg/ml |
| dbacp07739 | Longicalycinin A cyclic analogue 8 | FYPVG | Synthetic Analogue of Longicalycinin A | Cyclization enhances apoptosis via lysosomes | MTT assay | HepG-2 | Liver Cancer | IC50 = 9.12 ± 0.0007 µg/ml |
| dbacp07740 | Longicalycinin A cyclic analogue 8 | FYPVG | Synthetic Analogue of Longicalycinin A | Cyclization enhances apoptosis via lysosomes | MTT assay | HT-29 | Colorectal Cancer | IC50 = 12.67 ± 0.0028 µg/ml |
| dbacp07741 | Longicalycinin A cyclic analogue 8 | FYPVG | Synthetic Analogue of Longicalycinin A | Cyclization enhances apoptosis via lysosomes | MTT assay | HepG-2 | Liver Cancer | 36.85% Cell death at 100 µg/ml |
| dbacp07742 | Longicalycinin A cyclic analogue 8 | FYPVG | Synthetic Analogue of Longicalycinin A | Cyclization enhances apoptosis via lysosomes | MTT assay | HT-29 | Colorectal Cancer | 29.87% Cell death at 100 µg/ml |
| dbacp07743 | Longicalycinin A linear analogue 9 | FYPFV | Synthetic Analogue of Longicalycinin A | Cyclization enhances apoptosis via lysosomes | MTT assay | HepG-2 | Liver Cancer | IC50 = 9.33 ± 0.0007 µg/ml |
| dbacp07744 | Longicalycinin A linear analogue 9 | FYPFV | Synthetic Analogue of Longicalycinin A | Cyclization enhances apoptosis via lysosomes | MTT assay | HT-29 | Colorectal Cancer | IC50 = 10.44 ± 0.5536 µg/ml |
| dbacp07745 | Longicalycinin A linear analogue 9 | FYPFV | Synthetic Analogue of Longicalycinin A | Cyclization enhances apoptosis via lysosomes | MTT assay | HepG-2 | Liver Cancer | 72.74% Cell death at 100 µg/ml |
| dbacp07746 | Longicalycinin A linear analogue 9 | FYPFV | Synthetic Analogue of Longicalycinin A | Cyclization enhances apoptosis via lysosomes | MTT assay | HT-29 | Colorectal Cancer | 1.59% Cell death at 100 µg/ml |
| dbacp07747 | Longicalycinin A cyclic analogue 9 | FYPFV | Synthetic Analogue of Longicalycinin A | Cyclization enhances apoptosis via lysosomes | MTT assay | HepG-2 | Liver Cancer | IC50 = 10.67 ± 0 µg/ml |
| dbacp07748 | Longicalycinin A cyclic analogue 9 | FYPFV | Synthetic Analogue of Longicalycinin A | Cyclization enhances apoptosis via lysosomes | MTT assay | HT-29 | Colorectal Cancer | IC50 = 10.7 ± 0.0056 µg/ml |
| dbacp07749 | Longicalycinin A cyclic analogue 9 | FYPFV | Synthetic Analogue of Longicalycinin A | Cyclization enhances apoptosis via lysosomes | MTT assay | HepG-2 | Liver Cancer | 73.98% Cell death at 100 µg/ml |
| dbacp07750 | Longicalycinin A cyclic analogue 9 | FYPFV | Synthetic Analogue of Longicalycinin A | Cyclization enhances apoptosis via lysosomes | MTT assay | HT-29 | Colorectal Cancer | 76.25% Cell death at 100 µg/ml |
| dbacp07751 | Longicalycinin A linear analogue 10 | FYPFA | Synthetic Analogue of Longicalycinin A | Cyclization enhances apoptosis via lysosomes | MTT assay | HepG-2 | Liver Cancer | IC50 = 10.5 ± 0.0014 µg/ml |
| dbacp07752 | Longicalycinin A linear analogue 10 | FYPFA | Synthetic Analogue of Longicalycinin A | Cyclization enhances apoptosis via lysosomes | MTT assay | HT-29 | Colorectal Cancer | IC50 = 10.5 ± 0.0007 µg/ml |
| dbacp07753 | Longicalycinin A linear analogue 10 | FYPFA | Synthetic Analogue of Longicalycinin A | Cyclization enhances apoptosis via lysosomes | MTT assay | HepG-2 | Liver Cancer | 76.72% Cell death at 100 µg/ml |
| dbacp07754 | Longicalycinin A linear analogue 10 | FYPFA | Synthetic Analogue of Longicalycinin A | Cyclization enhances apoptosis via lysosomes | MTT assay | HT-29 | Colorectal Cancer | 92.09% Cell death at 100 µg/ml |
| dbacp07755 | Longicalycinin A cyclic analogue 10 | FYPFA | Synthetic Analogue of Longicalycinin A | Cyclization enhances apoptosis via lysosomes | MTT assay | HepG-2 | Liver Cancer | IC50 = 10.28 ± 0 µg/ml |
| dbacp07756 | Longicalycinin A cyclic analogue 10 | FYPFA | Synthetic Analogue of Longicalycinin A | Cyclization enhances apoptosis via lysosomes | MTT assay | HT-29 | Colorectal Cancer | IC50 = 11.56 ± 0.0028 µg/ml |
| dbacp07757 | Longicalycinin A cyclic analogue 10 | FYPFA | Synthetic Analogue of Longicalycinin A | Cyclization enhances apoptosis via lysosomes | MTT assay | HepG-2 | Liver Cancer | 72.06% Cell death at 100 µg/ml |
| dbacp07758 | Longicalycinin A cyclic analogue 10 | FYPFA | Synthetic Analogue of Longicalycinin A | Cyclization enhances apoptosis via lysosomes | MTT assay | HT-29 | Colorectal Cancer | 71.27% Cell death at 100 µg/ml |
| dbacp07759 | Longicalycinin A linear analogue 11 | TVPFA | Synthetic Analogue of Longicalycinin A | Cyclization enhances apoptosis via lysosomes | MTT assay | HepG-2 | Liver Cancer | IC50 = 9.56 ± 0.0021 µg/ml |
| dbacp07760 | Longicalycinin A linear analogue 11 | TVPFA | Synthetic Analogue of Longicalycinin A | Cyclization enhances apoptosis via lysosomes | MTT assay | HT-29 | Colorectal Cancer | IC50 = 11.67 ± 0.0014 µg/ml |
| dbacp07761 | Longicalycinin A linear analogue 11 | TVPFA | Synthetic Analogue of Longicalycinin A | Cyclization enhances apoptosis via lysosomes | MTT assay | HepG-2 | Liver Cancer | 70.28% Cell death at 100 µg/ml |
| dbacp07762 | Longicalycinin A linear analogue 11 | TVPFA | Synthetic Analogue of Longicalycinin A | Cyclization enhances apoptosis via lysosomes | MTT assay | HT-29 | Colorectal Cancer | 88.47% Cell death at 100 µg/ml |
| dbacp07763 | Longicalycinin A cyclic analogue 11 | TVPFA | Synthetic Analogue of Longicalycinin A | Cyclization enhances apoptosis via lysosomes | MTT assay | HepG-2 | Liver Cancer | IC50 = 10.36 ± 0 µg/ml |
| dbacp07764 | Longicalycinin A cyclic analogue 11 | TVPFA | Synthetic Analogue of Longicalycinin A | Cyclization enhances apoptosis via lysosomes | MTT assay | HT-29 | Colorectal Cancer | IC50 = 10.61 ± 0.0007 µg/ml |
| dbacp07765 | Longicalycinin A cyclic analogue 11 | TVPFA | Synthetic Analogue of Longicalycinin A | Cyclization enhances apoptosis via lysosomes | MTT assay | HepG-2 | Liver Cancer | 72.06% Cell death at 100 µg/ml |
| dbacp07766 | Longicalycinin A cyclic analogue 11 | TVPFA | Synthetic Analogue of Longicalycinin A | Cyclization enhances apoptosis via lysosomes | MTT assay | HT-29 | Colorectal Cancer | 74.89% Cell death at 100 µg/ml |
| dbacp07767 | Longicalycinin A linear analogue 12 | FYPFI | Synthetic Analogue of Longicalycinin A | Cyclization enhances apoptosis via lysosomes | MTT assay | HepG-2 | Liver Cancer | IC50 = 11.32 ± 0.0014 µg/ml |
| dbacp07768 | Longicalycinin A linear analogue 12 | FYPFI | Synthetic Analogue of Longicalycinin A | Cyclization enhances apoptosis via lysosomes | MTT assay | HT-29 | Colorectal Cancer | IC50 = 14.2 ± 0.0014 µg/ml |
| dbacp07769 | Longicalycinin A linear analogue 12 | FYPFI | Synthetic Analogue of Longicalycinin A | Cyclization enhances apoptosis via lysosomes | MTT assay | HepG-2 | Liver Cancer | 12.06% Cell death at 100 µg/ml |
| dbacp07770 | Longicalycinin A linear analogue 12 | FYPFI | Synthetic Analogue of Longicalycinin A | Cyclization enhances apoptosis via lysosomes | MTT assay | HT-29 | Colorectal Cancer | 81.34% Cell death at 100 µg/ml |
| dbacp07771 | Longicalycinin A cyclic analogue 12 | FYPFI | Synthetic Analogue of Longicalycinin A | Cyclization enhances apoptosis via lysosomes | MTT assay | HepG-2 | Liver Cancer | IC50 = 12.37 ± 0.0014 µg/ml |
| dbacp07772 | Longicalycinin A cyclic analogue 12 | FYPFI | Synthetic Analogue of Longicalycinin A | Cyclization enhances apoptosis via lysosomes | MTT assay | HT-29 | Colorectal Cancer | IC50 = 13.2 ± 0 µg/ml |
| dbacp07773 | Longicalycinin A cyclic analogue 12 | FYPFI | Synthetic Analogue of Longicalycinin A | Cyclization enhances apoptosis via lysosomes | MTT assay | HepG-2 | Liver Cancer | 63.84% Cell death at 100 µg/ml |
| dbacp07774 | Longicalycinin A cyclic analogue 12 | FYPFI | Synthetic Analogue of Longicalycinin A | Cyclization enhances apoptosis via lysosomes | MTT assay | HT-29 | Colorectal Cancer | 52.72% Cell death at 100 µg/ml |
| dbacp07775 | Longicalycinin A cyclic analogue 15 | PYGFV | Synthetic Analogue of Longicalycinin A | Cyclization enhances apoptosis via lysosomes | MTT assay | HepG-2 | Liver Cancer | IC50 = 10.33 ± 0 µg/ml |
| dbacp07776 | Longicalycinin A cyclic analogue 15 | PYGFV | Synthetic Analogue of Longicalycinin A | Cyclization enhances apoptosis via lysosomes | MTT assay | HT-29 | Colorectal Cancer | IC50 = 11.23 ± 0.0007 µg/ml |
| dbacp07777 | Longicalycinin A cyclic analogue 15 | PYGFV | Synthetic Analogue of Longicalycinin A | Cyclization enhances apoptosis via lysosomes | MTT assay | HepG-2 | Liver Cancer | 52.33% Cell death at 100 µg/ml |
| dbacp07778 | Longicalycinin A cyclic analogue 15 | PYGFV | Synthetic Analogue of Longicalycinin A | Cyclization enhances apoptosis via lysosomes | MTT assay | HT-29 | Colorectal Cancer | 27.43% Cell death at 100 µg/ml |
| dbacp07779 | Longicalycinin A linear analogue 16 | FTPFV | Synthetic Analogue of Longicalycinin A | Cyclization enhances apoptosis via lysosomes | MTT assay | HepG-2 | Liver Cancer | IC50 = 11.1 ± 0.0007 µg/ml |
| dbacp07780 | Longicalycinin A linear analogue 16 | FTPFV | Synthetic Analogue of Longicalycinin A | Cyclization enhances apoptosis via lysosomes | MTT assay | HT-29 | Colorectal Cancer | IC50 = 12.11 ± 0.0056 µg/ml |
| dbacp07781 | Longicalycinin A linear analogue 16 | FTPFV | Synthetic Analogue of Longicalycinin A | Cyclization enhances apoptosis via lysosomes | MTT assay | HepG-2 | Liver Cancer | 15.76% Cell death at 100 µg/ml |
| dbacp07782 | Longicalycinin A linear analogue 16 | FTPFV | Synthetic Analogue of Longicalycinin A | Cyclization enhances apoptosis via lysosomes | MTT assay | HT-29 | Colorectal Cancer | 88.24% Cell death at 100 µg/ml |
| dbacp07783 | Longicalycinin A cyclic analogue 16 | FTPFV | Synthetic Analogue of Longicalycinin A | Cyclization enhances apoptosis via lysosomes | MTT assay | HepG-2 | Liver Cancer | IC50 = 12.1 ± 0.0007 µg/ml |
| dbacp07784 | Longicalycinin A cyclic analogue 16 | FTPFV | Synthetic Analogue of Longicalycinin A | Cyclization enhances apoptosis via lysosomes | MTT assay | HT-29 | Colorectal Cancer | IC50 = 10.4 ± 0.0028 µg/ml |
| dbacp07785 | Longicalycinin A cyclic analogue 16 | FTPFV | Synthetic Analogue of Longicalycinin A | Cyclization enhances apoptosis via lysosomes | MTT assay | HepG-2 | Liver Cancer | 42.33% Cell death at 100 µg/ml |
| dbacp07786 | Longicalycinin A cyclic analogue 16 | FTPFV | Synthetic Analogue of Longicalycinin A | Cyclization enhances apoptosis via lysosomes | MTT assay | HT-29 | Colorectal Cancer | 29.87% Cell death at 100 µg/ml |
| dbacp07787 | Longicalycinin A linear analogue 17 | FSPFA | Synthetic Analogue of Longicalycinin A | Cyclization enhances apoptosis via lysosomes | MTT assay | HepG-2 | Liver Cancer | IC50 = 9.33 ± 0.0007 µg/ml |
| dbacp07788 | Longicalycinin A linear analogue 17 | FSPFA | Synthetic Analogue of Longicalycinin A | Cyclization enhances apoptosis via lysosomes | MTT assay | HT-29 | Colorectal Cancer | IC50 = 11.33 ± 0.0035 µg/ml |
| dbacp07789 | Longicalycinin A linear analogue 17 | FSPFA | Synthetic Analogue of Longicalycinin A | Cyclization enhances apoptosis via lysosomes | MTT assay | HepG-2 | Liver Cancer | 27.54% Cell death at 100 µg/ml |
| dbacp07790 | Longicalycinin A linear analogue 17 | FSPFA | Synthetic Analogue of Longicalycinin A | Cyclization enhances apoptosis via lysosomes | MTT assay | HT-29 | Colorectal Cancer | 75.68% Cell death at 100 µg/ml |
| dbacp07791 | Longicalycinin A cyclic analogue 17 | FSPFA | Synthetic Analogue of Longicalycinin A | Cyclization enhances apoptosis via lysosomes | MTT assay | HepG-2 | Liver Cancer | IC50 = 9.4 ± 0.0014 µg/ml |
| dbacp07792 | Longicalycinin A cyclic analogue 17 | FSPFA | Synthetic Analogue of Longicalycinin A | Cyclization enhances apoptosis via lysosomes | MTT assay | HT-29 | Colorectal Cancer | IC50 = 11.2 ± 0.0007 µg/ml |
| dbacp07793 | Longicalycinin A cyclic analogue 17 | FSPFA | Synthetic Analogue of Longicalycinin A | Cyclization enhances apoptosis via lysosomes | MTT assay | HepG-2 | Liver Cancer | 74.53% Cell death at 100 µg/ml |
| dbacp07794 | Longicalycinin A cyclic analogue 17 | FSPFA | Synthetic Analogue of Longicalycinin A | Cyclization enhances apoptosis via lysosomes | MTT assay | HT-29 | Colorectal Cancer | 76.14% Cell death at 100 µg/ml |
| dbacp07795 | Longicalycinin A linear analogue 18 | FSPAG | Synthetic Analogue of Longicalycinin A | Cyclization enhances apoptosis via lysosomes | MTT assay | HepG-2 | Liver Cancer | IC50 = 10.33 ± 0.0007 µg/ml |
| dbacp07796 | Longicalycinin A linear analogue 18 | FSPAG | Synthetic Analogue of Longicalycinin A | Cyclization enhances apoptosis via lysosomes | MTT assay | HT-29 | Colorectal Cancer | IC50 = 10.2 ± 0.0014 µg/ml |
| dbacp07797 | Longicalycinin A linear analogue 18 | FSPAG | Synthetic Analogue of Longicalycinin A | Cyclization enhances apoptosis via lysosomes | MTT assay | HepG-2 | Liver Cancer | 15.55% Cell death at 100 µg/ml |
| dbacp07798 | Longicalycinin A linear analogue 18 | FSPAG | Synthetic Analogue of Longicalycinin A | Cyclization enhances apoptosis via lysosomes | MTT assay | HT-29 | Colorectal Cancer | 56.51% Cell death at 100 µg/ml |
| dbacp07799 | Longicalycinin A cyclic analogue 18 | FSPAG | Synthetic Analogue of Longicalycinin A | Cyclization enhances apoptosis via lysosomes | MTT assay | HepG-2 | Liver Cancer | IC50 = 9.68 ± 0.0014 µg/ml |
| dbacp07800 | Longicalycinin A cyclic analogue 18 | FSPAG | Synthetic Analogue of Longicalycinin A | Cyclization enhances apoptosis via lysosomes | MTT assay | HT-29 | Colorectal Cancer | IC50 = 9.06 ± 0.0014 µg/ml |
| dbacp07801 | Longicalycinin A cyclic analogue 18 | FSPAG | Synthetic Analogue of Longicalycinin A | Cyclization enhances apoptosis via lysosomes | MTT assay | HepG-2 | Liver Cancer | 46.58% Cell death at 100 µg/ml |
| dbacp07802 | Longicalycinin A cyclic analogue 18 | FSPAG | Synthetic Analogue of Longicalycinin A | Cyclization enhances apoptosis via lysosomes | MTT assay | HT-29 | Colon Cancer | 22.8% Cell death at 100 µg/ml |
| dbacp07848 | Carnosine | (Beta-A)H | Muscular and Nervous tissues of vertebrates | Inhibits VEGFR-2 angiogenic signaling | MTT assay | MGH-U1 (EJ) | Bladder Cancer | IC50 = 50 mM |
| dbacp07849 | Dermaseptin-PT9 | GLWSKIKDAAKTAGKAALGFVNEMV | Phyllomedusa tarsius | Membrane disruption and cationic enhancement | MTT assay | MCF-7 | Breast Cancer | IC50 = 7.44 µM |
| dbacp07850 | Dermaseptin-PT9 | GLWSKIKDAAKTAGKAALGFVNEMV | Phyllomedusa tarsius | Membrane disruption and cationic enhancement | MTT assay | U251-MG | Brain Tumor | IC50 = 49.51 µM |
| dbacp07851 | Dermaseptin-PT9 | GLWSKIKDAAKTAGKAALGFVNEMV | Phyllomedusa tarsius | Membrane disruption and cationic enhancement | MTT assay | H-157 | Lung Cancer | IC50 = 25.51 µM |
| dbacp07852 | Dermaseptin-PT9 | GLWSKIKDAAKTAGKAALGFVNEMV | Phyllomedusa tarsius | Membrane disruption and cationic enhancement | MTT assay | PC-3 | Prostate Cancer | IC50 = 21.78 µM |
| dbacp07853 | Dermaseptin-PT9 | GLWSKIKDAAKTAGKAALGFVNEMV | Phyllomedusa tarsius | Membrane disruption and cationic enhancement | MTT assay | PANC-1 | Pancreatic Cancer | IC50 = 28.95 µM |
| dbacp07854 | K8, 23-DPT9 | GLWSKIKKAAKTAGKAALGFVNKMV | Synthetic | Membrane disruption and cationic enhancement | MTT assay | MCF-7 | Breast Cancer | IC50 = 8.64 µM |
| dbacp07855 | K8, 23-DPT9 | GLWSKIKKAAKTAGKAALGFVNKMV | Synthetic | Membrane disruption and cationic enhancement | MTT assay | U251-MG | Brain Tumor | IC50 = 18.51 µM |
| dbacp07856 | K8, 23-DPT9 | GLWSKIKKAAKTAGKAALGFVNKMV | Synthetic | Membrane disruption and cationic enhancement | MTT assay | H-157 | Lung Cancer | IC50 = 9.88 µM |
| dbacp07857 | K8, 23-DPT9 | GLWSKIKKAAKTAGKAALGFVNKMV | Synthetic | Membrane disruption and cationic enhancement | MTT assay | PC-3 | Prostate Cancer | IC50 = 9.97 µM |
| dbacp07858 | K8, 23-DPT9 | GLWSKIKKAAKTAGKAALGFVNKMV | Synthetic | Membrane disruption and cationic enhancement | MTT assay | PANC-1 | Pancreatic Cancer | IC50 = 11.17 µM |
| dbacp07859 | HN-1 | FALGAVTKLLPSLLCMITRKC | Amolops hainanensis | Apoptosis induction and immune activation | MTT assay | MCF-7 | Breast Cancer | IC50 = 6.9 μM |
| dbacp07860 | HN-1 | FALGAVTKLLPSLLCMITRKC | Amolops hainanensis | Apoptosis induction and immune activation | MTT assay | A-549 | Lung Cancer | Not Available |
| dbacp07861 | HN-1 | FALGAVTKLLPSLLCMITRKC | Amolops hainanensis | Apoptosis induction and immune activation | MTT assay | SGC-7901 | Stomach Cancer | Not Available |
| dbacp07862 | HN-1 | FALGAVTKLLPSLLCMITRKC | Amolops hainanensis | Apoptosis induction and immune activation | MTT assay | MDA-MB-453 | Breast Cancer | Not Available |
| dbacp07863 | HN-1 | FALGAVTKLLPSLLCMITRKC | Amolops hainanensis | Apoptosis induction and immune activation | MTT assay | PC-3 | Prostate Cancer | Not Available |
| dbacp07864 | HN-1 | FALGAVTKLLPSLLCMITRKC | Amolops hainanensis | Apoptosis induction and immune activation | MTT assay | 4T1 | Breast Cancer | Not Available |
| dbacp07879 | Nubein6.8 | LKCNQLIPPFWKTCPKGKNLCYKMTMRAAPMVPVKRGCIDVCPKSSLLIKYMCCNTDKCN | Naja nubiae | DNA damage and apoptosis induction | MTT assay | A-375 | Skin Cancer | EC50 = 0.54 ± 0.04 μM |
| dbacp07880 | Nubein6.8 | LKCNQLIPPFWKTCPKGKNLCYKMTMRAAPMVPVKRGCIDVCPKSSLLIKYMCCNTDKCN | Naja nubiae | DNA damage and apoptosis induction | MTT assay | A-2780 | Ovarian Cancer | EC50 = 1.249 ± 0.06 μM |
| dbacp07881 | Nubein6.8 | LKCNQLIPPFWKTCPKGKNLCYKMTMRAAPMVPVKRGCIDVCPKSSLLIKYMCCNTDKCN | Naja nubiae | DNA damage and apoptosis induction | MTT assay | PANC-1 | Pancreatic Cancer | slight toxicity above 3.7 μM |
| dbacp07887 | ICD-85 | Not Available | Active fractions from Gloydius halys and Hemiscorpius lepturus | Caspase-9 mediated apoptotic death | MTT assay | MCF-7 | Breast Cancer | IC50 = 36.45 ± 0.38 μg/mL |
| dbacp07889 | H-58 | IKLSKKTKKNLKKVLKGS5IKGS5IAVAKMV | Synthetic | Cell entry, DNA damage, apoptosis. | MTT assay | A-549 | Lung Cancer | IC50 = 0.62 ± 0.12 μM |
| dbacp07890 | H-58 | IKLSKKTKKNLKKVLKGS5IKGS5IAVAKMV | Synthetic | Cell entry, DNA damage, apoptosis. | MTT assay | HCT-116 | Colon Cancer | IC50 = 1.29 ± 0.08 μM |
| dbacp07891 | H-58 | IKLSKKTKKNLKKVLKGS5IKGS5IAVAKMV | Synthetic | Cell entry, DNA damage, apoptosis. | MTT assay | HepG-2 | Liver Cancer | IC50 = 2.13 ± 0.07 μM |
| dbacp07892 | H-57 | IKLSKKTKKNLKKVLKGS5IKGS5IAVAKMV | Synthetic | Cell entry, DNA damage, apoptosis. | MTT assay | A-549 | Lung Cancer | IC50 = 0.62 ± 0.12 μM |
| dbacp07893 | H-57 | IKLSKKTKKNLKKVLKGS5IKGS5IAVAKMV | Synthetic | Cell entry, DNA damage, apoptosis. | MTT assay | HCT-116 | Colon Cancer | IC50 = 1.29 ± 0.08 μM |
| dbacp07894 | H-57 | IKLSKKTKKNLKKVLKGS5IKGS5IAVAKMV | Synthetic | Cell entry, DNA damage, apoptosis. | MTT assay | HepG-2 | Liver Cancer | IC50 = 2.13 ± 0.07 μM |
| dbacp07895 | H-18 | IKLSKKTKKNLKKVLKGS5IKGS5IAVAKMV | Synthetic | Cell entry, DNA damage, apoptosis. | MTT assay | A-549 | Lung Cancer | IC50 = 0.89 ± 0.21 μM |
| dbacp07896 | H-18 | IKLSKKTKKNLKKVLKGS5IKGS5IAVAKMV | Synthetic | Cell entry, DNA damage, apoptosis. | MTT assay | HCT-116 | Colon Cancer | IC50 = 1.11 ± 0.21 μM |
| dbacp07897 | H-18 | IKLSKKTKKNLKKVLKGS5IKGS5IAVAKMV | Synthetic | Cell entry, DNA damage, apoptosis. | MTT assay | HepG-2 | Liver Cancer | IC50 = 1.61 ± 0.21 μM |
| dbacp07898 | H-21 | IKLSKS5TKKS5LKKVLKGS5IKGS5IAVAKMV | Synthetic | Cell entry, DNA damage, apoptosis. | MTT assay | A-549 | Lung Cancer | IC50 = 3.26 ± 0.36 μM |
| dbacp07899 | H-21 | IKLSKS5TKKS5LKKVLKGS5IKGS5IAVAKMV | Synthetic | Cell entry, DNA damage, apoptosis. | MTT assay | HCT-116 | Colon Cancer | IC50 = 3.05 ± 0.21 μM |
| dbacp07900 | H-21 | IKLSKS5TKKS5LKKVLKGS5IKGS5IAVAKMV | Synthetic | Cell entry, DNA damage, apoptosis. | MTT assay | HepG-2 | Liver Cancer | IC50 = 1.50 ± 0.28 μM |
| dbacp07901 | H-20 | IKLSPS5TKKS5LKKVLKGS5IKGS5IAVAKMV | Synthetic | Cell entry, DNA damage, apoptosis. | MTT assay | A-549 | Lung Cancer | IC50 = 2.10 ± 0.32 μM |
| dbacp07902 | H-20 | IKLSPS5TKKS5LKKVLKGS5IKGS5IAVAKMV | Synthetic | Cell entry, DNA damage, apoptosis. | MTT assay | HCT-116 | Colon Cancer | IC50 = 2.63 ± 0.35 μM |
| dbacp07903 | H-20 | IKLSPS5TKKS5LKKVLKGS5IKGS5IAVAKMV | Synthetic | Cell entry, DNA damage, apoptosis. | MTT assay | HepG-2 | Liver Cancer | IC50 = 4.93 ± 0.53 μM |
| dbacp07904 | H-19 | IKLSKETKKNLKKVLKGS5IKGS5IAVAKMV | Synthetic | Cell entry, DNA damage, apoptosis. | MTT assay | A-549 | Lung Cancer | IC50 = 1.00 ± 0.36 μM |
| dbacp07905 | H-19 | IKLSKETKKNLKKVLKGS5IKGS5IAVAKMV | Synthetic | Cell entry, DNA damage, apoptosis. | MTT assay | HCT-116 | Colon Cancer | IC50 = 1.78 ± 0.35 μM |
| dbacp07906 | H-19 | IKLSKETKKNLKKVLKGS5IKGS5IAVAKMV | Synthetic | Cell entry, DNA damage, apoptosis. | MTT assay | HepG-2 | Liver Cancer | IC50 = 1.64 ± 0.36 μM |
| dbacp07907 | H-17 | IKLSKS5TKKS5LKKVLKGAIKGAIAVAKMV | Synthetic | Cell entry, DNA damage, apoptosis. | MTT assay | A-549 | Lung Cancer | IC50 = 0.96 ± 0.33 μM |
| dbacp07908 | H-17 | IKLSKS5TKKS5LKKVLKGAIKGAIAVAKMV | Synthetic | Cell entry, DNA damage, apoptosis. | MTT assay | HCT-116 | Colon Cancer | IC50 = 1.49 ± 0.45 μM |
| dbacp07909 | H-17 | IKLSKS5TKKS5LKKVLKGAIKGAIAVAKMV | Synthetic | Cell entry, DNA damage, apoptosis. | MTT assay | HepG-2 | Liver Cancer | IC50 = 1.64 ± 0.47 μM |
| dbacp07910 | H-16 | IKLSPS5TKKS5LKKVLKGAIKGAIAVAKMV | Synthetic | Cell entry, DNA damage, apoptosis. | MTT assay | A-549 | Lung Cancer | IC50 = 1.85 ± 0.31 μM |
| dbacp07911 | H-16 | IKLSPS5TKKS5LKKVLKGAIKGAIAVAKMV | Synthetic | Cell entry, DNA damage, apoptosis. | MTT assay | HCT-116 | Colon Cancer | IC50 = 2.65 ± 0.35 μM |
| dbacp07912 | H-16 | IKLSPS5TKKS5LKKVLKGAIKGAIAVAKMV | Synthetic | Cell entry, DNA damage, apoptosis. | MTT assay | HepG-2 | Liver Cancer | IC50 = 3.14 ± 0.46 μM |
| dbacp07913 | H-15 | IKLSKS5TKDS5LKKVLKGAIKGAIAVAKMV | Synthetic | Cell entry, DNA damage, apoptosis. | MTT assay | A-549 | Lung Cancer | IC50 = 2.26 ± 0.24 μM |
| dbacp07914 | H-15 | IKLSKS5TKDS5LKKVLKGAIKGAIAVAKMV | Synthetic | Cell entry, DNA damage, apoptosis. | MTT assay | HCT-116 | Colon Cancer | IC50 = 2.95 ± 0.25 μM |
| dbacp07915 | H-15 | IKLSKS5TKDS5LKKVLKGAIKGAIAVAKMV | Synthetic | Cell entry, DNA damage, apoptosis. | MTT assay | HepG-2 | Liver Cancer | IC50 = 2.20 ± 0.27 μM |
| dbacp07916 | H-10 | IKLSPS5TKDS5LKKVLKGS5IKGS5IAVAKMV | Synthetic | Cell entry, DNA damage, apoptosis. | MTT assay | A-549 | Lung Cancer | IC50 = 3.59 ± 0.12 μM |
| dbacp07917 | H-10 | IKLSPS5TKDS5LKKVLKGS5IKGS5IAVAKMV | Synthetic | Cell entry, DNA damage, apoptosis. | MTT assay | HCT-116 | Colon Cancer | IC50 = 3.51 ± 0.37 μM |
| dbacp07918 | H-10 | IKLSPS5TKDS5LKKVLKGS5IKGS5IAVAKMV | Synthetic | Cell entry, DNA damage, apoptosis. | MTT assay | HepG-2 | Liver Cancer | IC50 = 1.50 ± 0.21 μM |
| dbacp07919 | H-5 | IKLSPETKDNLKKVLKGS5IKGS5IAVAKMV | Synthetic | Cell entry, DNA damage, apoptosis. | MTT assay | A-549 | Lung Cancer | IC50 = 7.35 ± 0.22 μM |
| dbacp07920 | H-5 | IKLSPETKDNLKKVLKGS5IKGS5IAVAKMV | Synthetic | Cell entry, DNA damage, apoptosis. | MTT assay | HCT-116 | Colon Cancer | IC50 = 4.16 ± 0.21 μM |
| dbacp07921 | H-5 | IKLSPETKDNLKKVLKGS5IKGS5IAVAKMV | Synthetic | Cell entry, DNA damage, apoptosis. | MTT assay | HepG-2 | Liver Cancer | IC50 = 2.82 ± 0.23 μM |
| dbacp07922 | H-2 | IKLSPS5TKDS5LKKVLKGAIKGAIAVAKMV | Synthetic | Cell entry, DNA damage, apoptosis. | MTT assay | A-549 | Lung Cancer | IC50 = 4.26 ± 0.52 μM |
| dbacp07923 | H-2 | IKLSPS5TKDS5LKKVLKGAIKGAIAVAKMV | Synthetic | Cell entry, DNA damage, apoptosis. | MTT assay | HCT-116 | Colon Cancer | IC50 = 3.54 ± 0.72 μM |
| dbacp07924 | H-2 | IKLSPS5TKDS5LKKVLKGAIKGAIAVAKMV | Synthetic | Cell entry, DNA damage, apoptosis. | MTT assay | HepG-2 | Liver Cancer | IC50 = 1.60 ± 0.24 μM |
| dbacp07925 | oligopeptide 1 | AGAPGG | Sarcophyton glaucum | Selective cytotoxicity, DNA damage, apoptosis | MTT assay | HeLa | Cervical Cancer | EC50 = 8.6 mmol/L |
| dbacp07926 | Phylloseptin-PBa3 | FLSLIPHIVSGVAALANHL | Phyllomedusa burmeisteri | Membrane disruption, apoptosis, selective cytotoxicity | MTT assay | MDA-MB-435S | Breast Cancer | IC50 = 208 µM |
| dbacp07927 | Phylloseptin-PBa3 | FLSLIPHIVSGVAALANHL | Phyllomedusa burmeisteri | Membrane disruption, apoptosis, selective cytotoxicity | MTT assay | H-838 | Lung Cancer | Cell viability ~ 65% at 10-5 M |
| dbacp07931 | myristoyl-CM4 | GRWKIFKKIEKVGQNIRDGIVKAGPAVAVVGQAATI | Bombyx mori | Cell penetration, Mitochondrial dysfunction, Apoptosis pathway activation | MTT assay | MCF-7 | Breast cancer | IC50 = 6 μM |
| dbacp07932 | myristoyl-CM4 | GRWKIFKKIEKVGQNIRDGIVKAGPAVAVVGQAATI | Bombyx mori | Enhanced binding, mitochondrial dysfunction, apoptosis | MTT assay | MDA-MB-231 | Breast cancer | IC50 = 4 μM |
| dbacp07933 | myristoyl-CM4 | GRWKIFKKIEKVGQNIRDGIVKAGPAVAVVGQAATI | Bombyx mori | Enhanced binding, mitochondrial dysfunction, apoptosis | MTT assay | MX-1 | Breast cancer | IC50 = 3 μM |
| dbacp07943 | TC22 | MTVVLLLIVLPLLGGVHSSGIL | Tribolium castaneum | ROS, p53, mitochondrial apoptosis activation | MTT assay | HeLa | Cervical Cancer | Fig 4a |
| dbacp07944 | TC22 | MTVVLLLIVLPLLGGVHSSGIL | Tribolium castaneum | ROS, p53, mitochondrial apoptosis activation | MTT assay | MCF-7 | Breast Cancer | Fig 4a |
| dbacp07945 | Emericellipsin A | (3-MeP)-(AHMOD)-A-Aib-IV-beta-A-N-(2-Hydroxyethyl)-1,2-propanediamine | Emericellopsis alkalina | Membrane disruption, antifungal, antibacterial, anticancer | MTT assay | HepG-2 | Liver Cancer | EC50 = 2.8 uM |
| dbacp07946 | Emericellipsin A | (3-MeP)-(AHMOD)-A-Aib-IV-beta-A-N-(2-Hydroxyethyl)-1,2-propanediamine | Emericellopsis alkalina | Membrane disruption, antifungal, antibacterial, anticancer | MTT assay | HeLa | Cervical Cancer | EC50 < 0.5 uM |
| dbacp07947 | IL13Rα2 D1 peptide | GSETWKTIITKN | Synthetic | IL13Rα2 blockade inhibits cancer metastasis | MTT assay | KM12SM | Colorectal Cancer | inhibited IL13-stimulated cell adhesion |
| dbacp07948 | IL13Rα2 D1 peptide | GSETWKTIITKN | Synthetic | IL13Rα2 blockade inhibits cancer metastasis | MTT assay | SW-620 | Colorectal Cancer | inhibited IL13-stimulated cell adhesion |
| dbacp07949 | IL13Rα2 D1 peptide | GSETWKTIITKN | Synthetic | IL13Rα2 blockade inhibits cancer metastasis | MTT assay | U-87 | Brain Cancer | inhibited IL13-stimulated cell adhesion |
| dbacp07950 | IL13Rα2 D1 peptide | GSETWKTIITKN | Synthetic | IL13Rα2 blockade inhibits cancer metastasis | MTT assay | U-118 | Brain Cancer | inhibited IL13-stimulated cell adhesion |
| dbacp07951 | S-24-R2PLx | GIMDTVKNAAKNLAGQLLDKLKCSITAC | Synthetic Analogue of Ranatuerin-2PLx | R2PLx induces caspase-dependent apoptosis | MTT assay | PC-3 | Prostate Cancer | IC50 = 792.60 µM |
| dbacp07952 | S-24-R2PLx | GIMDTVKNAAKNLAGQLLDKLKCSITAC | Synthetic Analogue of Ranatuerin-2PLx | R2PLx induces caspase-dependent apoptosis | MTT assay | H-157 | Lung Cancer | IC50 = 58.18 µM |
| dbacp07953 | S-24-R2PLx | GIMDTVKNAAKNLAGQLLDKLKCSITAC | Synthetic Analogue of Ranatuerin-2PLx | R2PLx induces caspase-dependent apoptosis | MTT assay | MDA-MB-435S | Skin Cancer | IC50 = 179.00 µM |
| dbacp07954 | S-24-R2PLx | GIMDTVKNAAKNLAGQLLDKLKCSITAC | Synthetic Analogue of Ranatuerin-2PLx | R2PLx induces caspase-dependent apoptosis | MTT assay | U-251-MG | Brain Tumor | IC50 = 278.30 µM |
| dbacp07955 | S-24-R2PLx | GIMDTVKNAAKNLAGQLLDKLKCSITAC | Synthetic Analogue of Ranatuerin-2PLx | R2PLx induces caspase-dependent apoptosis | MTT assay | MCF-7 | Breast Cancer | IC50 = 316.90 µM |
| dbacp07956 | DP-2 | GRKKRRQRRRGALWKSLLKNVGKA | Synthetic | DRS-DU-1 induces selective tumor cytotoxicity | MTT assay | H-157 | Lung Cancer | IC50 = 3.21 μM |
| dbacp07957 | DP-2 | GRKKRRQRRRGALWKSLLKNVGKA | Synthetic | DRS-DU-1 induces selective tumor cytotoxicity | MTT assay | PC-3 | Prostate Cancer | IC50 = 6.75 μM |
| dbacp07989 | K5, 17-DPS3 | ALWKKILKNAGKAALNKINQIVQ | Analogue of Dermaseptin-PS3 | Enhanced cationicity/hydrophobicity increases cytotoxicity | MTT assay | H-157 | Lung Cancer | IC50 = 18.20 μM |
| dbacp07990 | K5, 17-DPS3 | ALWKKILKNAGKAALNKINQIVQ | Analogue of Dermaseptin-PS3 | Enhanced cationicity/hydrophobicity increases cytotoxicity | MTT assay | PC-3 | Prostate Cancer | IC50 = 18.20 μM |
| dbacp07991 | L10, 11-DPS3 | ALWKDILKNLLKAALNEINQIVQ | Analogue of Dermaseptin-PS3 | Enhanced cationicity/hydrophobicity increases cytotoxicity | MTT assay | H-157 | Lung Cancer | IC50 = 0.12 μM |
| dbacp07992 | L10, 11-DPS3 | ALWKDILKNLLKAALNEINQIVQ | Analogue of Dermaseptin-PS3 | Enhanced cationicity/hydrophobicity increases cytotoxicity | MTT assay | PC-3 | Prostate Cancer | IC50 = 1.85 μM |
| dbacp07993 | [G10a]SHa | FLSGIVGMLaKLF | Synthetic analogue of Temporin-1SHa | Enhanced cationicity/hydrophobicity increases cytotoxicity | MTT assay | MCF-7 | Breast Cancer | IC50 = 16.2 ± 2.2 µM |
| dbacp07994 | [G10a]SHa | FLSGIVGMLaKLF | Synthetic analogue of Temporin-1SHa | Enhanced cationicity/hydrophobicity increases cytotoxicity | MTT assay | HeLa | Cervical Cancer | IC50 = 22.7 ± 0.86 µM |
| dbacp07995 | [G10a]SHa | FLSGIVGMLaKLF | Synthetic analogue of Temporin-1SHa | Enhanced cationicity/hydrophobicity increases cytotoxicity | MTT assay | NCI-H-460 | Lung Cancer | IC50 =24.3 ± 0.8 µM |
| dbacp07996 | [G10a]SHa-BCTP | FLSGIVGMLaKLFLFKQYAELW | Synthetic analogue of Temporin-1SHa | Enhanced cationicity/hydrophobicity increases cytotoxicity | MTT assay | MCF-7 | Breast Cancer | IC50 = 26.85 ± 1.85 µM |
| dbacp07997 | [G10a]SHa-BCTP | FLSGIVGMLaKLFLFKQYAELW | Synthetic analogue of Temporin-1SHa | Enhanced cationicity/hydrophobicity increases cytotoxicity | MTT assay | HeLa | Cervical Cancer | IC50 >100 µM |
| dbacp07998 | [G10a]SHa-BCTP | FLSGIVGMLaKLFLFKQYAELW | Synthetic analogue of Temporin-1SHa | Enhanced cationicity/hydrophobicity increases cytotoxicity | MTT assay | NCI-H-460 | Lung Cancer | IC50 >100 µM |
| dbacp07999 | [G4a]SHa | FLSaIVGMLGKLF | Synthetic analogue of Temporin-1SHa | Enhanced cationicity/hydrophobicity increases cytotoxicity | MTT assay | MCF-7 | Breast Cancer | IC50 = 17.9 ± 1.1 µM |
| dbacp08000 | [G4a]SHa | FLSaIVGMLGKLF | Synthetic analogue of Temporin-1SHa | Enhanced cationicity/hydrophobicity increases cytotoxicity | MTT assay | HeLa | Cervical Cancer | IC50 >100 µM |
| dbacp08001 | [G4a]SHa | FLSaIVGMLGKLF | Synthetic analogue of Temporin-1SHa | Enhanced cationicity/hydrophobicity increases cytotoxicity | MTT assay | NCI-H-460 | Lung Cancer | IC50 >100 µM |
| dbacp08002 | [G7a]SHa | FLSGIVaMLGKLF | Synthetic analogue of Temporin-1SHa | Enhanced cationicity/hydrophobicity increases cytotoxicity | MTT assay | MCF-7 | Breast Cancer | IC50 =22.4 ± 2.2 µM |
| dbacp08003 | [G7a]SHa | FLSGIVaMLGKLF | Synthetic analogue of Temporin-1SHa | Enhanced cationicity/hydrophobicity increases cytotoxicity | MTT assay | HeLa | Cervical Cancer | IC50 >100 µM |
| dbacp08004 | [G7a]SHa | FLSGIVaMLGKLF | Synthetic analogue of Temporin-1SHa | Enhanced cationicity/hydrophobicity increases cytotoxicity | MTT assay | NCI-H-460 | Lung Cancer | IC50 >100 µM |
| dbacp08005 | [G4,7a]SHa | FLSaIVaMLGKLF | Synthetic analogue of Temporin-1SHa | Enhanced cationicity/hydrophobicity increases cytotoxicity | MTT assay | MCF-7 | Breast Cancer | IC50 = 29.5 ± 6.03 µM |
| dbacp08006 | [G4,7a]SHa | FLSaIVaMLGKLF | Synthetic analogue of Temporin-1SHa | Enhanced cationicity/hydrophobicity increases cytotoxicity | MTT assay | HeLa | Cervical Cancer | IC50 >100 µM |
| dbacp08007 | [G4,7a]SHa | FLSaIVaMLGKLF | Synthetic analogue of Temporin-1SHa | Enhanced cationicity/hydrophobicity increases cytotoxicity | MTT assay | NCI-H-460 | Lung Cancer | IC50 = 37.3 ± 3.5 µM |
| dbacp08008 | [G4,7,10a]SHa | FLSaIVaMLaKLF | Synthetic analogue of Temporin-1SHa | Enhanced cationicity/hydrophobicity increases cytotoxicity | MTT assay | MCF-7 | Breast Cancer | IC50 = 26.33 ± 5.8 µM |
| dbacp08009 | [G4,7,10a]SHa | FLSaIVaMLaKLF | Synthetic analogue of Temporin-1SHa | Enhanced cationicity/hydrophobicity increases cytotoxicity | MTT assay | HeLa | Cervical Cancer | IC50 >100 µM |
| dbacp08010 | [G4,7,10a]SHa | FLSaIVaMLaKLF | Synthetic analogue of Temporin-1SHa | Enhanced cationicity/hydrophobicity increases cytotoxicity | MTT assay | NCI-H-460 | Lung Cancer | IC50 >100 µM |
| dbacp08011 | [G7,10a]SHa | FLSGIVaMLaKLF | Synthetic analogue of Temporin-1SHa | Enhanced cationicity/hydrophobicity increases cytotoxicity | MTT assay | MCF-7 | Breast Cancer | IC50 = 21.3 ± 1.13 µM |
| dbacp08012 | [G7,10a]SHa | FLSGIVaMLaKLF | Synthetic analogue of Temporin-1SHa | Enhanced cationicity/hydrophobicity increases cytotoxicity | MTT assay | HeLa | Cervical Cancer | IC50 >100 µM |
| dbacp08013 | [G7,10a]SHa | FLSGIVaMLaKLF | Synthetic analogue of Temporin-1SHa | Enhanced cationicity/hydrophobicity increases cytotoxicity | MTT assay | NCI-H-460 | Lung Cancer | IC50 >100 µM |
| dbacp08018 | Peptide4 Gonearrestide | ADAPGNYPLDARGKSYYC | Androctonus australis | Gonearrestide induces G1 cell-cycle arrest | MTT assay | HCT-116 | Colon Cancer | Not Available |
| dbacp08019 | Peptide4 Gonearrestide | ADAPGNYPLDARGKSYYC | Androctonus australis | Gonearrestide induces G1 cell-cycle arrest | MTT assay | DLD-1 | Colon Cancer | Not Available |
| dbacp08020 | Peptide4 Gonearrestide | ADAPGNYPLDARGKSYYC | Androctonus australis | Gonearrestide induces G1 cell-cycle arrest | MTT assay | HKe-3 | Colon Cancer | Not Available |
| dbacp08021 | Peptide4 Gonearrestide | ADAPGNYPLDARGKSYYC | Androctonus australis | Gonearrestide induces G1 cell-cycle arrest | MTT assay | Dks8 | Colon Cancer | Not Available |
| dbacp08022 | Peptide4 Gonearrestide | ADAPGNYPLDARGKSYYC | Androctonus australis | Gonearrestide induces G1 cell-cycle arrest | MTT assay | U-251 | Brain tumor | Not Available |
| dbacp08023 | Peptide6 Gonearrestide | KLSAIISKIRDE | Androctonus australis | Gonearrestide induces G1 cell-cycle arrest | MTT assay | HCT-116 | Colon Cancer | Not Available |
| dbacp08024 | Peptide6 Gonearrestide | KLSAIISKIRDE | Androctonus australis | Gonearrestide induces G1 cell-cycle arrest | MTT assay | DLD-1 | Colon Cancer | Not Available |
| dbacp08025 | Peptide6 Gonearrestide | KLSAIISKIRDE | Androctonus australis | Gonearrestide induces G1 cell-cycle arrest | MTT assay | HKe-3 | Colon Cancer | Not Available |
| dbacp08026 | Peptide6 Gonearrestide | KLSAIISKIRDE | Androctonus australis | Gonearrestide induces G1 cell-cycle arrest | MTT assay | Dks8 | Colon Cancer | Not Available |
| dbacp08027 | Peptide6 Gonearrestide | KLSAIISKIRDE | Androctonus australis | Gonearrestide induces G1 cell-cycle arrest | MTT assay | U-251 | Brain tumor | Not Available |
| dbacp08028 | Peptide10 Gonearrestide | NDADKDEMQSVYRGKANDDNSRGSKTNHRF | Androctonus mauritanicus | Gonearrestide induces G1 cell-cycle arrest | MTT assay | HCT-116 | Colon Cancer | Not Available |
| dbacp08029 | Peptide10 Gonearrestide | NDADKDEMQSVYRGKANDDNSRGSKTNHRF | Androctonus mauritanicus | Gonearrestide induces G1 cell-cycle arrest | MTT assay | DLD-1 | Colon Cancer | Not Available |
| dbacp08030 | Peptide10 Gonearrestide | NDADKDEMQSVYRGKANDDNSRGSKTNHRF | Androctonus mauritanicus | Gonearrestide induces G1 cell-cycle arrest | MTT assay | HKe-3 | Colon Cancer | Not Available |
| dbacp08031 | Peptide10 Gonearrestide | NDADKDEMQSVYRGKANDDNSRGSKTNHRF | Androctonus mauritanicus | Gonearrestide induces G1 cell-cycle arrest | MTT assay | Dks8 | Colon Cancer | Not Available |
| dbacp08032 | Peptide10 Gonearrestide | NDADKDEMQSVYRGKANDDNSRGSKTNHRF | Androctonus mauritanicus | Gonearrestide induces G1 cell-cycle arrest | MTT assay | U-251 | Brain tumor | Not Available |
| dbacp08033 | Peptide13 Gonearrestide | WCYKLPDRVSIKEKGRCN | Androctonus mauritanicus | Gonearrestide induces G1 cell-cycle arrest | MTT assay | HCT-116 | Colon Cancer | IC50 ~ 100 μM/L |
| dbacp08034 | Peptide13 Gonearrestide | WCYKLPDRVSIKEKGRCN | Androctonus mauritanicus | Gonearrestide induces G1 cell-cycle arrest | MTT assay | DLD-1 | Colon Cancer | Not Available |
| dbacp08035 | Peptide13 Gonearrestide | WCYKLPDRVSIKEKGRCN | Androctonus mauritanicus | Gonearrestide induces G1 cell-cycle arrest | MTT assay | HKe-3 | Colon Cancer | Not Available |
| dbacp08036 | Peptide13 Gonearrestide | WCYKLPDRVSIKEKGRCN | Androctonus mauritanicus | Gonearrestide induces G1 cell-cycle arrest | MTT assay | Dks8 | Colon Cancer | Not Available |
| dbacp08037 | Peptide13 Gonearrestide | WCYKLPDRVSIKEKGRCN | Androctonus mauritanicus | Gonearrestide induces G1 cell-cycle arrest | MTT assay | U-251 | Brain tumor | Not Available |
| dbacp08038 | Silk Fibroin peptide | Not Available | Silkworm Cocoons | SFP induces S-phase cell-cycle arrest | MTT assay | A-549 | Lung Cancer | IC50 = 9.921 ± 0.82 mg/ml |
| dbacp08039 | Silk Fibroin peptide | Not Available | Silkworm Cocoons | SFP induces S-phase cell-cycle arrest | MTT assay | H-460 | Lung Cancer | IC50 = 9.083 ± 1.22 mg/ml |
| dbacp08040 | Silk Fibroin peptide | Not Available | Silkworm Cocoons | SFP induces S-phase cell-cycle arrest | MTT assay | SW-1990 | Pancreatic Cancer | IC50 = 8.005 ± 1.34 mg/ml |
| dbacp08041 | Silk Fibroin peptide | Not Available | Silkworm Cocoons | SFP induces S-phase cell-cycle arrest | MTT assay | PANC-1 | Pancreatic Cancer | IC50 = 8.224 ± 1.43 mg/ml |
| dbacp08042 | Silk Fibroin peptide | Not Available | Silkworm Cocoons | SFP induces S-phase cell-cycle arrest | MTT assay | PC-9 | Lung Cancer | IC50 = 7.921 ± 1.19 mg/ml |
| dbacp08043 | Silk Fibroin peptide | Not Available | Silkworm Cocoons | SFP induces S-phase cell-cycle arrest | MTT assay | HT-29 | Colon Cancer | IC50 = 11.55 ± 3.33 mg/ml |
| dbacp08044 | Silk Fibroin peptide | Not Available | Silkworm Cocoons | SFP induces S-phase cell-cycle arrest | MTT assay | LN229 | Brain Tumor | IC50 = 13.32 ± 1.15 mg/ml |
| dbacp08064 | Temporin-PE | FLPIVAKLLSGLL | Pelophylax kl. esculentus | Modulates membrane interactions | MTT assay | NCI-H-157 | Lung Cancer | IC50 = 34.56 μM |
| dbacp08065 | Temporin-PE | FLPIVAKLLSGLL | Pelophylax kl. esculentus | Modulates membrane interactions | MTT assay | U251-MG | Brain Tumor | IC50 = 25.13 μM |
| dbacp08066 | Temporin-PE | FLPIVAKLLSGLL | Pelophylax kl. esculentus | Modulates membrane interactions | MTT assay | PC-3 | Prostate Cancer | IC50 = 38.56 μM |
| dbacp08067 | Temporin-PE | FLPIVAKLLSGLL | Pelophylax kl. esculentus | Modulates membrane interactions | MTT assay | MDA-MB-435S | Skin Cancer | IC50 = 33.23 μM |
| dbacp08068 | temporin-PEa | FLYIVAKLLSGLL | Synthetic analog of Temporin-PE | Modulates membrane interactions | MTT assay | NCI-H-157 | Lung Cancer | IC50 = 3.398 μM |
| dbacp08069 | temporin-PEa | FLYIVAKLLSGLL | Synthetic analog of Temporin-PE | Modulates membrane interactions | MTT assay | U251-MG | Brain Tumor | IC50 = 3.520 μM |
| dbacp08070 | temporin-PEa | FLYIVAKLLSGLL | Synthetic analog of Temporin-PE | Modulates membrane interactions | MTT assay | PC-3 | Prostate Cancer | IC50 = 27.62 μM |
| dbacp08071 | temporin-PEa | FLYIVAKLLSGLL | Synthetic analog of Temporin-PE | Modulates membrane interactions | MTT assay | MDA-MB-435S | Skin Cancer | IC50 = 9.864 μM |
| dbacp08072 | temporin-PEb | FLPIVAKLLSGLLGRKKRRQRRR | Synthetic analog of Temporin-PE | Modulates membrane interactions | MTT assay | NCI-H-157 | Lung Cancer | IC50 = 3.464 μM |
| dbacp08073 | temporin-PEb | FLPIVAKLLSGLLGRKKRRQRRR | Synthetic analog of Temporin-PE | Modulates membrane interactions | MTT assay | U251-MG | Brain Tumor | IC50 = 3.087 μM |
| dbacp08074 | temporin-PEb | FLPIVAKLLSGLLGRKKRRQRRR | Synthetic analog of Temporin-PE | Modulates membrane interactions | MTT assay | PC-3 | Prostate Cancer | IC50 = 3.051 μM |
| dbacp08075 | temporin-PEb | FLPIVAKLLSGLLGRKKRRQRRR | Synthetic analog of Temporin-PE | Modulates membrane interactions | MTT assay | MDA-MB-435S | Skin Cancer | IC50 = 3.483 μM |
| dbacp08076 | PvD1 | KTCENLADTYKGPCFTTGSCDDHCKNKEHLRSGRCRDDFRCWCTKNC | Phaseolus vulgaris | Disrupts tumor cells | MTT assay | HBMEC | Brain Cancer | Not Available |
| dbacp08077 | PvD1 | KTCENLADTYKGPCFTTGSCDDHCKNKEHLRSGRCRDDFRCWCTKNC | Phaseolus vulgaris | Disrupts tumor cells | MTT assay | MDA-MB-231 | Breast Cancer | IC50 = 0.82 ± 0.14 µM |
| dbacp08081 | Peptide 3a | YD | Synthetic | Inhibit COX-2 enzyme | MTT assay | MCF-7 | Breast Cancer | IC50 = 17.5 ± 0.04 µM |
| dbacp08082 | Peptide 3a | YD | Synthetic | Inhibit COX-2 enzyme | MTT assay | HepG-2 | Liver Cancer | IC50 = 4.8 ± 0.12 µM |
| dbacp08083 | Peptide 3a | YD | Synthetic | Inhibit COX-2 enzyme | MTT assay | A-549 | Lung Cancer | IC50 = 5.7 ± 0.04 µM |
| dbacp08084 | Peptide 3b | YD | Synthetic | Inhibit COX-2 enzyme | MTT assay | HepG-2 | Liver Cancer | IC50 = 62.3 ± 0.02 µM |
| dbacp08085 | Peptide 3b | YD | Synthetic | Inhibit COX-2 enzyme | MTT assay | A-549 | Lung Cancer | IC50 = 5.8 ± 0.02 µM |
| dbacp08086 | L-K6 | IKKILSKIKKLLK | Temporin 1CEb analogue | L-K6 binds, internalizes, damages nucleus | MTT assay | MCF-7 | Breast Cancer | IC50 = 31 μM |
| dbacp08087 | PTP-7S | EENFLGALFKALSKLL | PTP-7 | Not Available | MTT assay | HeLa | Cervical Cancer | 55 - 60% cell viability at 75 µM |
| dbacp08088 | PTP-7S | EENFLGALFKALSKLL | PTP-7 | Not Available | MTT assay | A-549 | Lung Cancer | 65% cell viability at 10 µΜ |
| dbacp08089 | B1 | KKLFKKILKYLK | Analogue of BP 100 | Membrane disruption triggers apoptosis | MTT assay | K-562 | Leukemia Cancer | IC50 = 17.9 ± 1.4 μM |
| dbacp08090 | B1 | KKLFKKILKYLK | Analogue of BP 100 | Membrane disruption triggers apoptosis | MTT assay | MCF-7 | Breast Cancer | IC50 = 15.7 ± 1.5 μM |
| dbacp08091 | B1 | KKLFKKILKYLK | Analogue of BP 100 | Membrane disruption triggers apoptosis | MTT assay | MCF-7/ADM | Breast Cancer | IC50 = 18.2 ± 1.3 μM |
| dbacp08092 | B1 | KKLFKKILKYLK | Analogue of BP 100 | Membrane disruption triggers apoptosis | MTT assay | K-562/ADM | Leukemia Cancer | IC50 = 19.1 ± 2.1 μM |
| dbacp08093 | B2 | KKLFKKILKYLKK | Analogue of BP 100 | Membrane disruption triggers apoptosis | MTT assay | K-562 | Leukemia Cancer | IC50 = 33.6 ± 4.2 μM |
| dbacp08094 | B2 | KKLFKKILKYLKK | Analogue of BP 100 | Membrane disruption triggers apoptosis | MTT assay | MCF-7 | Breast Cancer | IC50 = 30.8 ± 3.4 μM |
| dbacp08095 | B2 | KKLFKKILKYLKK | Analogue of BP 100 | Membrane disruption triggers apoptosis | MTT assay | MCF-7/ADM | Breast Cancer | IC50 = 36.1 ± 6.7 μM |
| dbacp08096 | B2 | KKLFKKILKYLKK | Analogue of BP 100 | Membrane disruption triggers apoptosis | MTT assay | K-562/ADM | Leukemia Cancer | IC50 = 39.6 ± 5.7 μM |
| dbacp08097 | B3 | KKLFKKILKYLKKL | Analogue of BP 100 | Membrane disruption triggers apoptosis | MTT assay | K-562 | Leukemia Cancer | IC50 = 47.4 ± 12.5 μM |
| dbacp08098 | B3 | KKLFKKILKYLKKL | Analogue of BP 100 | Membrane disruption triggers apoptosis | MTT assay | MCF-7 | Breast Cancer | IC50 = 25.3 ± 3.2 μM |
| dbacp08099 | B3 | KKLFKKILKYLKKL | Analogue of BP 100 | Membrane disruption triggers apoptosis | MTT assay | MCF-7/ADM | Breast Cancer | IC50 = 28.4 ± 3.1 μM |
| dbacp08100 | B5 | LKKLFKKILKYLK | Analogue of BP 100 | Membrane disruption triggers apoptosis | MTT assay | K-562 | Leukemia Cancer | IC50 = 26.5 ± 1.5 μM |
| dbacp08101 | B5 | LKKLFKKILKYLK | Analogue of BP 100 | Membrane disruption triggers apoptosis | MTT assay | MCF-7 | Breast Cancer | IC50 = 27.3 ± 2.4 μM |
| dbacp08102 | B5 | LKKLFKKILKYLK | Analogue of BP 100 | Membrane disruption triggers apoptosis | MTT assay | MCF-7/ADM | Breast Cancer | IC50 = 28.2 ± 2.7 μM |
| dbacp08103 | B5 | LKKLFKKILKYLK | Analogue of BP 100 | Membrane disruption triggers apoptosis | MTT assay | K-562/ADM | Leukemia Cancer | IC50 = 28.3 ± 2.3 μM |
| dbacp08104 | B6 | LKKLFKKILKYLKK | Analogue of BP 100 | Membrane disruption triggers apoptosis | MTT assay | K-562 | Leukemia Cancer | IC50 = 19.2 ± 2.3 μM |
| dbacp08105 | B6 | LKKLFKKILKYLKK | Analogue of BP 100 | Membrane disruption triggers apoptosis | MTT assay | MCF-7 | Breast Cancer | IC50 = 18.4 ± 1.5 μM |
| dbacp08106 | B6 | LKKLFKKILKYLKK | Analogue of BP 100 | Membrane disruption triggers apoptosis | MTT assay | MCF-7/ADM | Breast Cancer | IC50 = 20.7 ± 1.6 μM |
| dbacp08107 | B6 | LKKLFKKILKYLKK | Analogue of BP 100 | Membrane disruption triggers apoptosis | MTT assay | K-562/ADM | Leukemia Cancer | IC50 = 22.7 ± 2.3 μM |
| dbacp08108 | B9 | KLKKLFKKILKY | Analogue of BP 100 | Membrane disruption triggers apoptosis | MTT assay | K-562 | Leukemia Cancer | IC50 = 60.7 ± 5.4 μM |
| dbacp08109 | B9 | KLKKLFKKILKY | Analogue of BP 100 | Membrane disruption triggers apoptosis | MTT assay | MCF-7 | Breast Cancer | IC50 = 38.3 ± 2.5 μM |
| dbacp08110 | B9 | KLKKLFKKILKY | Analogue of BP 100 | Membrane disruption triggers apoptosis | MTT assay | MCF-7/ADM | Breast Cancer | IC50 = 30.6 ± 5.7 μM |
| dbacp08111 | B9 | KLKKLFKKILKY | Analogue of BP 100 | Membrane disruption triggers apoptosis | MTT assay | K-562/ADM | Leukemia Cancer | IC50 = 83.7 ± 5.3 μM |
| dbacp08112 | FR-15 | FRRFFKWFRRFFKFF | Synthetic | Proline-substituted AMP triggers mitochondrial apoptosis | MTT assay | MDA-MB-231 | Breast Cancer | IC50 = 3.15 μM |
| dbacp08113 | FR-15 | FRRFFKWFRRFFKFF | Synthetic | Proline-substituted AMP triggers mitochondrial apoptosis | MTT assay | HeLa | Cervical Cancer | IC50 = 4.9 μM |
| dbacp08114 | FR-15 | FRRFFKWFRRFFKFF | Synthetic | Proline-substituted AMP triggers mitochondrial apoptosis | MTT assay | DLD-1 | Colon Cancer | IC50 = 6.7 μM |
| dbacp08115 | FR-15 | FRRFFKWFRRFFKFF | Synthetic | Proline-substituted AMP triggers mitochondrial apoptosis | MTT assay | HepG-2 | Liver Cancer | IC50 = 2.5 μM |
| dbacp08116 | FR4P | FRRPFKWFRRFFKFF | Analogue of FR-15 | Proline-substituted AMP triggers mitochondrial apoptosis | MTT assay | MDA-MB-231 | Breast Cancer | IC50 = 6.3 μM |
| dbacp08117 | FR4P | FRRPFKWFRRFFKFF | Analogue of FR-15 | Proline-substituted AMP triggers mitochondrial apoptosis | MTT assay | HeLa | Cervical Cancer | IC50 = 7.7 μM |
| dbacp08118 | FR4P | FRRPFKWFRRFFKFF | Analogue of FR-15 | Proline-substituted AMP triggers mitochondrial apoptosis | MTT assay | DLD-1 | Colon Cancer | IC50 = 9.4 μM |
| dbacp08119 | FR4P | FRRPFKWFRRFFKFF | Analogue of FR-15 | Proline-substituted AMP triggers mitochondrial apoptosis | MTT assay | HepG-2 | Liver Cancer | IC50 = 2.5 μM |
| dbacp08120 | FR8P | FRRFFKWPRRFFKFF | Analogue of FR-15 | Proline-substituted AMP triggers mitochondrial apoptosis | MTT assay | MDA-MB-231 | Breast Cancer | IC50 = 6.4 μM |
| dbacp08121 | FR8P | FRRFFKWPRRFFKFF | Analogue of FR-15 | Proline-substituted AMP triggers mitochondrial apoptosis | MTT assay | HeLa | Cervical Cancer | IC50 = 10.5 μM |
| dbacp08122 | FR8P | FRRFFKWPRRFFKFF | Analogue of FR-15 | Proline-substituted AMP triggers mitochondrial apoptosis | MTT assay | DLD-1 | Colon Cancer | IC50 = 10.8 μM |
| dbacp08123 | FR8P | FRRFFKWPRRFFKFF | Analogue of FR-15 | Proline-substituted AMP triggers mitochondrial apoptosis | MTT assay | HepG-2 | Liver Cancer | IC50 = 4.2 μM |
| dbacp08124 | FR11P | FRRFFKWFRRPFKFF | Analogue of FR-15 | Proline-substituted AMP triggers mitochondrial apoptosis | MTT assay | MDA-MB-231 | Breast Cancer | IC50 = 7 μM |
| dbacp08125 | FR11P | FRRFFKWFRRPFKFF | Analogue of FR-15 | Proline-substituted AMP triggers mitochondrial apoptosis | MTT assay | HeLa | Cervical Cancer | IC50 = 11 μM |
| dbacp08126 | FR11P | FRRFFKWFRRPFKFF | Analogue of FR-15 | Proline-substituted AMP triggers mitochondrial apoptosis | MTT assay | DLD-1 | Colon Cancer | IC50 = 12.9 μM |
| dbacp08127 | FR11P | FRRFFKWFRRPFKFF | Analogue of FR-15 | Proline-substituted AMP triggers mitochondrial apoptosis | MTT assay | HepG-2 | Liver Cancer | IC50 = 4.8 μM |
| dbacp08128 | FR4,8P | FRRPFKWPRRFFKFF | Analogue of FR-15 | Proline-substituted AMP triggers mitochondrial apoptosis | MTT assay | MDA-MB-231 | Breast Cancer | IC50 = 15.4 μM |
| dbacp08129 | FR4,8P | FRRPFKWPRRFFKFF | Analogue of FR-15 | Proline-substituted AMP triggers mitochondrial apoptosis | MTT assay | HeLa | Cervical Cancer | IC50 = 13.8 μM |
| dbacp08130 | FR4,8P | FRRPFKWPRRFFKFF | Analogue of FR-15 | Proline-substituted AMP triggers mitochondrial apoptosis | MTT assay | DLD-1 | Colon Cancer | IC50 = 15.3 μM |
| dbacp08131 | FR4,8P | FRRPFKWPRRFFKFF | Analogue of FR-15 | Proline-substituted AMP triggers mitochondrial apoptosis | MTT assay | HepG-2 | Liver Cancer | IC50 = 5 μM |
| dbacp08132 | FR8,11P | FRRFFKWPRRPFKFF | Analogue of FR-15 | Proline-substituted AMP triggers mitochondrial apoptosis | MTT assay | MDA-MB-231 | Breast Cancer | IC50 = 27 μM |
| dbacp08133 | FR8,11P | FRRFFKWPRRPFKFF | Analogue of FR-15 | Proline-substituted AMP triggers mitochondrial apoptosis | MTT assay | HeLa | Cervical Cancer | IC50 = 18.9 μM |
| dbacp08134 | FR8,11P | FRRFFKWPRRPFKFF | Analogue of FR-15 | Proline-substituted AMP triggers mitochondrial apoptosis | MTT assay | DLD-1 | Colon Cancer | IC50 = 22 μM |
| dbacp08135 | FR8,11P | FRRFFKWPRRPFKFF | Analogue of FR-15 | Proline-substituted AMP triggers mitochondrial apoptosis | MTT assay | HepG-2 | Liver Cancer | IC50 = 15 μM |
| dbacp08136 | Laterosporulin10 (LS10) | ACVNQCPDAIDRFIVKDKGCHGVEKKYYKQVYVACMNGQHLYCRTEGGPCQL | Brevibacillus sp. strain SKDU10 | Apoptosis inducing | MTT assay | MCF-7 | Breast Cancer | 40% cytotoxicity at 5 μM concentration |
| dbacp08138 | Laterosporulin10 (LS10) | ACVNQCPDAIDRFIVKDKGCHGVEKKYYKQVYVACMNGQHLYCRTEGGPCQL | Brevibacillus sp. strain SKDU10 | Apoptosis inducing | MTT assay | HEK-293T | Renal Cancer | 20% cytotoxicity 5 μM concentration |
| dbacp08139 | Laterosporulin10 (LS10) | ACVNQCPDAIDRFIVKDKGCHGVEKKYYKQVYVACMNGQHLYCRTEGGPCQL | Brevibacillus sp. strain SKDU10 | Apoptosis inducing | MTT assay | HT-1080 | Fibrosarcoma | 20% cytotoxicity 5 μM concentration |
| dbacp08140 | Laterosporulin10 (LS10) | ACVNQCPDAIDRFIVKDKGCHGVEKKYYKQVYVACMNGQHLYCRTEGGPCQL | Brevibacillus sp. strain SKDU10 | Apoptosis inducing | MTT assay | HeLa | Cervical Cancer | 20% cytotoxicity 5 μM concentration |
| dbacp08142 | Laterosporulin10 (LS10) | ACVNQCPDAIDRFIVKDKGCHGVEKKYYKQVYVACMNGQHLYCRTEGGPCQL | Brevibacillus sp. strain SKDU10 | Apoptosis inducing | MTT assay | H-1299 | Lung Cancer | 80% cytotoxicity 10 μM concentration |
| dbacp08143 | MccJ25-18-4 | GGAGHVPEYFVGIGTPISFYG-WxEAAYQrFL | Synthetic | Apoptosis inducing | MTT assay | MCF-7 | Breast Cancer | IC50 = 14.2 ± 1.5 μM |
| dbacp08144 | MccJ25-18-4 | GGAGHVPEYFVGIGTPISFYG-WxEAAYQrFL | Synthetic | Apoptosis inducing | MTT assay | MDA-MB-435 | Breast Cancer | IC50 = 20.0 ± 0.5 μM |
| dbacp08145 | MccJ25-18-4 | GGAGHVPEYFVGIGTPISFYG-WxEAAYQrFL | Synthetic | Apoptosis inducing | MTT assay | MDA-MB-435-MDR | Breast Cancer | IC50 = 25.0 ± 0.5 μM |
| dbacp08146 | LfcinB-P13 | KCRRWLKRMKKLG | Synthetic analog of LFcinB | LfcinB-P13 induces liver cancer apoptosis | MTT assay | SMMC-7721 | Liver Cancer | IC50 = 41.8 µg/ml |
| dbacp08147 | Bothropoidin | Not Available | Bothrops pauloensis snake venom | Bothropoidin inhibits breast cancer progression | MTT assay | MDA-MB-231 | Breast Cancer | 30% cytotoxicity at 100 μg/mL |
| dbacp08152 | IL-1 | FKAGGFIKKLWRSLLA | Synthetic | Ile/Leu residues crucially mediate cytolysis | MTT assay | HeLa | Cervical Cancer | IC50 = 73.9 ± 13.6 μM |
| dbacp08153 | IL-1 | FKAGGFIKKLWRSLLA | Synthetic | Ile/Leu residues crucially mediate cytolysis | MTT assay | PC-3 | Prostate Cancer | IC50 = 58.4 ± 13.7 μM |
| dbacp08155 | IL-2 | FKIGGFAKKLWRSLLA | Synthetic | Ile/Leu residues crucially mediate cytolysis | MTT assay | HeLa | Cervical Cancer | IC50 = 52.0 ± 5.8 μM |
| dbacp08156 | IL-2 | FKIGGFAKKLWRSLLA | Synthetic | Ile/Leu residues crucially mediate cytolysis | MTT assay | PC-3 | Prostate Cancer | IC50 = 43.6 ± 7.9 μM |
| dbacp08158 | IL-3 | FKIGGFIKKAWRSLLA | Synthetic | Ile/Leu residues crucially mediate cytolysis | MTT assay | HeLa | Cervical Cancer | IC50 = 93.5 ± 19.4 μM |
| dbacp08159 | IL-3 | FKIGGFIKKAWRSLLA | Synthetic | Ile/Leu residues crucially mediate cytolysis | MTT assay | PC-3 | Prostate Cancer | IC50 = 74.9 ± 13.3 μM |
| dbacp08161 | IL-4 | FKIGGFIKKLWRSALA | Synthetic | Ile/Leu residues crucially mediate cytolysis | MTT assay | HeLa | Cervical Cancer | IC50 = 54.4 ± 3.0 μM |
| dbacp08162 | IL-4 | FKIGGFIKKLWRSALA | Synthetic | Ile/Leu residues crucially mediate cytolysis | MTT assay | PC-3 | Prostate Cancer | IC50 = 35.5 ± 3.9 μM |
| dbacp08164 | IL-5 | FKIGGFIKKLWRSLAA | Synthetic | Ile/Leu residues crucially mediate cytolysis | MTT assay | HeLa | Cervical Cancer | IC50 = 28.0 ± 4.6 μM |
| dbacp08165 | IL-5 | FKIGGFIKKLWRSLAA | Synthetic | Ile/Leu residues crucially mediate cytolysis | MTT assay | PC-3 | Prostate Cancer | IC50 = 22.0 ± 2.6 μM |
| dbacp08253 | Cecropin XJ | APEPRWKIFKKIEKMGRNIRDGIVKAGPAIEVLGSAKAIGK | Larvae of Bombyx mori | CecropinXJ induces apoptosis in HCC | MTT assay | Huh-7 | Liver Cancer | Cell viability = 50% at 50 µmol/l |
| dbacp08254 | Tr1 | Not Available | Protein extraction from Spirulina platensis | Not Available | MTT assay | MCF-7 | Breast Cancer | IC50 = 60.12 μg/mL |
| dbacp08255 | Tr1 | Not Available | Protein extraction from Spirulina platensis | Not Available | MTT assay | HepG-2 | Liver Cancer | IC50 = 147.03 μg/mL |
| dbacp08256 | Tr2 | Not Available | Protein extraction from Spirulina platensis | Not Available | MTT assay | MCF-7 | Breast Cancer | IC50 < 31.25 μg/mL |
| dbacp08257 | Tr2 | Not Available | Protein extraction from Spirulina platensis | Not Available | MTT assay | HepG-2 | Liver Cancer | IC50 = 36.42 μg/mL |
| dbacp08258 | Tr2 | Not Available | Protein extraction from Spirulina platensis | Not Available | MTT assay | SGC-7901 | Gastric Cancer | IC50 = 48.25 μg/mL |
| dbacp08259 | Tr3 | Not Available | Protein extraction from Spirulina platensis | Not Available | MTT assay | HT-29 | Colon Cancer | IC50 = 112.89 μg/mL |
| dbacp08260 | Tr4 | Not Available | Protein extraction from Spirulina platensis | Not Available | MTT assay | MCF-7 | Breast Cancer | IC50 = 238.86 μg/mL |
| dbacp08261 | Tr4 | Not Available | Protein extraction from Spirulina platensis | Not Available | MTT assay | HepG-2 | Liver Cancer | IC50 = 176.37 μg/mL |
| dbacp08262 | HR | HVLSRAPR | Fraction identified from Tr1 | Not Available | MTT assay | HT-29 | Colon Cancer | IC50 = 99.88 μg/mL |
| dbacp08263 | HR | HVLSRAPR | Fraction identified from Tr1 | Not Available | MTT assay | HepG-2 | Liver Cancer | 22% inhibition at 500 μg/mL |
| dbacp08264 | HR | HVLSRAPR | Fraction identified from Tr1 | Not Available | MTT assay | SGC-7901 | Gastric Cancer | 20% inhibition at 500 μg/mL |
| dbacp08265 | HR | HVLSRAPR | Fraction identified from Tr1 | Not Available | MTT assay | A-549 | Lung Cancer | 15% inhibition at 500 μg/mL |
| dbacp08266 | ZXR-2 | FKIGGFIKKLWRSLLA | Synthetic | Not Available | MTT assay | HeLa | Cervical Cancer | IC50 = 8.1 ± 1.6 μM |
| dbacp08267 | ZXR-2 | FKIGGFIKKLWRSLLA | Synthetic | Not Available | MTT assay | SACC-83 | Salivary Cancer | IC50 = 9.9 ± 1.7 μM |
| dbacp08268 | ZXR-2 | FKIGGFIKKLWRSLLA | Synthetic | Not Available | MTT assay | HepG-2 | Liver Cancer | IC50 = 7.5 ± 1.2 μM |
| dbacp08269 | ZXR-2 | FKIGGFIKKLWRSLLA | Synthetic | Not Available | MTT assay | Huh-7 | Liver Cancer | IC50 = 8.4 ± 1.1 μM |
| dbacp08270 | ZXR-2 | FKIGGFIKKLWRSLLA | Synthetic | Not Available | MTT assay | PC-3 | Prostate Cancer | IC50 = 14.2 ± 0.5 μM |
| dbacp08271 | ZXR-2 | FKIGGFIKKLWRSLLA | Synthetic | Not Available | MTT assay | 293T | Kidney Cancer | IC50 = 6.3 ± 0.7 μM |
| dbacp08272 | [Lys5,6] TG | UGLUKKLUGI | Trichogin GA | Not Available | MTT assay | T-67 | Brain Tumor | EC50 = 7 µM |
| dbacp08273 | [Lys5,6] TG | UGLUKKLUGI | Trichogin GA | Not Available | MTT assay | HeLa | Cervical Cancer | EC50 = 10 µM |
| dbacp08274 | [Lys6] TG | UGLUGKLUGI | Trichogin GA | Not Available | MTT assay | T-67 | Brain Tumor | EC50 = 4 µM |
| dbacp08275 | [Lys6] TG | UGLUGKLUGI | Trichogin GA | Not Available | MTT assay | HeLa | Cervical Cancer | EC50 = 2 µM |
| dbacp08276 | Trichogin GA | UGLUGGLUGI | Trichoderma longibrachiatum | Not Available | MTT assay | T-67 | Brain Tumor | EC50 = 2 µM |
| dbacp08277 | Trichogin GA | UGLUGGLUGI | Trichoderma longibrachiatum | Not Available | MTT assay | HeLa | Cervical Cancer | EC50 = 8 µM |
| dbacp08278 | [TOAC1] TG | XGLUGGLUGI | Trichogin GA | Not Available | MTT assay | T-67 | Brain Tumor | EC50 = 1 µM |
| dbacp08279 | [TOAC1] TG | XGLUGGLUGI | Trichogin GA | Not Available | MTT assay | HeLa | Cervical Cancer | EC50 = 3 µM |
| dbacp08280 | [TOAC1, Lys6] TG | XGLUGKLUGI | Trichogin GA | Not Available | MTT assay | T-67 | Brain Tumor | EC50 = 1 µM |
| dbacp08281 | [TOAC1, Lys6] TG | XGLUGKLUGI | Trichogin GA | Not Available | MTT assay | HeLa | Cervical Cancer | EC50 = 3 µM |
| dbacp08282 | [Arg2] TG | URLUGGLUGI | Trichogin GA | Not Available | MTT assay | T-67 | Brain Tumor | EC50 = 8 µM |
| dbacp08283 | [Arg2] TG | URLUGGLUGI | Trichogin GA | Not Available | MTT assay | HeLa | Cervical Cancer | EC50 = 4 µM |
| dbacp08284 | [TOAC1, Arg2] TG | XRLUGGLUGI | Trichogin GA | Not Available | MTT assay | T-67 | Brain Tumor | EC50 = 8 µM |
| dbacp08285 | [TOAC1, Arg2] TG | XRLUGGLUGI | Trichogin GA | Not Available | MTT assay | HeLa | Cervical Cancer | EC50 = 9 µM |
| dbacp08286 | [TOAC1, Arg9] TG | XGLUGGLURI | Trichogin GA | Not Available | MTT assay | T-67 | Brain Tumor | EC50 = 8 µM |
| dbacp08287 | [TOAC1, Arg9] TG | XGLUGGLURI | Trichogin GA | Not Available | MTT assay | HeLa | Cervical Cancer | EC50 = 5 µM |
| dbacp08288 | [TOAC1, Lys5,6] TG | XGLUKKLUGI | Trichogin GA | Not Available | MTT assay | T-67 | Brain Tumor | EC50 = 10 µM |
| dbacp08289 | [TOAC1, Lys5,6] TG | XGLUKKLUGI | Trichogin GA | Not Available | MTT assay | HeLa | Cervical Cancer | EC50 = 6 µM |
| dbacp08290 | [TOAC1, Api4] TG | XGLZGGLUGI | Trichogin GA | Not Available | MTT assay | T-67 | Brain Tumor | EC50 = 13 µM |
| dbacp08291 | L-Carnosine | Beta-AH | Synthetic | Not Available | MTT assay | A-2780 | Ovarian Cancer | IC50 = 165 mM |
| dbacp08292 | L-Carnosine | Beta-AH | Synthetic | Not Available | MTT assay | OVCAR-3 | Ovarian Cancer | IC50 = 125 mM |
| dbacp08293 | L-Carnosine | Beta-AH | Synthetic | Not Available | MTT assay | SK-OV-3 | Ovarian Cancer | IC50 = 485 mM |
| dbacp08294 | CA4 | CGPCFTTDHNMARKCDECCGGKGRGKCFGPQCLCR | Synthetic | Not Available | MTT assay | U-251 | Brain Tumor | Graph Figure 2 |
| dbacp08295 | CTX-23 | VCMPCFTTDQQMARKCSDCCGGKGRGKCYGPQCLCR | Synthetic | Not Available | MTT assay | U-251 | Brain Tumor | Graph Figure 2 |
| dbacp08296 | BnSP-6 | SLFELGKMILQETGKNPAKSYGAYGCNCGVLGRGGPKDATDRCCYVHKCCYKKLTGCDPKKDRYSYSWKDKTIVCGENNPCLKELCECDKAVAICLRENLGTYNKKYRYHLKPFCKKADPC | B. pauloensis | Not Available | MTT assay | MDA-MB-231 | Breast Cancer | 45% cell cytotoxicity at 100 μg/mL |
| dbacp08297 | DN1 | ILGKIVKKLVSDF | Synthetic | Not Available | MTT assay | HepG-2 | Liver Cancer | 152.17 ± 7.73 μM |
| dbacp08298 | DN4 | ILGKIWKGIVSDF | Synthetic | Not Available | MTT assay | HepG-2 | Liver Cancer | 191.67 ± 12.02 μM |
| dbacp08299 | SKACP003 | FPLPCAYKGTYC | Synthetic | Not Available | MTT assay | MCF-7 | Breast Cancer | IC50 = 193 ± 0.5 µM |
| dbacp08300 | SKACP003 | FPLPCAYKGTYC | Synthetic | Not Available | MTT assay | MDA-MB-231 | Breast Cancer | IC50 = 212 ± 0.5 µM |
| dbacp08301 | SKACP003 | FPLPCAYKGTYC | Synthetic | Not Available | MTT assay | MDA-MB-453 | Breast Cancer | IC50 = 156 ± 0.5 µM |
| dbacp08302 | RF13 | RRGKGGRRVTMSF | VSP26B of C. striatus | Not Available | MTT assay | HEp-2 | Larynx Cancer | IC50 = 49.65 µM |
| dbacp08304 | MAD1 | KRWHWWRRHWVVW | Synthetic | Not Available | MTT assay | OVCAR-3 | Ovarian Cancer | IC50 = 14.2 μM |
| dbacp08305 | MAD1 | KRWHWWRRHWVVW | Synthetic | Not Available | MTT assay | A-549 | Lung Cancer | IC50 = 36.2 μM |
| dbacp08306 | MAD1 | KRWHWWRRHWVVW | Synthetic | Not Available | MTT assay | NCI/ADR-RES | Ovarian Cancer | IC50 = 85.6 μM |
| dbacp08307 | DAP1 | LWKRWVGVWRKWL | Synthetic | Not Available | MTT assay | A-549 | Lung Cancer | IC50 = 11.9 μM |
| dbacp08308 | DAP1 | LWKRWVGVWRKWL | Synthetic | Not Available | MTT assay | OVCAR-3 | Ovarian Cancer | IC50 = 8.6 μM |
| dbacp08309 | DAP1 | LWKRWVGVWRKWL | Synthetic | Not Available | MTT assay | NCI/ADR-RES | Ovarian Cancer | IC50 = 14.0 μM |
| dbacp08310 | DAP1 | LWKRWVGVWRKWL | Synthetic | Not Available | MTT assay | T-24 | Bladder Cancer | IC50 = 15.3 μM |
| dbacp08311 | AMP1 | WKWLKKWIK | Synthetic | Not Available | MTT assay | OVCAR-3 | Ovarian Cancer | IC50 = 51.1 μM |
| dbacp08312 | AMP2 | KRWWKWWRR | Synthetic | Not Available | MTT assay | OVCAR-3 | Ovarian Cancer | IC50 = 53.5 μM |
| dbacp08342 | VLL-28 | VLLVTLTRLHQRGVIYEKWRHFSGRKYR | Sulfolobus islandicus | Not Available | MTT assay | HEK-293T | Renal Cancer | IC50 = 10 μM |
| dbacp08417 | 5-2C | NYPQRPCRGDKGPDC | Synthetic | Not Available | MTT assay | U343 | Glioblastoma | IC50 = 0.781 μM |
| dbacp08418 | 5-2C | NYPQRPCRGDKGPDC | Synthetic | Not Available | MTT assay | U373MG | Glioblastoma | IC50 = 0.8717 μM |
| dbacp08419 | 5-2C | NYPQRPCRGDKGPDC | Synthetic | Not Available | MTT assay | U251 | Glioblastoma | IC50 = 0.7607 μM |
| dbacp08420 | 5-2C | NYPQRPCRGDKGPDC | Synthetic | Not Available | MTT assay | U87-MG | Glioblastoma | IC50 = 0.9164 μM |
| dbacp08421 | 5-2C | NYPQRPCRGDKGPDC | Synthetic | Not Available | MTT assay | HepG-2 | Liver Cancer | IC50 = 3.064 μM |
| dbacp08422 | 5-2C | NYPQRPCRGDKGPDC | Synthetic | Not Available | MTT assay | Hep3B | Liver Cancer | IC50 = 0.7847 μM |
| dbacp08423 | 5-2C | NYPQRPCRGDKGPDC | Synthetic | Not Available | MTT assay | 293T | Renal Cancer | IC50 = 1.107 μM |
| dbacp08424 | 5-2C | NYPQRPCRGDKGPDC | Synthetic | Not Available | MTT assay | MCF-7 | Breast Cancer | IC50 = 9.74 μM |
| dbacp08425 | 5-2C | NYPQRPCRGDKGPDC | Synthetic | Not Available | MTT assay | MDA-MB-231 | Breast Cancer | IC50 = 0.8061 μM |
| dbacp08426 | 5-2C | NYPQRPCRGDKGPDC | Synthetic | Not Available | MTT assay | HL-60 | Blood Cancer | IC50 = 1.111 μM |
| dbacp08427 | 5-2C | NYPQRPCRGDKGPDC | Synthetic | Not Available | MTT assay | K-562 | Blood Cancer | IC50 = 1.103 μM |
| dbacp08428 | 5-2C | NYPQRPCRGDKGPDC | Synthetic | Not Available | MTT assay | Hel | Blood Cancer | IC50 = 1.055 μM |
| dbacp08433 | Alpha-gliadin peptide p31-43 | LGQQQPFPPQQPY | Synthetic | Not Available | MTT assay | A-549 | Lung Cancer | 9.4% growth inhibition at 70 μg/mL |
| dbacp08434 | Alpha-gliadin peptide p31-43 | LGQQQPFPPQQPY | Synthetic | Not Available | MTT assay | NCI-H1975 | Lung Cancer | 36.3% growth inhibition at 70 μg/mL |
| dbacp08435 | Alpha-gliadin peptide p31-43 | LGQQQPFPPQQPY | Synthetic | Not Available | MTT assay | PANC-1 | Pancreatic Cancer | 26.2% growth inhibition at 70 μg/mL |